F403009

General Info

Members Datasets Scaffolds Average Seq Length
315 171 630 215

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100003818|Ga0070682_1000038181
Length 258
Sequence VDHCNPTQARSEHHAFARRRTSCRGADVLHSPTATRYKRRKLRIVACAGLVLVFVSFASAQSIDRTDNQFWSDVQLAVPVTKTVDLNFLGTLRIGRDFSHPVDERVGVGFTFRFGKYLSVAPNYLGIGMQPVPRRRIWENRLSLPVTVRFNVDKFRLSDRNLIERRFRNSGARATRYRNRFQVEHPVGPDDLGLSLYVADEVFYDWTTDRWVRNRFTVGASKVFNKHFTEDFYYLRQNDGVSVPGDLNVIGTSLRFRL

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
143 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
144 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
145 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
148 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
149 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
153 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
154 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
157 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
158 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
159 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
160 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
161 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
162 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
163 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
164 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.22
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 20.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100003818 3300005337 Bacteria 8370
2 SwRhRL2b_contig_1332272 2162886007 Bacteria 986
3 MBSR1b_contig_2606821 2162886012 Bacteria 893
4 JGI24034J14986_101100 3300001432 Unclassified 1584
5 rootL2_10159216 3300003322 Bacteria 3230
6 Ga0065714_10064432 3300005288 Bacteria 133542
7 Ga0065704_10071170 3300005289 Bacteria 12695
8 Ga0065712_10067730 3300005290 Bacteria 133482
9 Ga0065715_10009713 3300005293 Bacteria 4340
10 Ga0065715_10199609 3300005293 Unclassified 1369
11 Ga0065715_10436328 3300005293 Unclassified 841
12 Ga0065707_10000836 3300005295 Bacteria 19661
13 Ga0065707_10138003 3300005295 Bacteria 1812
14 Ga0070690_100600826 3300005330 Unclassified 835
15 Ga0070670_100000324 3300005331 Bacteria 40556
16 Ga0068869_100007198 3300005334 Bacteria 7093
17 Ga0068869_100480499 3300005334 Unclassified 1034
18 Ga0070680_100039165 3300005336 Bacteria 3836
19 Ga0070682_100635809 3300005337 Unclassified 847
20 Ga0070689_100593933 3300005340 Unclassified 958
21 Ga0070687_100214789 3300005343 Unclassified 1174
22 Ga0070692_10082663 3300005345 Bacteria 1732
23 Ga0070692_10387755 3300005345 Unclassified 878
24 Ga0070675_100565918 3300005354 Bacteria 1029
25 Ga0070673_100031274 3300005364 Bacteria 3993
26 Ga0070673_100659919 3300005364 Unclassified 958
27 Ga0070688_100658579 3300005365 Unclassified 807
28 Ga0070659_100011980 3300005366 Bacteria 6419
29 Ga0070703_10039668 3300005406 Bacteria 1460
30 Ga0070705_100111671 3300005440 Bacteria 1748
31 Ga0070705_100333726 3300005440 Bacteria 1099
32 Ga0070705_100388542 3300005440 Unclassified 1029
