F402802

General Info

Members Datasets Scaffolds Average Seq Length
314 204 311 182

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0230427|Ga0451577_0230427_444_1073
Length 198
Sequence LFELEQSFIFLFCKNILFNYLIMTEEVQLVLDDAIERLGKIRAGKANPQMLDGLMIDYYGSMTPLTQVANINTPDPRTIAIQPWEKKMIQTIERALMAANLGMTPENNGEIIRLNVPPLTEERRKSLVKQAKQESEDAKVSVRSIRRDMIEEFKKLKKDGLSEDAEKDAEAEAQKIHDRYIRKVDELMEKKEKDILTV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2857472729 Cohnella sp. R-74144 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
204 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 1.27
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 7.01
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2083883 2162886007 Bacteria 1756
2 rootH1_10056096 3300003316 Bacteria 1469
3 rootH2_10131447 3300003320 Bacteria 2713
4 rootL2_10033832 3300003322 Bacteria 2214
5 Ga0058863_11484990 3300004799 Bacteria 1018
6 Ga0058861_11930275 3300004800 Bacteria 942
7 Ga0065715_10319032 3300005293 Bacteria 1005
8 Ga0065707_10215213 3300005295 Bacteria 1248
9 Ga0070658_10106046 3300005327 Bacteria 2325
10 Ga0068869_100079040 3300005334 Bacteria 2451
11 Ga0070660_100608440 3300005339 Bacteria 914
12 Ga0070689_100754464 3300005340 Bacteria 853
13 Ga0070691_10110962 3300005341 Bacteria 1372
14 Ga0070687_100502854 3300005343 Bacteria 816
15 Ga0070669_101165391 3300005353 Bacteria 665
16 Ga0070674_100034031 3300005356 Bacteria 3398
17 Ga0070674_100233718 3300005356 Bacteria 1436
18 Ga0070705_100029660 3300005440 Bacteria 3012
19 Ga0070708_100000453 3300005445 Bacteria 30747
20 Ga0070708_100232999 3300005445 Bacteria 1728
21 Ga0070708_100505707 3300005445 Bacteria 1140
22 Ga0070681_10071122 3300005458 Bacteria 3444
23 Ga0070681_10087221 3300005458 Bacteria 3074
24 Ga0070681_10644626 3300005458 Bacteria 974
25 Ga0068867_100891486 3300005459 Bacteria 800
26 Ga0068867_100954561 3300005459 Bacteria 775
27 Ga0068867_101066816 3300005459 Bacteria 736
28 Ga0070685_10485350 3300005466 Bacteria 872
29 Ga0070706_100276873 3300005467 Bacteria 1566
30 Ga0070707_100009790 3300005468 Bacteria 8912
31 Ga0070707_100161997 3300005468 Bacteria 2180
32 Ga0070698_100017643 3300005471 Bacteria 7520
33 Ga0070698_100055771 3300005471 Bacteria 4005
34 Ga0070698_100119054 3300005471 Bacteria 2601
35 Ga0070699_100101981 3300005518 Bacteria 2516
36 Ga0070697_100044685 3300005536 Bacteria 3588
37 Ga0070672_100336412 3300005543 Bacteria 1285
38 Ga0070695_100103990 3300005545 Bacteria 1917
39 Ga0070695_100859209 3300005545 Bacteria 730
40 Ga0070696_100128343 3300005546 Bacteria 1842
41 Ga0070704_100114750 3300005549 Bacteria 2057
42 Ga0070704_101073171 3300005549 Bacteria 731
43 Ga0068855_100045894 3300005563 Bacteria 5166
44 Ga0070664_100622356 3300005564 Bacteria 1002
45 Ga0068859_100061493 3300005617 Bacteria 3784
46 Ga0068859_100677014 3300005617 Bacteria 1123
47 Ga0068859_101520926 3300005617 Unclassified 739
48 Ga0068864_100210764 3300005618 Bacteria 1789
49 Ga0068851_10293924 3300005834 Bacteria 932
50 Ga0068858_100079942 3300005842 Bacteria 3038
51 Ga0081455_10209492 3300005937 Bacteria 1453
52 Ga0081539_10012932 3300005985 Bacteria 6349
53 Ga0075364_10289823 3300006051 Bacteria 1114
54 Ga0075370_10023835 3300006353 Bacteria 3375
55 Ga0075434_100001709 3300006871 Bacteria 18796
56 Ga0097620_100061494 3300006931 Bacteria 3784
57 Ga0097620_101520976 3300006931 Unclassified 739
58 Ga0075435_100163925 3300007076 Bacteria 1874
59 Ga0105250_10241933 3300009092 Bacteria 769
60 Ga0105240_10115711 3300009093 Bacteria 3237
61 Ga0111539_10098459 3300009094 Bacteria 3435
62 Ga0111539_10930435 3300009094 Bacteria 1011
63 Ga0105245_10321042 3300009098 Bacteria 1525
64 Ga0114129_10643056 3300009147 Bacteria 1370
65 Ga0105243_10000018 3300009148 Bacteria 227618
66 Ga0105243_10696389 3300009148 Bacteria 990
67 Ga0105243_11178456 3300009148 Archaea 778
68 Ga0105242_10303266 3300009176 Bacteria 1459
69 Ga0105242_11259718 3300009176 Bacteria 761
70 Ga0105248_10764847 3300009177 Bacteria 1090
