F402993

General Info

Members Datasets Scaffolds Average Seq Length
315 237 630 239

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100154771|Ga0070683_1001547713
Length 258
Sequence MIGMTRRAAGDRQQAADQLTGTPVPLVVDGLQVRYGGVRAVHGTSFEVAPGEAVGIIGANGAGKTSTLKAVLGLVGRQATTLRYGNTNLLKTPASAMVRLGIGYVPEGRHVFPGLSVEKNLLLGAYVRKWDATTKQHADEVYELFPVLGEMRGRLAGALSGGQQQMLAMGRALMARPSLIVCDEPSMGLSPILVDDILGALQRLHGTGMSILLVEQNARLCFEAVSRCLVMEHGNVVKTGSVDELRHDPDVRRIYLGI

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
219 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
226 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
227 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
228 2842694124 Methylopila sp. R-72369 Isolate Unclassified
229 2855730933 Achromobacter sp. HZ28 Isolate Nodule
230 2855767633 Achromobacter sp. HZ34 Isolate Nodule
231 2858950400 Achromobacter sp. K91 Isolate Unclassified
232 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
233 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
234 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
235 2941479691
236 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
237 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0.63
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 0.63
Rhizoplane 4.13
Rhizosphere 75.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100154771 3300005329 Bacteria 2174
2 JGI25150J39212_1002294 3300002774 Bacteria 4834
3 JGI25151J46595_10000665 3300003187 Bacteria 29242
4 JGI25151J46595_10005897 3300003187 Bacteria 6257
5 Ga0055537_1005793 3300003773 Bacteria 3245
6 Ga0065165_1012996 3300005262 Bacteria 3342
7 Ga0065707_10116753 3300005295 Bacteria 2229
8 Ga0070658_10007242 3300005327 Bacteria 8954
9 Ga0070658_10074336 3300005327 Bacteria 2787
10 Ga0070658_10114008 3300005327 Bacteria 2241
11 Ga0070690_100070107 3300005330 Bacteria 2275
12 Ga0068869_100486821 3300005334 Bacteria 1028
13 Ga0070666_10020622 3300005335 Bacteria 4262
14 Ga0070680_100504749 3300005336 Bacteria 1035
15 Ga0070660_100281545 3300005339 Bacteria 1361
16 Ga0070689_100050668 3300005340 Bacteria 3208
17 Ga0070671_100020433 3300005355 Bacteria 5400
18 Ga0070674_100005087 3300005356 Bacteria 7559
19 Ga0070673_100358134 3300005364 Bacteria 1296
20 Ga0070667_100107070 3300005367 Bacteria 2420
21 Ga0070709_10260265 3300005434 Bacteria 1253
22 Ga0070713_100117049 3300005436 Bacteria 2331
23 Ga0070710_10010866 3300005437 Bacteria 4483
24 Ga0070711_100006663 3300005439 Bacteria 6982
25 Ga0070705_100058027 3300005440 Bacteria 2286
26 Ga0070681_10060055 3300005458 Bacteria 3781
27 Ga0070681_10212932 3300005458 Bacteria 1848
28 Ga0068867_100263677 3300005459 Bacteria 1406
29 Ga0070679_100085195 3300005530 Bacteria 3147
30 Ga0070679_100262353 3300005530 Bacteria 1683
31 Ga0070679_100292062 3300005530 Bacteria 1581
32 Ga0070684_100145141 3300005535 Bacteria 2148
33 Ga0070697_100081804 3300005536 Bacteria 2661
34 Ga0068853_100026178 3300005539 Bacteria 4898
35 Ga0070695_100470122 3300005545 Bacteria 967
36 Ga0070693_100294325 3300005547 Bacteria 1092