33 Ga0070700_100048464 3300005441 Bacteria 2633
34 Ga0070700_100106971 3300005441 Bacteria 1853
35 Ga0070700_100134044 3300005441 Bacteria 1675
36 Ga0070694_100006095 3300005444 Bacteria 7315
37 Ga0070694_100007619 3300005444 Bacteria 6610
38 Ga0070694_100086708 3300005444 Bacteria 2188
39 Ga0070694_100168206 3300005444 Bacteria 1613
40 Ga0070708_100003456 3300005445 Bacteria 12360
41 Ga0070681_10002627 3300005458 Bacteria 16490
42 Ga0068867_100023041 3300005459 Bacteria 4456
43 Ga0068867_100039167 3300005459 Bacteria 3454
44 Ga0068867_100129384 3300005459 Bacteria 1960
45 Ga0068867_100198115 3300005459 Bacteria 1606
46 Ga0068867_100341200 3300005459 Bacteria 1247
47 Ga0070706_100000480 3300005467 Bacteria 47075
48 Ga0070706_100109518 3300005467 Unclassified 2570
49 Ga0070706_100431226 3300005467 Bacteria 1227
50 Ga0070707_100040034 3300005468 Bacteria 4482
51 Ga0070707_100085396 3300005468 Bacteria 3051
52 Ga0070698_100761575 3300005471 Unclassified 911
53 Ga0070699_100011147 3300005518 Bacteria 7769
54 Ga0070699_100307926 3300005518 Bacteria 1422
55 Ga0070679_100086343 3300005530 Bacteria 3124
56 Ga0070697_100038065 3300005536 Bacteria 3886
57 Ga0070697_100103350 3300005536 Unclassified 2368
58 Ga0070686_100101017 3300005544 Bacteria 1949
59 Ga0070686_100257534 3300005544 Unclassified 1277
60 Ga0070695_100012382 3300005545 Bacteria 5116
61 Ga0070696_100046562 3300005546 Bacteria 3008
62 Ga0070696_100063605 3300005546 Bacteria 2585
63 Ga0070693_100001894 3300005547 Bacteria 9555
64 Ga0070693_100043444 3300005547 Bacteria 2538
65 Ga0070693_100066768 3300005547 Unclassified 2106
66 Ga0070704_100042886 3300005549 Bacteria 3132
67 Ga0070704_100043771 3300005549 Bacteria 3106
68 Ga0070704_100085385 3300005549 Bacteria 2336
69 Ga0070664_100535601 3300005564 Bacteria 1082
70 Ga0068854_100039573 3300005578 Bacteria 3323
71 Ga0068854_100123387 3300005578 Bacteria 1970
72 Ga0068854_100233735 3300005578 Bacteria 1460
73 Ga0070702_100007655 3300005615 Bacteria 5180
74 Ga0070702_100042904 3300005615 Bacteria 2546
75 Ga0068852_100403503 3300005616 Unclassified 1345
76 Ga0068859_100006869 3300005617 Bacteria 11556
77 Ga0068859_100015271 3300005617 Bacteria 7712
78 Ga0068859_100024597 3300005617 Bacteria 6042
79 Ga0068859_100118625 3300005617 Bacteria 2712
80 Ga0068859_100201196 3300005617 Bacteria 2076
81 Ga0068859_100728092 3300005617 Unclassified 1082
82 Ga0068864_100085347 3300005618 Bacteria 2776
83 Ga0068861_100031944 3300005719 Bacteria 3873
84 Ga0068861_100171289 3300005719 Bacteria 1800
85 Ga0068851_10000390 3300005834 Bacteria 19872
86 Ga0068870_10166949 3300005840 Bacteria 1310
87 Ga0068863_100659793 3300005841 Bacteria 1038
88 Ga0068863_100703306 3300005841 Unclassified 1005
89 Ga0068858_100030948 3300005842 Bacteria 4970
90 Ga0068858_100194274 3300005842 Bacteria 1918
91 Ga0068858_100362870 3300005842 Bacteria 1388
92 Ga0068860_100051415 3300005843 Bacteria 3921
93 Ga0068860_100060535 3300005843 Bacteria 3598
94 Ga0068860_100074948 3300005843 Bacteria 3219
95 Ga0068860_100076488 3300005843 Bacteria 3183