71 Ga0105237_10000864 3300009545 Bacteria 41160
72 Ga0105238_10088942 3300009551 Bacteria 3075
73 Ga0105249_11058512 3300009553 Bacteria 881
74 Ga0105030_100350 3300009987 Bacteria 4019
75 Ga0157372_10300150 3300013307 Bacteria 1868
76 Ga0157375_10022966 3300013308 Bacteria 5749
77 Ga0157514_100289 3300013874 Bacteria 1595
78 Ga0163163_10046577 3300014325 Bacteria 4260
79 Ga0163163_10131687 3300014325 Bacteria 2541
80 Ga0157380_10382575 3300014326 Bacteria 1329
81 Ga0163161_10054847 3300017792 Bacteria 2893
82 Ga0206351_10603424 3300020077 Bacteria 769
83 Ga0209566_100118 3300025225 Bacteria 105475
84 Ga0207705_10410553 3300025909 Unclassified 1048
85 Ga0207684_10198529 3300025910 Bacteria 1730
86 Ga0207707_10556650 3300025912 Bacteria 974
87 Ga0207671_10000164 3300025914 Bacteria 103302
88 Ga0207660_10266909 3300025917 Bacteria 1355
89 Ga0207646_10117822 3300025922 Bacteria 2385
90 Ga0207646_10161039 3300025922 Bacteria 2025
91 Ga0207646_10601795 3300025922 Bacteria 987
92 Ga0207646_10792289 3300025922 Unclassified 844
93 Ga0207694_10007296 3300025924 Bacteria 8388
94 Ga0207686_10521101 3300025934 Bacteria 925
95 Ga0207709_10000021 3300025935 Bacteria 386722
96 Ga0207709_10403066 3300025935 Bacteria 1046
97 Ga0207709_10480764 3300025935 Bacteria 966
98 Ga0207669_10039812 3300025937 Bacteria 2720
99 Ga0207669_10563937 3300025937 Bacteria 921
100 Ga0207704_10075128 3300025938 Bacteria 2160
101 Ga0207679_10618062 3300025945 Bacteria 978
102 Ga0207679_10925063 3300025945 Bacteria 798
103 Ga0207667_10042833 3300025949 Bacteria 4809
104 Ga0207703_10022377 3300026035 Bacteria 4958
105 Ga0207703_10410966 3300026035 Bacteria 1258
106 Ga0207639_10859881 3300026041 Bacteria 847
107 Ga0207648_10617892 3300026089 Bacteria 1000
108 Ga0207676_10175800 3300026095 Bacteria 1870
109 Ga0207675_100066970 3300026118 Bacteria 3357
110 Ga0207675_100328170 3300026118 Bacteria 1495
111 Ga0207683_10865803 3300026121 Bacteria 839
112 Ga0209983_1008807 3300027665 Bacteria 2060
113 Ga0209971_1010972 3300027682 Bacteria 2146
114 Ga0209966_1004094 3300027695 Bacteria 2463
115 Ga0209998_10000161 3300027717 Bacteria 24636
116 Ga0209974_10001376 3300027876 Bacteria 8781
117 Ga0207428_10334049 3300027907 Bacteria 1117
118 Ga0268266_10566148 3300028379 Bacteria 1090
119 Ga0265338_10061915 3300028800 Bacteria 3275
120 Ga0265324_10009856 3300029957 Bacteria 3712
121 Ga0307408_100000209 3300031548 Bacteria 62437
122 Ga0316575_10057234 3300031665 Bacteria 1554
123 Ga0316576_10033947 3300031727 Bacteria 3634
124 Ga0316576_10047216 3300031727 Bacteria 3119
125 Ga0316576_10072558 3300031727 Bacteria 2541
126 Ga0316578_10422512 3300031728 Bacteria 789
127 Ga0307405_10428999 3300031731 Bacteria 1042
128 Ga0307413_10460855 3300031824 Bacteria 1011
129 Ga0307410_10310789 3300031852 Bacteria 1247
130 Ga0307410_11076072 3300031852 Bacteria 696
131 Ga0307407_10693718 3300031903 Bacteria 766
132 Ga0307409_100074142 3300031995 Bacteria 2718
133 Ga0307416_101489223 3300032002 Bacteria 782
134 Ga0307414_10117171 3300032004 Bacteria 2040
135 Ga0307414_10720438 3300032004 Bacteria 904
136 Ga0307411_10146247 3300032005 Bacteria 1750
137 Ga0307411_10305417 3300032005 Bacteria 1278
138 Ga0316593_10002144 3300032168 Bacteria 4601
139 Ga0373940_0032277 3300035088 Bacteria 1403
140 Ga0316574_0028247 3300035398 Bacteria 3382
141 Ga0316584_0175668 3300036712 Bacteria 1587
142 Ga0395900_0338089 3300037418 Bacteria 1482
143 Ga0451835_0016181 3300041492 Bacteria 957
144 Ga0451855_0451566 3300041511 Bacteria 871
145 Ga0451855_0975324 3300041511 Bacteria 890
146 Ga0451855_1591985 3300041511 Bacteria 763
147 Ga0450920_087507 3300042122 Bacteria 641
148 Ga0450923_010234 3300042125 Bacteria 1659
149 Ga0450906_045637 3300042145 Bacteria 773
150 Ga0439434_0014713 3300042435 Bacteria 2329
151 Ga0450918_014902 3300042531 Bacteria 1351
152 Ga0451577_0118582 3300042876 Bacteria 2370
153 Ga0451577_0230427 3300042876 Bacteria 1675
154 Ga0453683_0022859 3300044673 Bacteria 3987