37 Ga0068855_100010347 3300005563 Bacteria 11250
38 Ga0068855_100209593 3300005563 Bacteria 2190
39 Ga0070664_100166557 3300005564 Bacteria 1953
40 Ga0068856_100034152 3300005614 Bacteria 4982
41 Ga0068856_100197963 3300005614 Bacteria 2023
42 Ga0068852_100009570 3300005616 Bacteria 7200
43 Ga0068852_100038612 3300005616 Bacteria 4015
44 Ga0068859_100353803 3300005617 Bacteria 1564
45 Ga0068863_100202901 3300005841 Bacteria 1908
46 Ga0068858_100192419 3300005842 Bacteria 1927
47 Ga0068860_100062601 3300005843 Bacteria 3535
48 Ga0075364_10008524 3300006051 Bacteria 6133
49 Ga0075364_10152468 3300006051 Bacteria 1558
50 Ga0070715_10008341 3300006163 Bacteria 3608
51 Ga0070712_100005678 3300006175 Bacteria 7715
52 Ga0075362_10005151 3300006177 Bacteria 4761
53 Ga0075367_10046272 3300006178 Bacteria 2556
54 Ga0075366_10075858 3300006195 Bacteria 2006
55 Ga0097621_100205202 3300006237 Bacteria 1712
56 Ga0075370_10136043 3300006353 Bacteria 1436
57 Ga0075428_100000657 3300006844 Bacteria 35530
58 Ga0075428_100077570 3300006844 Bacteria 3626
59 Ga0075429_100002260 3300006880 Bacteria 16139
60 Ga0068865_100037927 3300006881 Bacteria 3258
61 Ga0068865_100329417 3300006881 Bacteria 1231
62 Ga0075436_100457839 3300006914 Bacteria 929
63 Ga0097620_100353833 3300006931 Bacteria 1564
64 Ga0099794_10003421 3300007265 Bacteria 6052
65 Ga0105240_10011176 3300009093 Bacteria 12531
66 Ga0105240_10187230 3300009093 Bacteria 2437
67 Ga0111539_10001999 3300009094 Bacteria 27198
68 Ga0111539_10013655 3300009094 Bacteria 10144
69 Ga0105245_10028859 3300009098 Bacteria 4897
70 Ga0105245_10268418 3300009098 Bacteria 1663
71 Ga0114129_10293301 3300009147 Bacteria 2170
72 Ga0114129_11525832 3300009147 Bacteria 820
73 Ga0105241_10034109 3300009174 Bacteria 3823
74 Ga0105242_10013489 3300009176 Bacteria 6318
75 Ga0105248_10174781 3300009177 Bacteria 2421
76 Ga0105237_10084165 3300009545 Bacteria 3171
77 Ga0105238_10054994 3300009551 Bacteria 3996
78 Ga0105238_10232535 3300009551 Bacteria 1820
79 Ga0105239_10081152 3300010375 Bacteria 3570
80 Ga0105239_10408018 3300010375 Bacteria 1538
81 Ga0157369_10000578 3300013105 Bacteria 47949
82 Ga0157369_10227281 3300013105 Bacteria 1952
83 Ga0157369_10418834 3300013105 Bacteria 1388
84 Ga0157374_10001238 3300013296 Bacteria 21798
85 Ga0157378_10043988 3300013297 Bacteria 3964
86 Ga0157372_10003319 3300013307 Bacteria 17386
87 Ga0157372_10419651 3300013307 Bacteria 1559
88 Ga0157375_10023648 3300013308 Bacteria 5673
89 Ga0163163_10139892 3300014325 Bacteria 2463
90 Ga0163163_10333395 3300014325 Bacteria 1572
91 Ga0157379_10170824 3300014968 Bacteria 1963
92 Ga0206354_11233657 3300020081 Bacteria 1108
93 Ga0206353_10692019 3300020082 Bacteria 6478
94 Ga0207425_1003000 3300025245 Bacteria 5624
95 Ga0209565_1001165 3300025263 Bacteria 12620
96 Ga0209675_1002633 3300025291 Bacteria 9075
97 Ga0209025_1000040 3300025294 Bacteria 376228
98 Ga0209025_1006346 3300025294 Bacteria 9212
99 Ga0209758_1006941 3300025297 Bacteria 7896
100 Ga0209256_1026061 3300025299 Bacteria 1691
101 Ga0207680_10019296 3300025903 Bacteria 3643
102 Ga0207645_10124225 3300025907 Bacteria 1677