96 Ga0068862_100693419 3300005844 Unclassified 986
97 Ga0081539_10003930 3300005985 Bacteria 17250
98 Ga0097621_100025216 3300006237 Bacteria 4649
99 Ga0068871_100009380 3300006358 Bacteria 7087
100 Ga0068871_100346606 3300006358 Bacteria 1313
101 Ga0075428_100164253 3300006844 Bacteria 2409
102 Ga0075428_100678529 3300006844 Bacteria 1098
103 Ga0075428_100757269 3300006844 Bacteria 1033
104 Ga0075430_100259785 3300006846 Bacteria 1438
105 Ga0075431_100203218 3300006847 Bacteria 2026
106 Ga0075433_10107865 3300006852 Bacteria 2469
107 Ga0075433_10187636 3300006852 Bacteria 1839
108 Ga0075433_10241750 3300006852 Bacteria 1603
109 Ga0075433_10350191 3300006852 Bacteria 1305
110 Ga0075433_10919243 3300006852 Bacteria 763
111 Ga0075434_100000642 3300006871 Bacteria 27039
112 Ga0075434_100196730 3300006871 Bacteria 2036
113 Ga0075434_100318517 3300006871 Bacteria 1576
114 Ga0075429_100047946 3300006880 Bacteria 3715
115 Ga0097620_100006869 3300006931 Bacteria 11556
116 Ga0097620_100015272 3300006931 Bacteria 7712
117 Ga0097620_100024598 3300006931 Bacteria 6042
118 Ga0097620_100118618 3300006931 Bacteria 2712
119 Ga0097620_100201193 3300006931 Bacteria 2076
120 Ga0097620_100728100 3300006931 Unclassified 1082
121 Ga0075435_100048997 3300007076 Bacteria 3395
122 Ga0105251_10121316 3300009011 Unclassified 1187
123 Ga0105240_10043592 3300009093 Bacteria 5707
124 Ga0111539_10000296 3300009094 Bacteria 60206
125 Ga0111539_10588980 3300009094 Bacteria 1295
126 Ga0111539_11236046 3300009094 Unclassified 867
127 Ga0105245_10809168 3300009098 Bacteria 975
128 Ga0105247_10006088 3300009101 Bacteria 7498
129 Ga0114129_10055898 3300009147 Bacteria 5531
130 Ga0114129_10059706 3300009147 Bacteria 5331
131 Ga0114129_10101488 3300009147 Bacteria 3981
132 Ga0114129_10132503 3300009147 Bacteria 3422
133 Ga0114129_10155451 3300009147 Bacteria 3128
134 Ga0114129_10298292 3300009147 Bacteria 2149
135 Ga0105243_10000446 3300009148 Bacteria 43049
136 Ga0105243_10034946 3300009148 Bacteria 3896
137 Ga0105243_10047702 3300009148 Unclassified 3374
138 Ga0105243_10483568 3300009148 Bacteria 1169
139 Ga0105241_10077036 3300009174 Bacteria 2602
140 Ga0105241_10130679 3300009174 Bacteria 2033
141 Ga0105241_10353418 3300009174 Bacteria 1277
142 Ga0105241_10368851 3300009174 Unclassified 1251
143 Ga0105242_10000118 3300009176 Bacteria 57840
144 Ga0105242_10127602 3300009176 Bacteria 2191
145 Ga0105242_10191501 3300009176 Bacteria 1811
146 Ga0105242_10529801 3300009176 Unclassified 1126
147 Ga0105248_10007391 3300009177 Bacteria 12059
148 Ga0105248_10016258 3300009177 Bacteria 8190
149 Ga0105248_10140862 3300009177 Bacteria 2720
150 Ga0105248_10284942 3300009177 Unclassified 1860
151 Ga0105248_10970732 3300009177 Bacteria 960
152 Ga0105237_10004419 3300009545 Bacteria 16295
153 Ga0105237_10295493 3300009545 Unclassified 1623
154 Ga0105237_10710423 3300009545 Bacteria 1012
155 Ga0105237_10814148 3300009545 Unclassified 941
156 Ga0105238_10077111 3300009551 Bacteria 3325
157 Ga0105249_10927231 3300009553 Unclassified 938