155 Ga0451576_0003470 3300045051 Bacteria 21606
156 Ga0466967_0090351 3300045976 Bacteria 2782
157 Ga0495592_0426466 3300046454 Bacteria 835
158 Ga0495641_0089491 3300046461 Bacteria 1376
159 Ga0495641_0384984 3300046461 Unclassified 636
160 Ga0495651_0036152 3300046462 Bacteria 3845
161 Ga0495582_0208734 3300046473 Bacteria 1116
162 Ga0495618_0266751 3300046514 Bacteria 1071
163 Ga0495628_0345891 3300046516 Bacteria 1094
164 Ga0495652_0189834 3300046529 Bacteria 1569
165 Ga0495667_0426120 3300046559 Bacteria 835
166 Ga0495657_0235080 3300046675 Bacteria 1107
167 Ga0495599_0452574 3300046678 Bacteria 760
168 Ga0495647_0048056 3300046681 Bacteria 1649
169 Ga0495658_0166542 3300046683 Bacteria 1362
170 Ga0495600_0372597 3300046809 Bacteria 892
171 Ga0495581_0224100 3300047315 Bacteria 1100
172 Ga0495604_0112356 3300047317 Bacteria 1985
173 Ga0495676_0214513 3300047321 Bacteria 1330
174 Ga0495680_0299915 3300047322 Bacteria 1128
175 Ga0495602_0066687 3300048088 Bacteria 3100
176 Ga0496100_0157863 3300048903 Bacteria 1623
177 Ga0496101_0088638 3300048904 Bacteria 2298
178 Ga0496101_0089402 3300048904 Bacteria 2289
179 Ga0496101_0819008 3300048904 Bacteria 734
180 Ga0496102_0290424 3300048905 Bacteria 1541
181 Ga0496102_0766237 3300048905 Bacteria 888
182 Ga0496104_0041275 3300048907 Bacteria 4326
183 Ga0496104_0098269 3300048907 Bacteria 2802
184 Ga0496105_0017090 3300048908 Bacteria 5808
185 Ga0496106_0529306 3300048909 Bacteria 946
186 Ga0496107_0755541 3300048910 Bacteria 713
187 Ga0496108_0050300 3300048911 Bacteria 3488
188 Ga0496108_0059616 3300048911 Bacteria 3209
189 Ga0496109_0013464 3300048912 Bacteria 7096
190 Ga0496109_0165544 3300048912 Bacteria 2072
191 Ga0496110_0031154 3300048913 Bacteria 4600
192 Ga0496110_0345954 3300048913 Bacteria 1354
193 Ga0496111_0071758 3300048914 Bacteria 2520
194 Ga0496112_0154146 3300048915 Bacteria 2265
195 Ga0496113_0118885 3300048916 Bacteria 2064
196 Ga0496114_0010043 3300048917 Bacteria 7527
197 Ga0496114_1020287 3300048917 Bacteria 711
198 Ga0496116_0063145 3300048919 Bacteria 2387
199 Ga0496116_0160364 3300048919 Bacteria 1235
200 Ga0496121_0162883 3300048924 Bacteria 1629
201 Ga0496122_0247355 3300048925 Bacteria 1000
202 Ga0501031_0020150 3300049568 Bacteria 4347
203 Ga0501031_0140487 3300049568 Bacteria 1578
204 Ga0501031_0462356 3300049568 Bacteria 819
205 Ga0501032_0112280 3300049569 Bacteria 1803
206 Ga0501032_0122815 3300049569 Bacteria 1716
207 Ga0501033_0084554 3300049570 Bacteria 2325
208 Ga0501036_0020226 3300049572 Bacteria 5590
209 Ga0501036_0071505 3300049572 Bacteria 2933
210 Ga0501036_0149755 3300049572 Bacteria 1968
211 Ga0501037_0084236 3300049573 Bacteria 2303
212 Ga0501038_0012694 3300049574 Bacteria 7699
213 Ga0501038_0028877 3300049574 Bacteria 4923
214 Ga0501038_0171978 3300049574 Bacteria 1753
215 Ga0501039_0205242 3300049575 Bacteria 1549
216 Ga0501039_0716931 3300049575 Bacteria 782
217 Ga0501040_0001628 3300049576 Bacteria 14311
218 Ga0501040_0003850 3300049576 Bacteria 9731
219 Ga0501041_0009179 3300049577 Bacteria 5825
220 Ga0501041_0024501 3300049577 Bacteria 3622
221 Ga0501042_0001740 3300049578 Bacteria 13019
222 Ga0501042_0026020 3300049578 Bacteria 4112
223 Ga0501042_0337884 3300049578 Bacteria 1089
224 Ga0501043_0125160 3300049579 Bacteria 2015
225 Ga0501046_0015827 3300049580 Bacteria 6329
226 Ga0501048_0028241 3300049582 Bacteria 4072
227 Ga0501048_0031788 3300049582 Bacteria 3817
228 Ga0501048_0331733 3300049582 Bacteria 1084
229 Ga0501067_0019068 3300049583 Bacteria 3796
230 Ga0501067_0019969 3300049583 Bacteria 3707
231 Ga0501068_0061338 3300049584 Bacteria 2285
232 Ga0501068_0151381 3300049584 Bacteria 1458
233 Ga0501068_0179616 3300049584 Bacteria 1338
234 Ga0501069_0014053 3300049585 Bacteria 4276
235 Ga0501069_0037809 3300049585 Bacteria 2663
236 Ga0501069_0137353 3300049585 Bacteria 1401
237 Ga0501069_0288616 3300049585 Bacteria 961
238 Ga0501070_0032019 3300049586 Bacteria 4403