103 Ga0207705_10042851 3300025909 Bacteria 3250
104 Ga0207705_10431708 3300025909 Bacteria 1020
105 Ga0207707_10062794 3300025912 Bacteria 3233
106 Ga0207707_10193168 3300025912 Bacteria 1776
107 Ga0207671_10325941 3300025914 Bacteria 1216
108 Ga0207693_10003697 3300025915 Bacteria 13040
109 Ga0207657_10441681 3300025919 Bacteria 1021
110 Ga0207652_10086494 3300025921 Bacteria 2749
111 Ga0207652_10268843 3300025921 Bacteria 1538
112 Ga0207694_10074027 3300025924 Bacteria 2666
113 Ga0207687_10236540 3300025927 Bacteria 1445
114 Ga0207644_10061236 3300025931 Bacteria 2725
115 Ga0207690_10132707 3300025932 Bacteria 1825
116 Ga0207669_10188297 3300025937 Bacteria 1486
117 Ga0207704_10073625 3300025938 Bacteria 2176
118 Ga0207704_10291017 3300025938 Bacteria 1246
119 Ga0207665_10002312 3300025939 Bacteria 12865
120 Ga0207711_10745091 3300025941 Bacteria 913
121 Ga0207661_10020190 3300025944 Bacteria 4975
122 Ga0207661_10524860 3300025944 Bacteria 1083
123 Ga0207661_10661345 3300025944 Bacteria 960
124 Ga0207661_11003193 3300025944 Bacteria 769
125 Ga0207667_10015542 3300025949 Bacteria 8640
126 Ga0207667_10049110 3300025949 Bacteria 4459
127 Ga0207667_10416223 3300025949 Bacteria 1368
128 Ga0207651_10284664 3300025960 Bacteria 1368
129 Ga0207651_10521105 3300025960 Bacteria 1030
130 Ga0207708_10225235 3300026075 Bacteria 1504
131 Ga0207702_10612065 3300026078 Bacteria 1069
132 Ga0207641_10747049 3300026088 Bacteria 965
133 Ga0207648_10016934 3300026089 Bacteria 6641
134 Ga0207683_10052262 3300026121 Bacteria 3580
135 Ga0207698_10019126 3300026142 Bacteria 4681
136 Ga0207698_10047217 3300026142 Bacteria 3259
137 Ga0209588_1010768 3300027671 Bacteria 2755
138 Ga0207428_10001254 3300027907 Bacteria 27170
139 Ga0207428_10066478 3300027907 Bacteria 2841
140 Ga0307515_10007106 3300028794 Bacteria 22238
141 Ga0265331_10266640 3300031250 Bacteria 768
142 Ga0307509_10126405 3300031507 Bacteria 2521
143 Ga0307508_10084214 3300031616 Bacteria 2762
144 Ga0307412_10001253 3300031911 Bacteria 14352
145 Ga0307412_10465585 3300031911 Bacteria 1045
146 Ga0307412_10653706 3300031911 Bacteria 897
147 Ga0307415_100483354 3300032126 Bacteria 1079
148 Ga0307507_10295840 3300033179 Bacteria 997
149 Ga0373928_0079033 3300035084 Bacteria 826
150 Ga0373956_0066580 3300035119 Bacteria 1639
151 Ga0373946_0047096 3300035171 Bacteria 1790
152 Ga0373955_0049879 3300035172 Bacteria 2274
153 Ga0373924_0037647 3300035410 Bacteria 1971
154 Ga0373931_0280955 3300035691 Bacteria 1022
155 Ga0373935_0147482 3300035692 Bacteria 1594
156 Ga0373927_0099462 3300035695 Bacteria 1891
157 Ga0373937_0020198 3300036401 Bacteria 5970
158 Ga0373937_0028135 3300036401 Bacteria 5086
159 Ga0373937_0172877 3300036401 Bacteria 2027
160 Ga0395899_0082412 3300037312 Bacteria 2340
161 Ga0395900_0037949 3300037418 Bacteria 4967
162 Ga0395898_0040731 3300037466 Bacteria 4592
163 Ga0395905_0000088 3300037471 Bacteria 152506
164 Ga0395905_0007844 3300037471 Bacteria 10575
165 Ga0395905_0038611 3300037471 Bacteria 4480
166 Ga0395905_0038705 3300037471 Bacteria 4473