158 Ga0105239_10104590 3300010375 Unclassified 3135
159 Ga0105239_10663309 3300010375 Bacteria 1192
160 Ga0105246_10142205 3300011119 Bacteria 1806
161 Ga0105246_10311252 3300011119 Bacteria 1276
162 Ga0157373_10002570 3300013100 Bacteria 13790
163 Ga0157373_10457566 3300013100 Unclassified 919
164 Ga0157378_10000004 3300013297 Bacteria 201051
165 Ga0157378_10047867 3300013297 Bacteria 3802
166 Ga0157378_10071530 3300013297 Bacteria 3115
167 Ga0157378_10205752 3300013297 Bacteria 1864
168 Ga0163162_10531286 3300013306 Bacteria 1305
169 Ga0157372_11134126 3300013307 Unclassified 904
170 Ga0157375_10028125 3300013308 Bacteria 5264
171 Ga0157375_10775957 3300013308 Bacteria 1108
172 Ga0163163_10001138 3300014325 Bacteria 22621
173 Ga0163163_10236264 3300014325 Bacteria 1877
174 Ga0163163_11227503 3300014325 Unclassified 812
175 Ga0157380_10404417 3300014326 Bacteria 1296
176 Ga0207656_10017076 3300025321 Bacteria 2838
177 Ga0207653_10001209 3300025885 Bacteria 8437
178 Ga0207710_10003142 3300025900 Bacteria 7398
179 Ga0207647_10019861 3300025904 Bacteria 4511
180 Ga0207647_10088988 3300025904 Unclassified 1843
181 Ga0207699_10467284 3300025906 Unclassified 907
182 Ga0207684_10000533 3300025910 Bacteria 47088
183 Ga0207654_10013969 3300025911 Bacteria 4140
184 Ga0207707_10063861 3300025912 Bacteria 3204
185 Ga0207671_10004693 3300025914 Bacteria 12916
186 Ga0207671_10096817 3300025914 Unclassified 2230
187 Ga0207660_10038590 3300025917 Bacteria 3335
188 Ga0207662_10349013 3300025918 Unclassified 993
189 Ga0207646_10094144 3300025922 Bacteria 2683
190 Ga0207681_10016868 3300025923 Bacteria 4579
191 Ga0207650_10000112 3300025925 Bacteria 106714
192 Ga0207650_10257636 3300025925 Bacteria 1414
193 Ga0207659_10362082 3300025926 Bacteria 1206
194 Ga0207690_10021784 3300025932 Bacteria 3979
195 Ga0207686_10000725 3300025934 Bacteria 20487
196 Ga0207686_10298180 3300025934 Bacteria 1196
197 Ga0207709_10005553 3300025935 Bacteria 7145
198 Ga0207709_10051804 3300025935 Bacteria 2517
199 Ga0207709_10169231 3300025935 Bacteria 1532
200 Ga0207709_10517662 3300025935 Bacteria 933
201 Ga0207670_10199011 3300025936 Unclassified 1521
202 Ga0207704_10333708 3300025938 Bacteria 1174
203 Ga0207711_10016058 3300025941 Bacteria 6212
204 Ga0207711_10024114 3300025941 Bacteria 5092
205 Ga0207689_10174940 3300025942 Bacteria 1770
206 Ga0207689_10178174 3300025942 Bacteria 1753
207 Ga0207689_10391161 3300025942 Unclassified 1158
208 Ga0207689_10476847 3300025942 Bacteria 1044
209 Ga0207651_10021027 3300025960 Bacteria 3955
210 Ga0207651_10478568 3300025960 Unclassified 1073
211 Ga0207640_10069484 3300025981 Bacteria 2365
212 Ga0207640_10103851 3300025981 Bacteria 1999
213 Ga0207677_10299693 3300026023 Bacteria 1327
214 Ga0207703_10262579 3300026035 Bacteria 1561
215 Ga0207639_10066480 3300026041 Bacteria 2802
216 Ga0207708_10000074 3300026075 Bacteria 79215
217 Ga0207708_10033927 3300026075 Bacteria 3880
218 Ga0207708_10077108 3300026075 Bacteria 2558
219 Ga0207708_10168501 3300026075 Bacteria 1733