239 Ga0501070_0068893 3300049586 Bacteria 2929
240 Ga0501070_0666908 3300049586 Bacteria 825
241 Ga0501071_0000248 3300049587 Bacteria 25026
242 Ga0501071_0003229 3300049587 Bacteria 10164
243 Ga0501071_0096707 3300049587 Bacteria 2174
244 Ga0501071_0229505 3300049587 Bacteria 1398
245 Ga0501071_0232143 3300049587 Bacteria 1390
246 Ga0501071_0994702 3300049587 Bacteria 648
247 Ga0501072_0000230 3300049588 Bacteria 41301
248 Ga0501072_0096666 3300049588 Bacteria 2347
249 Ga0501072_0253204 3300049588 Bacteria 1402
250 Ga0501072_0307748 3300049588 Bacteria 1260
251 Ga0501074_0028392 3300049590 Bacteria 4055
252 Ga0501074_0085373 3300049590 Bacteria 2262
253 Ga0501074_0894915 3300049590 Bacteria 625
254 Ga0501075_0005452 3300049591 Bacteria 8700
255 Ga0501075_0011410 3300049591 Bacteria 6288
256 Ga0501075_0016276 3300049591 Bacteria 5354
257 Ga0501076_0006142 3300049592 Bacteria 8695
258 Ga0501076_0033432 3300049592 Bacteria 4015
259 Ga0501076_0038561 3300049592 Bacteria 3751
260 Ga0501076_0060779 3300049592 Bacteria 3007
261 Ga0501076_0565125 3300049592 Bacteria 938
262 Ga0501077_0002181 3300049593 Bacteria 11828
263 Ga0501077_0026951 3300049593 Bacteria 3649
264 Ga0501077_0186607 3300049593 Bacteria 1317
265 Ga0501079_0001980 3300049741 Bacteria 14676
266 Ga0501079_0003803 3300049741 Bacteria 11151
267 Ga0501079_0209673 3300049741 Bacteria 1522
268 Ga0501080_0014324 3300049742 Bacteria 7302
269 Ga0501080_0188490 3300049742 Bacteria 1896
270 Ga0501080_0400931 3300049742 Bacteria 1234
271 Ga0501081_0030009 3300049743 Bacteria 3677
272 Ga0501081_0038768 3300049743 Bacteria 3258
273 Ga0501081_0054156 3300049743 Bacteria 2772
274 Ga0501081_0058930 3300049743 Bacteria 2657
275 Ga0501081_0155298 3300049743 Bacteria 1646
276 Ga0501081_0166328 3300049743 Bacteria 1591
277 Ga0501081_0191035 3300049743 Bacteria 1483
278 Ga0501083_0222599 3300049744 Bacteria 1229
279 Ga0501035_0028409 3300049822 Bacteria 5105
280 Ga0501035_0529558 3300049822 Bacteria 967
281 Ga0501035_0803615 3300049822 Bacteria 751
282 Ga0501045_0013006 3300049824 Bacteria 5867
283 Ga0501045_0013539 3300049824 Bacteria 5762
284 Ga0501045_0021276 3300049824 Bacteria 4639
285 nmdc:mga03n38_124444_c1 3300050490 Bacteria 1271
286 nmdc:mga00v17_437988_c1 3300050491 Bacteria 849
287 nmdc:mga06z11_626447_c1 3300050494 Bacteria 655
288 nmdc:mga07m45_23426_c1 3300050496 Bacteria 3375
289 nmdc:mga08y16_246169_c1 3300050511 Bacteria 1847
290 nmdc:mga08y16_59830_c1 3300050511 Bacteria 3979
291 nmdc:mga0n895_127221_c1 3300050512 Bacteria 2572
292 nmdc:mga0rr50_447708_c1 3300050513 Bacteria 1095
293 nmdc:mga08x19_505052_c1 3300050514 Bacteria 854
294 Ga0495601_0286031 3300053077 Bacteria 1075
295 Ga0495612_0026309 3300053078 Bacteria 2338
296 Ga0500568_0020327 3300053139 Bacteria 2874
297 Ga0501084_0025037 3300054114 Bacteria 4980
298 Ga0501084_0028584 3300054114 Bacteria 4661
299 Ga0501084_0194314 3300054114 Bacteria 1712
300 Ga0590071_000952 3300059421 Bacteria 8005
301 Ga0590074_020544 3300059423 Bacteria 1137
302 Ga0590075_023648 3300059424 Bacteria 1540
303 Ga0590077_003003 3300059426 Bacteria 3531
304 Ga0501082_0013245 3300060353 Bacteria 7092
305 Ga0501082_0151984 3300060353 Bacteria 2011
306 Ga0501082_0658259 3300060353 Bacteria 917
307 Ga0530510_0024351 3300061734 Bacteria 4319
308 Ga0530510_0029998 3300061734 Bacteria 3904
309 Ga0530510_0038591 3300061734 Bacteria 3448
310 Ga0530510_0055828 3300061734 Bacteria 2853
311 Ga0530510_0113311 3300061734 Bacteria 1987

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0451566 Ga0451855_0451566_147_707 133
2 3300041511 Ga0451855_0975324 Ga0451855_0975324_13_531 137
3 3300009148 Ga0105243_10696389 Ga0105243_106963891 148
4 3300042122 Ga0450920_087507 Ga0450920_087507_152_601 148
5 3300049822 Ga0501035_0803615 Ga0501035_0803615_19_468 148
6 3300049587 Ga0501071_0994702 Ga0501071_0994702_21_473 149
7 3300049585 Ga0501069_0037809 Ga0501069_0037809_1256_1813 153
8 3300061734 Ga0530510_0038591 Ga0530510_0038591_159_716 153