167 Ga0436364_0497962 3300037853 Bacteria 1474
168 Ga0395901_0116309 3300038443 Bacteria 2809
169 Ga0395901_0196199 3300038443 Bacteria 2117
170 Ga0436361_0313204 3300039447 Bacteria 3358
171 Ga0439436_0001274 3300041404 Bacteria 7194
172 Ga0439447_018135 3300041407 Bacteria 1903
173 Ga0439431_0017329 3300041997 Bacteria 1693
174 Ga0439434_0049235 3300042435 Bacteria 1304
175 Ga0451577_0039580 3300042876 Bacteria 4236
176 Ga0451577_0809357 3300042876 Bacteria 846
177 Ga0453683_0070592 3300044673 Bacteria 2185
178 Ga0453683_0195309 3300044673 Bacteria 1284
179 Ga0466963_0453050 3300044694 Bacteria 905
180 Ga0453684_0042207 3300044712 Bacteria 6152
181 Ga0453684_0053059 3300044712 Bacteria 5295
182 Ga0453684_0109922 3300044712 Bacteria 3351
183 Ga0453684_0113550 3300044712 Bacteria 3286
184 Ga0453684_0183979 3300044712 Bacteria 2450
185 Ga0451576_0276811 3300045051 Bacteria 1755
186 Ga0466967_0038179 3300045976 Bacteria 4117
187 Ga0495592_0227259 3300046454 Bacteria 1244
188 Ga0495629_0000252 3300046459 Bacteria 46609
189 Ga0495629_0316151 3300046459 Bacteria 1068
190 Ga0495651_0022749 3300046462 Bacteria 4872
191 Ga0495651_0073931 3300046462 Bacteria 2587
192 Ga0495580_0026155 3300046472 Bacteria 4258
193 Ga0495582_0171592 3300046473 Bacteria 1235
194 Ga0495664_0002044 3300046477 Bacteria 10792
195 Ga0495594_0029795 3300046499 Bacteria 2950
196 Ga0495665_0019635 3300046531 Bacteria 3635
197 Ga0495587_0000921 3300046536 Bacteria 19411
198 Ga0495587_0095009 3300046536 Bacteria 1721
199 Ga0495621_0007906 3300046539 Bacteria 3165
200 Ga0495634_0000126 3300046642 Bacteria 65545
201 Ga0495635_0012475 3300046663 Bacteria 5953
202 Ga0495588_0167126 3300046674 Bacteria 1163
203 Ga0495657_0003759 3300046675 Bacteria 12283
204 Ga0495646_0011336 3300046680 Bacteria 5661
205 Ga0495600_0000831 3300046809 Bacteria 16432
206 Ga0495604_0000268 3300047317 Bacteria 46321
207 Ga0495674_0084713 3300047319 Bacteria 2716
208 Ga0495676_0008222 3300047321 Bacteria 9570
209 Ga0495593_0044927 3300047673 Bacteria 2360
210 Ga0495614_0000520 3300048089 Bacteria 15847
211 Ga0496101_0257441 3300048904 Bacteria 1360
212 Ga0496102_0340483 3300048905 Bacteria 1412
213 Ga0496105_0123677 3300048908 Bacteria 2132
214 Ga0496105_0139924 3300048908 Bacteria 1993
215 Ga0496107_0076447 3300048910 Bacteria 2438
216 Ga0496108_0461610 3300048911 Bacteria 1109
217 Ga0496110_0083402 3300048913 Bacteria 2851
218 Ga0496111_0195404 3300048914 Bacteria 1504
219 Ga0496112_0039330 3300048915 Bacteria 4622
220 Ga0496112_0121480 3300048915 Bacteria 2582
221 Ga0496113_0035549 3300048916 Bacteria 3644
222 Ga0496114_0030392 3300048917 Bacteria 4444
223 Ga0496115_0272777 3300048918 Bacteria 1389
224 Ga0496116_0032269 3300048919 Bacteria 3736
225 Ga0496116_0056016 3300048919 Bacteria 2586
226 Ga0496116_0259784 3300048919 Bacteria 857
227 Ga0496117_0168032 3300048920 Bacteria 1276
228 Ga0496118_0007262 3300048921 Bacteria 11811
229 Ga0496119_0025031 3300048922 Bacteria 4178
230 Ga0496120_0011868 3300048923 Bacteria 5962
231 Ga0496121_0000748 3300048924 Bacteria 59722
232 Ga0496122_0001323 3300048925 Bacteria 40594