220 Ga0207641_10036046 3300026088 Bacteria 4127
221 Ga0207641_10097689 3300026088 Bacteria 2582
222 Ga0207648_10440490 3300026089 Bacteria 1185
223 Ga0207676_10108429 3300026095 Bacteria 2318
224 Ga0207676_10187782 3300026095 Bacteria 1816
225 Ga0207676_10242965 3300026095 Bacteria 1616
226 Ga0207676_10265269 3300026095 Bacteria 1553
227 Ga0207676_10380431 3300026095 Bacteria 1314
228 Ga0207674_10085142 3300026116 Unclassified 3158
229 Ga0207674_10234230 3300026116 Bacteria 1784
230 Ga0207675_100015659 3300026118 Bacteria 7072
231 Ga0207675_100418079 3300026118 Bacteria 1324
232 Ga0207428_10002868 3300027907 Bacteria 17091
233 Ga0207428_10116085 3300027907 Bacteria 2056
234 Ga0268265_10053471 3300028380 Bacteria 3060
235 Ga0268264_10035583 3300028381 Bacteria 4099
236 Ga0268264_10118054 3300028381 Bacteria 2334
237 Ga0268264_10590572 3300028381 Bacteria 1093
238 Ga0307405_10039452 3300031731 Bacteria 2854
239 Ga0307405_10307917 3300031731 Unclassified 1205
240 Ga0307406_10120760 3300031901 Bacteria 1821
241 Ga0307409_100365777 3300031995 Bacteria 1366
242 Ga0307409_100420523 3300031995 Bacteria 1282
243 Ga0307416_100335788 3300032002 Bacteria 1521
244 Ga0307416_100480001 3300032002 Bacteria 1303
245 Ga0307416_101020882 3300032002 Unclassified 930
246 Ga0307414_10128223 3300032004 Bacteria 1964
247 Ga0307414_10174867 3300032004 Bacteria 1721
248 Ga0307414_10362507 3300032004 Archaea 1248
249 Ga0307414_10394537 3300032004 Bacteria 1200
250 Ga0307411_10049751 3300032005 Bacteria 2726
251 Ga0307411_10065714 3300032005 Bacteria 2434
252 Ga0307411_10176795 3300032005 Bacteria 1616
253 Ga0307415_100028873 3300032126 Bacteria 3537
254 Ga0307415_100138246 3300032126 Bacteria 1856
255 Ga0307415_100394955 3300032126 Unclassified 1179
256 Ga0395899_0116420 3300037312 Bacteria 1918
257 Ga0395900_0096299 3300037418 Bacteria 3041
258 Ga0395898_0646393 3300037466 Bacteria 1000
259 Ga0242419_008690 3300038698 Bacteria 762
260 Ga0242420_023228 3300038996 Bacteria 1119
261 Ga0453684_1721741 3300044712 Unclassified 640
262 Ga0495636_0012306 3300047318 Bacteria 3388
263 Ga0496104_0603515 3300048907 Bacteria 1008
264 Ga0496106_0006927 3300048909 Bacteria 8384
265 Ga0496107_0079323 3300048910 Bacteria 2393
266 Ga0496107_0596921 3300048910 Bacteria 816
267 Ga0496108_0565739 3300048911 Bacteria 991
268 Ga0496110_0144691 3300048913 Bacteria 2150
269 Ga0496111_1041864 3300048914 Unclassified 585
270 Ga0501293_007358 3300049516 Bacteria 911
271 Ga0501296_009345 3300049519 Unclassified 1148
272 Ga0501298_008423 3300049521 Bacteria 1732
273 Ga0501299_006945 3300049522 Bacteria 1789
274 Ga0501048_0170469 3300049582 Bacteria 1542
275 Ga0501202_006543 3300049652 Bacteria 2088
276 Ga0501202_009449 3300049652 Unclassified 1793
277 Ga0501202_040592 3300049652 Unclassified 1003
278 Ga0501207_027924 3300049654 Unclassified 937
279 Ga0501216_011513 3300049660 Bacteria 1439
280 Ga0501217_020087 3300049661 Bacteria 1565
281 Ga0501217_082350 3300049661 Unclassified 892
282 Ga0501223_003218 3300049663 Bacteria 3570