9 3300049583 Ga0501067_0019068 Ga0501067_0019068_387_944 155
10 3300005468 Ga0070707_100009790 Ga0070707_10000979013 156
11 3300005471 Ga0070698_100055771 Ga0070698_1000557712 156
12 3300025910 Ga0207684_10198529 Ga0207684_101985292 156
13 3300025922 Ga0207646_10117822 Ga0207646_101178222 156
14 3300049588 Ga0501072_0307748 Ga0501072_0307748_159_680 156
15 3300005536 Ga0070697_100044685 Ga0070697_1000446852 157
16 3300005545 Ga0070695_100103990 Ga0070695_1001039902 157
17 3300006871 Ga0075434_100001709 Ga0075434_1000017093 157
18 3300007076 Ga0075435_100163925 Ga0075435_1001639252 157
19 3300050514 nmdc:mga08x19_505052_c1 nmdc:mga08x19_505052_c1_275_832 157
20 3300050512 nmdc:mga0n895_127221_c1 nmdc:mga0n895_127221_c1_802_1359 158
21 3300050513 nmdc:mga0rr50_447708_c1 nmdc:mga0rr50_447708_c1_402_959 158
22 3300060353 Ga0501082_0658259 Ga0501082_0658259_214_771 158
23 3300005459 Ga0068867_100891486 Ga0068867_1008914862 160
24 3300005467 Ga0070706_100276873 Ga0070706_1002768732 160
25 3300005545 Ga0070695_100859209 Ga0070695_1008592091 160
26 3300041511 Ga0451855_1591985 Ga0451855_1591985_99_659 161
27 3300048919 Ga0496116_0063145 Ga0496116_0063145_878_1432 165
28 3300048925 Ga0496122_0247355 Ga0496122_0247355_406_960 165
29 3300048910 Ga0496107_0755541 Ga0496107_0755541_174_686 169
30 3300009147 Ga0114129_10643056 Ga0114129_106430562 172
31 3300032168 Ga0316593_10002144 Ga0316593_100021445 172
32 3300042125 Ga0450923_010234 Ga0450923_010234_20_541 172
33 3300046461 Ga0495641_0384984 Ga0495641_0384984_92_613 172
34 3300047322 Ga0495680_0299915 Ga0495680_0299915_584_1105 172
35 3300048916 Ga0496113_0118885 Ga0496113_0118885_20_541 172
36 3300048917 Ga0496114_1020287 Ga0496114_1020287_11_532 172
37 3300049575 Ga0501039_0716931 Ga0501039_0716931_26_547 172
38 3300049744 Ga0501083_0222599 Ga0501083_0222599_677_1198 172
39 3300005445 Ga0070708_100000453 Ga0070708_10000045316 173
40 3300025922 Ga0207646_10792289 Ga0207646_107922891 173
41 3300005563 Ga0068855_100045894 Ga0068855_1000458943 174
42 3300025949 Ga0207667_10042833 Ga0207667_100428334 174
43 3300041492 Ga0451835_0016181 Ga0451835_0016181_294_851 174
44 3300048905 Ga0496102_0290424 Ga0496102_0290424_668_1225 174
45 3300048907 Ga0496104_0041275 Ga0496104_0041275_1052_1609 174
46 3300048909 Ga0496106_0529306 Ga0496106_0529306_180_737 174
47 3300048911 Ga0496108_0059616 Ga0496108_0059616_1964_2521 174
48 3300042876 Ga0451577_0230427 Ga0451577_0230427_444_1073 176
49 3300045051 Ga0451576_0003470 Ga0451576_0003470_1843_2472 176
50 3300049569 Ga0501032_0122815 Ga0501032_0122815_58_615 179
51 3300049572 Ga0501036_0071505 Ga0501036_0071505_1266_1823 179
52 3300049574 Ga0501038_0012694 Ga0501038_0012694_526_1083 179
53 3300049576 Ga0501040_0003850 Ga0501040_0003850_3000_3557 179
54 3300049577 Ga0501041_0024501 Ga0501041_0024501_2716_3273 179
55 3300049578 Ga0501042_0026020 Ga0501042_0026020_621_1178 179
56 3300049582 Ga0501048_0028241 Ga0501048_0028241_3111_3668 179
57 3300049584 Ga0501068_0151381 Ga0501068_0151381_43_600 179
58 3300049585 Ga0501069_0137353 Ga0501069_0137353_445_1002 179
59 3300049587 Ga0501071_0003229 Ga0501071_0003229_6499_7056 179
60 3300049590 Ga0501074_0085373 Ga0501074_0085373_1653_2210 179
61 3300049591 Ga0501075_0005452 Ga0501075_0005452_1881_2438 179
62 3300049592 Ga0501076_0038561 Ga0501076_0038561_2685_3242 179
63 3300049593 Ga0501077_0026951 Ga0501077_0026951_1142_1699 179
64 3300049741 Ga0501079_0003803 Ga0501079_0003803_1431_1988 179
65 3300049743 Ga0501081_0058930 Ga0501081_0058930_14_571 179
66 3300049824 Ga0501045_0021276 Ga0501045_0021276_3045_3602 179
67 3300054114 Ga0501084_0194314 Ga0501084_0194314_285_842 179
68 3300061734 Ga0530510_0024351 Ga0530510_0024351_3303_3860 179
69 iso_pu_bacteria 2857472729 2857472869 179
70 iso_pu_bacteria 8002317523 8002321801 179
71 iso_pu_bacteria 8046991243 8046997937 179
72 3300006051 Ga0075364_10289823 Ga0075364_102898231 182
73 3300050491 nmdc:mga00v17_437988_c1 nmdc:mga00v17_437988_c1_229_780 182