233 Ga0496122_0062406 3300048925 Bacteria 2728
234 Ga0496123_0000568 3300048926 Bacteria 63015
235 Ga0496123_0006799 3300048926 Bacteria 10984
236 Ga0496124_0169093 3300048927 Bacteria 1695
237 Ga0496124_0296438 3300048927 Bacteria 1170
238 Ga0496124_0402922 3300048927 Bacteria 949
239 Ga0496125_0000096 3300048928 Bacteria 205618
240 Ga0496125_0006664 3300048928 Bacteria 12431
241 Ga0496125_0008836 3300048928 Bacteria 10473
242 Ga0496126_0031248 3300048929 Bacteria 5034
243 Ga0496126_0033684 3300048929 Bacteria 4818
244 Ga0501034_0120504 3300049571 Bacteria 2610
245 Ga0501036_0007564 3300049572 Bacteria 8866
246 Ga0501037_0265463 3300049573 Bacteria 1199
247 Ga0501038_0360884 3300049574 Bacteria 1130
248 Ga0501039_0075465 3300049575 Bacteria 2621
249 Ga0501040_0020830 3300049576 Bacteria 4372
250 Ga0501041_0003501 3300049577 Bacteria 9035
251 Ga0501041_0143031 3300049577 Bacteria 1492
252 Ga0501042_0041500 3300049578 Bacteria 3272
253 Ga0501042_0184955 3300049578 Bacteria 1503
254 Ga0501046_0547254 3300049580 Bacteria 825
255 Ga0501047_0006821 3300049581 Bacteria 10732
256 Ga0501048_0024184 3300049582 Bacteria 4434
257 Ga0501048_0417586 3300049582 Bacteria 960
258 Ga0501070_0068153 3300049586 Bacteria 2946
259 Ga0501071_0153142 3300049587 Bacteria 1720
260 Ga0501071_0224946 3300049587 Bacteria 1413
261 Ga0501072_0014918 3300049588 Bacteria 5955
262 Ga0501074_0043174 3300049590 Bacteria 3263
263 Ga0501075_0009385 3300049591 Bacteria 6844
264 Ga0501076_0000088 3300049592 Bacteria 48517
265 Ga0501077_0015498 3300049593 Bacteria 4799
266 Ga0501079_0002815 3300049741 Bacteria 12686
267 Ga0501079_0441001 3300049741 Bacteria 1022
268 Ga0501080_0028284 3300049742 Bacteria 5214
269 Ga0501081_0057224 3300049743 Bacteria 2695
270 Ga0501081_0242042 3300049743 Bacteria 1316
271 Ga0501081_0263696 3300049743 Bacteria 1259
272 Ga0501035_0008483 3300049822 Bacteria 9569
273 Ga0501044_0035194 3300049823 Bacteria 5245
274 Ga0501044_0334343 3300049823 Bacteria 1437
275 Ga0501045_0068962 3300049824 Bacteria 2598
276 Ga0501045_0144060 3300049824 Bacteria 1772
277 Ga0501045_0185629 3300049824 Bacteria 1549
278 nmdc:mga00v17_14222_c1 3300050491 Bacteria 4437
279 nmdc:mga04h51_41540_c1 3300050495 Bacteria 1503
280 nmdc:mga07m45_25140_c1 3300050496 Bacteria 3264
281 nmdc:mga05p37_473079_c1 3300050507 Bacteria 1445
282 nmdc:mga05p37_863106_c1 3300050507 Bacteria 981
283 nmdc:mga09592_1561_c1 3300050508 Bacteria 18441
284 nmdc:mga08y16_3447_c1 3300050511 Bacteria 16415
285 nmdc:mga08y16_52734_c1 3300050511 Bacteria 4255
286 nmdc:mga0rr50_450188_c1 3300050513 Bacteria 1091
287 nmdc:mga08x19_135588_c1 3300050514 Bacteria 1659
288 Ga0495595_0014377 3300053084 Bacteria 3357
289 Ga0495619_0115406 3300053085 Bacteria 1838
290 Ga0500644_0042673 3300053088 Bacteria 1513
291 Ga0500641_0122529 3300053096 Bacteria 1121
292 Ga0500650_0066362 3300053098 Bacteria 1686
293 Ga0500593_021525 3300053117 Bacteria 2839
294 Ga0500628_000605 3300053129 Bacteria 6568
295 Ga0500627_0205139 3300053158 Bacteria 883
296 Ga0500645_001533 3300053730 Bacteria 11552