283 Ga0501227_002441 3300049665 Bacteria 4103
284 Ga0501228_006621 3300049666 Bacteria 1063
285 Ga0501233_002049 3300049668 Bacteria 3517
286 Ga0501233_006922 3300049668 Bacteria 2145
287 Ga0501235_026590 3300049669 Unclassified 1297
288 Ga0501236_054502 3300049670 Bacteria 695
289 Ga0501253_041629 3300049683 Unclassified 928
290 Ga0501257_047218 3300049686 Unclassified 1068
291 Ga0501257_099440 3300049686 Bacteria 763
292 Ga0501257_100606 3300049686 Unclassified 759
293 Ga0501257_107807 3300049686 Unclassified 736
294 Ga0501234_014431 3300049707 Unclassified 1241
295 Ga0501245_012265 3300049708 Bacteria 1256
296 Ga0501268_019924 3300049765 Bacteria 1139
297 Ga0501273_003028 3300049770 Bacteria 1753
298 Ga0501204_012693 3300049850 Archaea 1014
299 Ga0501226_006972 3300049853 Unclassified 1271
300 nmdc:mga05p37_1127436_c1 3300050507 Unclassified 818
301 nmdc:mga05p37_148558_c1 3300050507 Bacteria 2868
302 nmdc:mga05p37_258745_c2 3300050507 Bacteria 1309
303 nmdc:mga05p37_643486_c1 3300050507 Unclassified 1189
304 nmdc:mga05p37_83927_c1 3300050507 Bacteria 3925
305 nmdc:mga05p37_8844_c1 3300050507 Bacteria 11898
306 nmdc:mga09592_90515_c1 3300050508 Bacteria 2614
307 nmdc:mga0qj67_255177_c1 3300050509 Bacteria 1423
308 nmdc:mga08y16_389029_c1 3300050511 Unclassified 1429
309 nmdc:mga08y16_8432_c1 3300050511 Bacteria 10789
310 nmdc:mga0n895_49457_c1 3300050512 Bacteria 4119
311 nmdc:mga0rr50_19948_c1 3300050513 Bacteria 4539
312 nmdc:mga0a205_211377_c1 3300050515 Bacteria 1828
313 nmdc:mga0a205_256896_c1 3300050515 Unclassified 1625
314 nmdc:mga0a205_64675_c1 3300050515 Bacteria 3534
315 nmdc:mga0a205_710185_c1 3300050515 Bacteria 855
316 Ga0070682_100003818
317 SwRhRL2b_contig_1332272
318 MBSR1b_contig_2606821
319 JGI24034J14986_101100
320 rootL2_10159216
321 Ga0065714_10064432
322 Ga0065704_10071170
323 Ga0065712_10067730
324 Ga0065715_10009713
325 Ga0065715_10199609
326 Ga0065715_10436328
327 Ga0065707_10000836
328 Ga0065707_10138003
329 Ga0070690_100600826
330 Ga0070670_100000324
331 Ga0068869_100007198
332 Ga0068869_100480499
333 Ga0070680_100039165
334 Ga0070682_100635809
335 Ga0070689_100593933
336 Ga0070687_100214789
337 Ga0070692_10082663
338 Ga0070692_10387755
339 Ga0070675_100565918
340 Ga0070673_100031274
341 Ga0070673_100659919
342 Ga0070688_100658579
343 Ga0070659_100011980
344 Ga0070703_10039668
345 Ga0070705_100111671
346 Ga0070705_100333726
347 Ga0070705_100388542
348 Ga0070700_100048464
349 Ga0070700_100106971
350 Ga0070700_100134044
351 Ga0070694_100006095
352 Ga0070694_100007619
353 Ga0070694_100086708
354 Ga0070694_100168206
355 Ga0070708_100003456
356 Ga0070681_10002627
357 Ga0068867_100023041
358 Ga0068867_100039167
359 Ga0068867_100129384
360 Ga0068867_100198115
361 Ga0068867_100341200
362 Ga0070706_100000480
363 Ga0070706_100109518
364 Ga0070706_100431226
365 Ga0070707_100040034
366 Ga0070707_100085396
367 Ga0070698_100761575
368 Ga0070699_100011147
369 Ga0070699_100307926
370 Ga0070679_100086343
371 Ga0070697_100038065
372 Ga0070697_100103350
373 Ga0070686_100101017
374 Ga0070686_100257534