74 3300005842 Ga0068858_100079942 Ga0068858_1000799423 183
75 3300006353 Ga0075370_10023835 Ga0075370_100238352 183
76 3300025225 Ga0209566_100118 Ga0209566_10011885 183
77 3300026035 Ga0207703_10022377 Ga0207703_100223775 183
78 3300031727 Ga0316576_10072558 Ga0316576_100725582 183
79 3300045976 Ga0466967_0090351 Ga0466967_0090351_1858_2412 183
80 3300048919 Ga0496116_0160364 Ga0496116_0160364_529_1083 183
81 3300048924 Ga0496121_0162883 Ga0496121_0162883_98_652 183
82 3300049586 Ga0501070_0666908 Ga0501070_0666908_26_580 183
83 3300050490 nmdc:mga03n38_124444_c1 nmdc:mga03n38_124444_c1_702_1256 183
84 3300050494 nmdc:mga06z11_626447_c1 nmdc:mga06z11_626447_c1_32_586 183
85 3300050496 nmdc:mga07m45_23426_c1 nmdc:mga07m45_23426_c1_1984_2538 183
86 3300003316 rootH1_10056096 rootH1_100560962 184
87 3300003320 rootH2_10131447 rootH2_101314473 184
88 3300003322 rootL2_10033832 rootL2_100338322 184
89 3300004799 Ga0058863_11484990 Ga0058863_114849902 184
90 3300004800 Ga0058861_11930275 Ga0058861_119302751 184
91 3300005293 Ga0065715_10319032 Ga0065715_103190321 184
92 3300005295 Ga0065707_10215213 Ga0065707_102152132 184
93 3300005327 Ga0070658_10106046 Ga0070658_101060463 184
94 3300005334 Ga0068869_100079040 Ga0068869_1000790403 184
95 3300005339 Ga0070660_100608440 Ga0070660_1006084402 184
96 3300005340 Ga0070689_100754464 Ga0070689_1007544641 184
97 3300005341 Ga0070691_10110962 Ga0070691_101109622 184
98 3300005343 Ga0070687_100502854 Ga0070687_1005028542 184
99 3300005353 Ga0070669_101165391 Ga0070669_1011653911 184
100 3300005356 Ga0070674_100034031 Ga0070674_1000340312 184
101 3300005356 Ga0070674_100233718 Ga0070674_1002337181 184
102 3300005440 Ga0070705_100029660 Ga0070705_1000296602 184
103 3300005445 Ga0070708_100232999 Ga0070708_1002329993 184
104 3300005445 Ga0070708_100505707 Ga0070708_1005057072 184
105 3300005458 Ga0070681_10087221 Ga0070681_100872213 184
106 3300005458 Ga0070681_10644626 Ga0070681_106446262 184
107 3300005459 Ga0068867_100954561 Ga0068867_1009545611 184
108 3300005459 Ga0068867_101066816 Ga0068867_1010668161 184
109 3300005466 Ga0070685_10485350 Ga0070685_104853501 184
110 3300005468 Ga0070707_100161997 Ga0070707_1001619972 184
111 3300005471 Ga0070698_100017643 Ga0070698_1000176435 184
112 3300005471 Ga0070698_100119054 Ga0070698_1001190541 184
113 3300005518 Ga0070699_100101981 Ga0070699_1001019812 184
114 3300005543 Ga0070672_100336412 Ga0070672_1003364121 184
115 3300005546 Ga0070696_100128343 Ga0070696_1001283433 184
116 3300005549 Ga0070704_100114750 Ga0070704_1001147503 184
117 3300005549 Ga0070704_101073171 Ga0070704_1010731712 184
118 3300005564 Ga0070664_100622356 Ga0070664_1006223562 184
119 3300005617 Ga0068859_100061493 Ga0068859_1000614932 184
120 3300005617 Ga0068859_100677014 Ga0068859_1006770142 184
121 3300005617 Ga0068859_101520926 Ga0068859_1015209261 184
122 3300005618 Ga0068864_100210764 Ga0068864_1002107642 184
123 3300005834 Ga0068851_10293924 Ga0068851_102939242 184
124 3300005937 Ga0081455_10209492 Ga0081455_102094922 184
125 3300005985 Ga0081539_10012932 Ga0081539_100129326 184
126 3300006931 Ga0097620_100061494 Ga0097620_1000614942 184
127 3300006931 Ga0097620_101520976 Ga0097620_1015209762 184
128 3300009092 Ga0105250_10241933 Ga0105250_102419332 184
129 3300009094 Ga0111539_10098459 Ga0111539_100984592 184
130 3300009094 Ga0111539_10930435 Ga0111539_109304352 184
131 3300009098 Ga0105245_10321042 Ga0105245_103210422 184
132 3300009148 Ga0105243_11178456 Ga0105243_111784561 184
133 3300009176 Ga0105242_10303266 Ga0105242_103032662 184
134 3300009176 Ga0105242_11259718 Ga0105242_112597182 184
135 3300009177 Ga0105248_10764847 Ga0105248_107648471 184
136 3300009553 Ga0105249_11058512 Ga0105249_110585122 184
137 3300013308 Ga0157375_10022966 Ga0157375_100229663 184
138 3300014325 Ga0163163_10046577 Ga0163163_100465775 184
139 3300014325 Ga0163163_10131687 Ga0163163_101316874 184
140 3300014326 Ga0157380_10382575 Ga0157380_103825752 184