297 Ga0500645_002397 3300053730 Bacteria 8411
298 Ga0501084_0002533 3300054114 Bacteria 14728
299 Ga0501084_0335011 3300054114 Bacteria 1278
300 Ga0501082_0023411 3300060353 Bacteria 5328
301 Ga0501082_0379528 3300060353 Bacteria 1233
302 Ga0530510_0000514 3300061734 Bacteria 24670
303 2511243173 2511231002 Bacteria 5042903
304 2523106039 2522572158 Bacteria 6514390
305 2819613958 2818991449 Bacteria 5518009
306 2842694736 2842694124 Bacteria 4063419
307 2855736556 2855730933 Bacteria 7047938
308 2855773493 2855767633 Bacteria 7049357
309 2858951248 2858950400 Bacteria 6783797
310 2881418515 2881412998 Bacteria 6492157
311 2883578409 2883577096 Bacteria 4709178
312 2895434516 2895427314 Bacteria 13147766
313 2941485420
314 2996338097 2996336353 Bacteria 5511628
315 639785224 639633007 Bacteria 4376040
316 Ga0070683_100154771
317 JGI25150J39212_1002294
318 JGI25151J46595_10000665
319 JGI25151J46595_10005897
320 Ga0055537_1005793
321 Ga0065165_1012996
322 Ga0065707_10116753
323 Ga0070658_10007242
324 Ga0070658_10074336
325 Ga0070658_10114008
326 Ga0070690_100070107
327 Ga0068869_100486821
328 Ga0070666_10020622
329 Ga0070680_100504749
330 Ga0070660_100281545
331 Ga0070689_100050668
332 Ga0070671_100020433
333 Ga0070674_100005087
334 Ga0070673_100358134
335 Ga0070667_100107070
336 Ga0070709_10260265
337 Ga0070713_100117049
338 Ga0070710_10010866
339 Ga0070711_100006663
340 Ga0070705_100058027
341 Ga0070681_10060055
342 Ga0070681_10212932
343 Ga0068867_100263677
344 Ga0070679_100085195
345 Ga0070679_100262353
346 Ga0070679_100292062
347 Ga0070684_100145141
348 Ga0070697_100081804
349 Ga0068853_100026178
350 Ga0070695_100470122
351 Ga0070693_100294325
352 Ga0068855_100010347
353 Ga0068855_100209593
354 Ga0070664_100166557
355 Ga0068856_100034152
356 Ga0068856_100197963
357 Ga0068852_100009570
358 Ga0068852_100038612
359 Ga0068859_100353803
360 Ga0068863_100202901
361 Ga0068858_100192419
362 Ga0068860_100062601
363 Ga0075364_10008524
364 Ga0075364_10152468
365 Ga0070715_10008341
366 Ga0070712_100005678
367 Ga0075362_10005151
368 Ga0075367_10046272
369 Ga0075366_10075858
370 Ga0097621_100205202
371 Ga0075370_10136043
372 Ga0075428_100000657
373 Ga0075428_100077570
374 Ga0075429_100002260
375 Ga0068865_100037927
376 Ga0068865_100329417
377 Ga0075436_100457839
378 Ga0097620_100353833
379 Ga0099794_10003421
380 Ga0105240_10011176
381 Ga0105240_10187230
382 Ga0111539_10001999
383 Ga0111539_10013655
384 Ga0105245_10028859
385 Ga0105245_10268418
386 Ga0114129_10293301
387 Ga0114129_11525832
388 Ga0105241_10034109
389 Ga0105242_10013489
390 Ga0105248_10174781
391 Ga0105237_10084165
392 Ga0105238_10054994
393 Ga0105238_10232535
394 Ga0105239_10081152
395 Ga0105239_10408018
396 Ga0157369_10000578
397 Ga0157369_10227281
398 Ga0157369_10418834
399 Ga0157374_10001238
400 Ga0157378_10043988
401 Ga0157372_10003319
402 Ga0157372_10419651
403 Ga0157375_10023648
404 Ga0163163_10139892
405 Ga0163163_10333395
406 Ga0157379_10170824
407 Ga0206354_11233657
408 Ga0206353_10692019
409 Ga0207425_1003000
410 Ga0209565_1001165
411 Ga0209675_1002633
412 Ga0209025_1000040