375 Ga0070695_100012382
376 Ga0070696_100046562
377 Ga0070696_100063605
378 Ga0070693_100001894
379 Ga0070693_100043444
380 Ga0070693_100066768
381 Ga0070704_100042886
382 Ga0070704_100043771
383 Ga0070704_100085385
384 Ga0070664_100535601
385 Ga0068854_100039573
386 Ga0068854_100123387
387 Ga0068854_100233735
388 Ga0070702_100007655
389 Ga0070702_100042904
390 Ga0068852_100403503
391 Ga0068859_100006869
392 Ga0068859_100015271
393 Ga0068859_100024597
394 Ga0068859_100118625
395 Ga0068859_100201196
396 Ga0068859_100728092
397 Ga0068864_100085347
398 Ga0068861_100031944
399 Ga0068861_100171289
400 Ga0068851_10000390
401 Ga0068870_10166949
402 Ga0068863_100659793
403 Ga0068863_100703306
404 Ga0068858_100030948
405 Ga0068858_100194274
406 Ga0068858_100362870
407 Ga0068860_100051415
408 Ga0068860_100060535
409 Ga0068860_100074948
410 Ga0068860_100076488
411 Ga0068862_100693419
412 Ga0081539_10003930
413 Ga0097621_100025216
414 Ga0068871_100009380
415 Ga0068871_100346606
416 Ga0075428_100164253
417 Ga0075428_100678529
418 Ga0075428_100757269
419 Ga0075430_100259785
420 Ga0075431_100203218
421 Ga0075433_10107865
422 Ga0075433_10187636
423 Ga0075433_10241750
424 Ga0075433_10350191
425 Ga0075433_10919243
426 Ga0075434_100000642
427 Ga0075434_100196730
428 Ga0075434_100318517
429 Ga0075429_100047946
430 Ga0097620_100006869
431 Ga0097620_100015272
432 Ga0097620_100024598
433 Ga0097620_100118618
434 Ga0097620_100201193
435 Ga0097620_100728100
436 Ga0075435_100048997
437 Ga0105251_10121316
438 Ga0105240_10043592
439 Ga0111539_10000296
440 Ga0111539_10588980
441 Ga0111539_11236046
442 Ga0105245_10809168
443 Ga0105247_10006088
444 Ga0114129_10055898
445 Ga0114129_10059706
446 Ga0114129_10101488
447 Ga0114129_10132503
448 Ga0114129_10155451
449 Ga0114129_10298292
450 Ga0105243_10000446
451 Ga0105243_10034946
452 Ga0105243_10047702
453 Ga0105243_10483568
454 Ga0105241_10077036
455 Ga0105241_10130679
456 Ga0105241_10353418
457 Ga0105241_10368851
458 Ga0105242_10000118
459 Ga0105242_10127602
460 Ga0105242_10191501
461 Ga0105242_10529801
462 Ga0105248_10007391
463 Ga0105248_10016258
464 Ga0105248_10140862
465 Ga0105248_10284942
466 Ga0105248_10970732
467 Ga0105237_10004419
468 Ga0105237_10295493
469 Ga0105237_10710423
470 Ga0105237_10814148
471 Ga0105238_10077111
472 Ga0105249_10927231
473 Ga0105239_10104590
474 Ga0105239_10663309
475 Ga0105246_10142205
476 Ga0105246_10311252
477 Ga0157373_10002570
478 Ga0157373_10457566
479 Ga0157378_10000004
480 Ga0157378_10047867
481 Ga0157378_10071530
482 Ga0157378_10205752
483 Ga0163162_10531286
484 Ga0157372_11134126
485 Ga0157375_10028125
486 Ga0157375_10775957
487 Ga0163163_10001138
488 Ga0163163_10236264
489 Ga0163163_11227503
490 Ga0157380_10404417
491 Ga0207656_10017076
492 Ga0207653_10001209
493 Ga0207710_10003142
494 Ga0207647_10019861
495 Ga0207647_10088988
496 Ga0207699_10467284
497 Ga0207684_10000533
498 Ga0207654_10013969
499 Ga0207707_10063861
500 Ga0207671_10004693
501 Ga0207671_10096817
502 Ga0207660_10038590
503 Ga0207662_10349013