141 3300017792 Ga0163161_10054847 Ga0163161_100548472 184
142 3300025909 Ga0207705_10410553 Ga0207705_104105532 184
143 3300025912 Ga0207707_10556650 Ga0207707_105566502 184
144 3300025917 Ga0207660_10266909 Ga0207660_102669092 184
145 3300025922 Ga0207646_10161039 Ga0207646_101610392 184
146 3300025922 Ga0207646_10601795 Ga0207646_106017952 184
147 3300025934 Ga0207686_10521101 Ga0207686_105211012 184
148 3300025935 Ga0207709_10403066 Ga0207709_104030662 184
149 3300025935 Ga0207709_10480764 Ga0207709_104807642 184
150 3300025937 Ga0207669_10039812 Ga0207669_100398122 184
151 3300025937 Ga0207669_10563937 Ga0207669_105639372 184
152 3300025938 Ga0207704_10075128 Ga0207704_100751282 184
153 3300025945 Ga0207679_10618062 Ga0207679_106180622 184
154 3300025945 Ga0207679_10925063 Ga0207679_109250631 184
155 3300026035 Ga0207703_10410966 Ga0207703_104109662 184
156 3300026041 Ga0207639_10859881 Ga0207639_108598812 184
157 3300026089 Ga0207648_10617892 Ga0207648_106178922 184
158 3300026095 Ga0207676_10175800 Ga0207676_101758002 184
159 3300026118 Ga0207675_100066970 Ga0207675_1000669702 184
160 3300026118 Ga0207675_100328170 Ga0207675_1003281702 184
161 3300026121 Ga0207683_10865803 Ga0207683_108658032 184
162 3300027665 Ga0209983_1008807 Ga0209983_10088073 184
163 3300027682 Ga0209971_1010972 Ga0209971_10109723 184
164 3300027695 Ga0209966_1004094 Ga0209966_10040943 184
165 3300027717 Ga0209998_10000161 Ga0209998_1000016121 184
166 3300027876 Ga0209974_10001376 Ga0209974_1000137610 184
167 3300027907 Ga0207428_10334049 Ga0207428_103340492 184
168 3300028379 Ga0268266_10566148 Ga0268266_105661482 184
169 3300028800 Ga0265338_10061915 Ga0265338_100619151 184
170 3300029957 Ga0265324_10009856 Ga0265324_100098562 184
171 3300031665 Ga0316575_10057234 Ga0316575_100572342 184
172 3300031727 Ga0316576_10033947 Ga0316576_100339474 184
173 3300031727 Ga0316576_10047216 Ga0316576_100472163 184
174 3300031731 Ga0307405_10428999 Ga0307405_104289992 184
175 3300031824 Ga0307413_10460855 Ga0307413_104608552 184
176 3300031852 Ga0307410_10310789 Ga0307410_103107892 184
177 3300031903 Ga0307407_10693718 Ga0307407_106937182 184
178 3300031995 Ga0307409_100074142 Ga0307409_1000741424 184
179 3300032002 Ga0307416_101489223 Ga0307416_1014892232 184
180 3300032005 Ga0307411_10146247 Ga0307411_101462472 184
181 3300035398 Ga0316574_0028247 Ga0316574_0028247_1422_1979 184
182 3300036712 Ga0316584_0175668 Ga0316584_0175668_884_1441 184
183 3300042145 Ga0450906_045637 Ga0450906_045637_148_705 184
184 3300042435 Ga0439434_0014713 Ga0439434_0014713_709_1266 184
185 3300042531 Ga0450918_014902 Ga0450918_014902_574_1131 184
186 3300046454 Ga0495592_0426466 Ga0495592_0426466_227_784 184
187 3300046461 Ga0495641_0089491 Ga0495641_0089491_108_665 184
188 3300046462 Ga0495651_0036152 Ga0495651_0036152_17_574 184
189 3300046473 Ga0495582_0208734 Ga0495582_0208734_400_957 184
190 3300046514 Ga0495618_0266751 Ga0495618_0266751_450_1007 184
191 3300046516 Ga0495628_0345891 Ga0495628_0345891_372_929 184
192 3300046529 Ga0495652_0189834 Ga0495652_0189834_25_582 184
193 3300046559 Ga0495667_0426120 Ga0495667_0426120_229_786 184
194 3300046675 Ga0495657_0235080 Ga0495657_0235080_26_583 184
195 3300046678 Ga0495599_0452574 Ga0495599_0452574_24_581 184
196 3300046681 Ga0495647_0048056 Ga0495647_0048056_177_734 184
197 3300046683 Ga0495658_0166542 Ga0495658_0166542_54_611 184
198 3300046809 Ga0495600_0372597 Ga0495600_0372597_116_673 184
199 3300047315 Ga0495581_0224100 Ga0495581_0224100_98_655 184
200 3300047317 Ga0495604_0112356 Ga0495604_0112356_1002_1559 184
201 3300047321 Ga0495676_0214513 Ga0495676_0214513_229_786 184
202 3300048088 Ga0495602_0066687 Ga0495602_0066687_1294_1851 184
203 3300048903 Ga0496100_0157863 Ga0496100_0157863_763_1320 184
204 3300048904 Ga0496101_0088638 Ga0496101_0088638_1622_2179 184
205 3300048904 Ga0496101_0089402 Ga0496101_0089402_16_573 184
206 3300048904 Ga0496101_0819008 Ga0496101_0819008_153_710 184