413 Ga0209025_1006346
414 Ga0209758_1006941
415 Ga0209256_1026061
416 Ga0207680_10019296
417 Ga0207645_10124225
418 Ga0207705_10042851
419 Ga0207705_10431708
420 Ga0207707_10062794
421 Ga0207707_10193168
422 Ga0207671_10325941
423 Ga0207693_10003697
424 Ga0207657_10441681
425 Ga0207652_10086494
426 Ga0207652_10268843
427 Ga0207694_10074027
428 Ga0207687_10236540
429 Ga0207644_10061236
430 Ga0207690_10132707
431 Ga0207669_10188297
432 Ga0207704_10073625
433 Ga0207704_10291017
434 Ga0207665_10002312
435 Ga0207711_10745091
436 Ga0207661_10020190
437 Ga0207661_10524860
438 Ga0207661_10661345
439 Ga0207661_11003193
440 Ga0207667_10015542
441 Ga0207667_10049110
442 Ga0207667_10416223
443 Ga0207651_10284664
444 Ga0207651_10521105
445 Ga0207708_10225235
446 Ga0207702_10612065
447 Ga0207641_10747049
448 Ga0207648_10016934
449 Ga0207683_10052262
450 Ga0207698_10019126
451 Ga0207698_10047217
452 Ga0209588_1010768
453 Ga0207428_10001254
454 Ga0207428_10066478
455 Ga0307515_10007106
456 Ga0265331_10266640
457 Ga0307509_10126405
458 Ga0307508_10084214
459 Ga0307412_10001253
460 Ga0307412_10465585
461 Ga0307412_10653706
462 Ga0307415_100483354
463 Ga0307507_10295840
464 Ga0373928_0079033
465 Ga0373956_0066580
466 Ga0373946_0047096
467 Ga0373955_0049879
468 Ga0373924_0037647
469 Ga0373931_0280955
470 Ga0373935_0147482
471 Ga0373927_0099462
472 Ga0373937_0020198
473 Ga0373937_0028135
474 Ga0373937_0172877
475 Ga0395899_0082412
476 Ga0395900_0037949
477 Ga0395898_0040731
478 Ga0395905_0000088
479 Ga0395905_0007844
480 Ga0395905_0038611
481 Ga0395905_0038705
482 Ga0436364_0497962
483 Ga0395901_0116309
484 Ga0395901_0196199
485 Ga0436361_0313204
486 Ga0439436_0001274
487 Ga0439447_018135
488 Ga0439431_0017329
489 Ga0439434_0049235
490 Ga0451577_0039580
491 Ga0451577_0809357
492 Ga0453683_0070592
493 Ga0453683_0195309
494 Ga0466963_0453050
495 Ga0453684_0042207
496 Ga0453684_0053059
497 Ga0453684_0109922
498 Ga0453684_0113550
499 Ga0453684_0183979
500 Ga0451576_0276811
501 Ga0466967_0038179
502 Ga0495592_0227259
503 Ga0495629_0000252
504 Ga0495629_0316151
505 Ga0495651_0022749
506 Ga0495651_0073931
507 Ga0495580_0026155
508 Ga0495582_0171592
509 Ga0495664_0002044
510 Ga0495594_0029795
511 Ga0495665_0019635
512 Ga0495587_0000921
513 Ga0495587_0095009
514 Ga0495621_0007906
515 Ga0495634_0000126
516 Ga0495635_0012475
517 Ga0495588_0167126
518 Ga0495657_0003759
519 Ga0495646_0011336
520 Ga0495600_0000831
521 Ga0495604_0000268
522 Ga0495674_0084713
523 Ga0495676_0008222
524 Ga0495593_0044927
525 Ga0495614_0000520
526 Ga0496101_0257441
527 Ga0496102_0340483
528 Ga0496105_0123677
529 Ga0496105_0139924
530 Ga0496107_0076447
531 Ga0496108_0461610
532 Ga0496110_0083402
533 Ga0496111_0195404
534 Ga0496112_0039330
535 Ga0496112_0121480
536 Ga0496113_0035549
537 Ga0496114_0030392
538 Ga0496115_0272777
539 Ga0496116_0032269
540 Ga0496116_0056016
541 Ga0496116_0259784
542 Ga0496117_0168032
543 Ga0496118_0007262
544 Ga0496119_0025031
545 Ga0496120_0011868
546 Ga0496121_0000748
547 Ga0496122_0001323
548 Ga0496122_0062406
549 Ga0496123_0000568
550 Ga0496123_0006799