504 Ga0207646_10094144
505 Ga0207681_10016868
506 Ga0207650_10000112
507 Ga0207650_10257636
508 Ga0207659_10362082
509 Ga0207690_10021784
510 Ga0207686_10000725
511 Ga0207686_10298180
512 Ga0207709_10005553
513 Ga0207709_10051804
514 Ga0207709_10169231
515 Ga0207709_10517662
516 Ga0207670_10199011
517 Ga0207704_10333708
518 Ga0207711_10016058
519 Ga0207711_10024114
520 Ga0207689_10174940
521 Ga0207689_10178174
522 Ga0207689_10391161
523 Ga0207689_10476847
524 Ga0207651_10021027
525 Ga0207651_10478568
526 Ga0207640_10069484
527 Ga0207640_10103851
528 Ga0207677_10299693
529 Ga0207703_10262579
530 Ga0207639_10066480
531 Ga0207708_10000074
532 Ga0207708_10033927
533 Ga0207708_10077108
534 Ga0207708_10168501
535 Ga0207641_10036046
536 Ga0207641_10097689
537 Ga0207648_10440490
538 Ga0207676_10108429
539 Ga0207676_10187782
540 Ga0207676_10242965
541 Ga0207676_10265269
542 Ga0207676_10380431
543 Ga0207674_10085142
544 Ga0207674_10234230
545 Ga0207675_100015659
546 Ga0207675_100418079
547 Ga0207428_10002868
548 Ga0207428_10116085
549 Ga0268265_10053471
550 Ga0268264_10035583
551 Ga0268264_10118054
552 Ga0268264_10590572
553 Ga0307405_10039452
554 Ga0307405_10307917
555 Ga0307406_10120760
556 Ga0307409_100365777
557 Ga0307409_100420523
558 Ga0307416_100335788
559 Ga0307416_100480001
560 Ga0307416_101020882
561 Ga0307414_10128223
562 Ga0307414_10174867
563 Ga0307414_10362507
564 Ga0307414_10394537
565 Ga0307411_10049751
566 Ga0307411_10065714
567 Ga0307411_10176795
568 Ga0307415_100028873
569 Ga0307415_100138246
570 Ga0307415_100394955
571 Ga0395899_0116420
572 Ga0395900_0096299
573 Ga0395898_0646393
574 Ga0242419_008690
575 Ga0242420_023228
576 Ga0453684_1721741
577 Ga0495636_0012306
578 Ga0496104_0603515
579 Ga0496106_0006927
580 Ga0496107_0079323
581 Ga0496107_0596921
582 Ga0496108_0565739
583 Ga0496110_0144691
584 Ga0496111_1041864
585 Ga0501293_007358
586 Ga0501296_009345
587 Ga0501298_008423
588 Ga0501299_006945
589 Ga0501048_0170469
590 Ga0501202_006543
591 Ga0501202_009449
592 Ga0501202_040592
593 Ga0501207_027924
594 Ga0501216_011513
595 Ga0501217_020087
596 Ga0501217_082350
597 Ga0501223_003218
598 Ga0501227_002441
599 Ga0501228_006621
600 Ga0501233_002049
601 Ga0501233_006922
602 Ga0501235_026590
603 Ga0501236_054502
604 Ga0501253_041629
605 Ga0501257_047218
606 Ga0501257_099440
607 Ga0501257_100606
608 Ga0501257_107807
609 Ga0501234_014431
610 Ga0501245_012265
611 Ga0501268_019924
612 Ga0501273_003028
613 Ga0501204_012693
614 Ga0501226_006972
615 nmdc:mga05p37_1127436_c1
616 nmdc:mga05p37_148558_c1
617 nmdc:mga05p37_258745_c2
618 nmdc:mga05p37_643486_c1
619 nmdc:mga05p37_83927_c1
620 nmdc:mga05p37_8844_c1
621 nmdc:mga09592_90515_c1
622 nmdc:mga0qj67_255177_c1
623 nmdc:mga08y16_389029_c1
624 nmdc:mga08y16_8432_c1
625 nmdc:mga0n895_49457_c1
626 nmdc:mga0rr50_19948_c1
627 nmdc:mga0a205_211377_c1
628 nmdc:mga0a205_256896_c1
629 nmdc:mga0a205_64675_c1
630 nmdc:mga0a205_710185_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10677

DUF2490

Protein of unknown function (DUF2490)

68

247

0.95

Map