551 Ga0496124_0169093
552 Ga0496124_0296438
553 Ga0496124_0402922
554 Ga0496125_0000096
555 Ga0496125_0006664
556 Ga0496125_0008836
557 Ga0496126_0031248
558 Ga0496126_0033684
559 Ga0501034_0120504
560 Ga0501036_0007564
561 Ga0501037_0265463
562 Ga0501038_0360884
563 Ga0501039_0075465
564 Ga0501040_0020830
565 Ga0501041_0003501
566 Ga0501041_0143031
567 Ga0501042_0041500
568 Ga0501042_0184955
569 Ga0501046_0547254
570 Ga0501047_0006821
571 Ga0501048_0024184
572 Ga0501048_0417586
573 Ga0501070_0068153
574 Ga0501071_0153142
575 Ga0501071_0224946
576 Ga0501072_0014918
577 Ga0501074_0043174
578 Ga0501075_0009385
579 Ga0501076_0000088
580 Ga0501077_0015498
581 Ga0501079_0002815
582 Ga0501079_0441001
583 Ga0501080_0028284
584 Ga0501081_0057224
585 Ga0501081_0242042
586 Ga0501081_0263696
587 Ga0501035_0008483
588 Ga0501044_0035194
589 Ga0501044_0334343
590 Ga0501045_0068962
591 Ga0501045_0144060
592 Ga0501045_0185629
593 nmdc:mga00v17_14222_c1
594 nmdc:mga04h51_41540_c1
595 nmdc:mga07m45_25140_c1
596 nmdc:mga05p37_473079_c1
597 nmdc:mga05p37_863106_c1
598 nmdc:mga09592_1561_c1
599 nmdc:mga08y16_3447_c1
600 nmdc:mga08y16_52734_c1
601 nmdc:mga0rr50_450188_c1
602 nmdc:mga08x19_135588_c1
603 Ga0495595_0014377
604 Ga0495619_0115406
605 Ga0500644_0042673
606 Ga0500641_0122529
607 Ga0500650_0066362
608 Ga0500593_021525
609 Ga0500628_000605
610 Ga0500627_0205139
611 Ga0500645_001533
612 Ga0500645_002397
613 Ga0501084_0002533
614 Ga0501084_0335011
615 Ga0501082_0023411
616 Ga0501082_0379528
617 Ga0530510_0000514
618 2511243173
619 2523106039
620 2819613958
621 2842694736
622 2855736556
623 2855773493
624 2858951248
625 2881418515
626 2883578409
627 2895434516
628 2941485420
629 2996338097
630 639785224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9209 7 241
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9001 13 235
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8991 10 230
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8989 7 241
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8971 10 230
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9185 12 240 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9115 12 228 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9093 10 241 3.40.50.300
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9089 9 230 3.40.50.300
af_Q2FYW3_2_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9059 10 232 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1B1CKP2-F1-model_v4 ABC transporter ATP-binding protein 0.9926 10 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1B1CKP2-F1-model_v4 ABC transporter ATP-binding protein 0.9842 10 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A132EYC1-F1-model_v4 ABC transporter ATP-binding protein 0.9761 12 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A1I5RA90-F1-model_v4 Branched-chain amino acid transport system ATP-binding protein 0.9706 1 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7W1WM10-F1-model_v4 ABC transporter ATP-binding protein 0.9682 13 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map