207 3300048905 Ga0496102_0766237 Ga0496102_0766237_194_751 184
208 3300048907 Ga0496104_0098269 Ga0496104_0098269_1118_1675 184
209 3300048908 Ga0496105_0017090 Ga0496105_0017090_3621_4178 184
210 3300048911 Ga0496108_0050300 Ga0496108_0050300_745_1302 184
211 3300048912 Ga0496109_0013464 Ga0496109_0013464_5969_6526 184
212 3300048912 Ga0496109_0165544 Ga0496109_0165544_777_1334 184
213 3300048913 Ga0496110_0031154 Ga0496110_0031154_2346_2903 184
214 3300048913 Ga0496110_0345954 Ga0496110_0345954_563_1120 184
215 3300048914 Ga0496111_0071758 Ga0496111_0071758_806_1363 184
216 3300048915 Ga0496112_0154146 Ga0496112_0154146_1608_2165 184
217 3300048917 Ga0496114_0010043 Ga0496114_0010043_6118_6675 184
218 3300049568 Ga0501031_0020150 Ga0501031_0020150_1372_1929 184
219 3300049568 Ga0501031_0140487 Ga0501031_0140487_548_1105 184
220 3300049568 Ga0501031_0462356 Ga0501031_0462356_147_704 184
221 3300049569 Ga0501032_0112280 Ga0501032_0112280_222_779 184
222 3300049570 Ga0501033_0084554 Ga0501033_0084554_1243_1800 184
223 3300049572 Ga0501036_0020226 Ga0501036_0020226_533_1090 184
224 3300049572 Ga0501036_0149755 Ga0501036_0149755_1275_1832 184
225 3300049573 Ga0501037_0084236 Ga0501037_0084236_416_973 184
226 3300049574 Ga0501038_0028877 Ga0501038_0028877_2167_2724 184
227 3300049574 Ga0501038_0171978 Ga0501038_0171978_756_1313 184
228 3300049575 Ga0501039_0205242 Ga0501039_0205242_395_952 184
229 3300049576 Ga0501040_0001628 Ga0501040_0001628_1662_2219 184
230 3300049577 Ga0501041_0009179 Ga0501041_0009179_3850_4407 184
231 3300049578 Ga0501042_0001740 Ga0501042_0001740_1762_2319 184
232 3300049578 Ga0501042_0337884 Ga0501042_0337884_253_810 184
233 3300049579 Ga0501043_0125160 Ga0501043_0125160_20_577 184
234 3300049580 Ga0501046_0015827 Ga0501046_0015827_4383_4940 184
235 3300049582 Ga0501048_0031788 Ga0501048_0031788_969_1526 184
236 3300049582 Ga0501048_0331733 Ga0501048_0331733_249_806 184
237 3300049583 Ga0501067_0019969 Ga0501067_0019969_2374_2931 184
238 3300049584 Ga0501068_0061338 Ga0501068_0061338_418_975 184
239 3300049584 Ga0501068_0179616 Ga0501068_0179616_544_1101 184
240 3300049585 Ga0501069_0014053 Ga0501069_0014053_3202_3759 184
241 3300049585 Ga0501069_0288616 Ga0501069_0288616_68_625 184
242 3300049586 Ga0501070_0032019 Ga0501070_0032019_2857_3414 184
243 3300049586 Ga0501070_0068893 Ga0501070_0068893_755_1312 184
244 3300049587 Ga0501071_0000248 Ga0501071_0000248_4903_5460 184
245 3300049587 Ga0501071_0096707 Ga0501071_0096707_540_1097 184
246 3300049587 Ga0501071_0229505 Ga0501071_0229505_121_678 184
247 3300049587 Ga0501071_0232143 Ga0501071_0232143_414_971 184
248 3300049588 Ga0501072_0000230 Ga0501072_0000230_12023_12580 184
249 3300049588 Ga0501072_0096666 Ga0501072_0096666_346_903 184
250 3300049588 Ga0501072_0253204 Ga0501072_0253204_320_877 184
251 3300049590 Ga0501074_0028392 Ga0501074_0028392_407_964 184
252 3300049590 Ga0501074_0894915 Ga0501074_0894915_34_591 184
253 3300049591 Ga0501075_0011410 Ga0501075_0011410_1097_1654 184
254 3300049591 Ga0501075_0016276 Ga0501075_0016276_1496_2053 184
255 3300049592 Ga0501076_0006142 Ga0501076_0006142_6413_6970 184
256 3300049592 Ga0501076_0033432 Ga0501076_0033432_2036_2593 184
257 3300049592 Ga0501076_0060779 Ga0501076_0060779_1203_1760 184
258 3300049592 Ga0501076_0565125 Ga0501076_0565125_284_841 184
259 3300049593 Ga0501077_0002181 Ga0501077_0002181_5328_5885 184
260 3300049593 Ga0501077_0186607 Ga0501077_0186607_364_921 184
261 3300049741 Ga0501079_0001980 Ga0501079_0001980_12140_12697 184
262 3300049741 Ga0501079_0209673 Ga0501079_0209673_457_1014 184
263 3300049742 Ga0501080_0014324 Ga0501080_0014324_4513_5070 184
264 3300049742 Ga0501080_0188490 Ga0501080_0188490_1243_1800 184
265 3300049742 Ga0501080_0400931 Ga0501080_0400931_287_844 184
266 3300049743 Ga0501081_0030009 Ga0501081_0030009_2421_2978 184
267 3300049743 Ga0501081_0038768 Ga0501081_0038768_732_1289 184
268 3300049743 Ga0501081_0054156 Ga0501081_0054156_1335_1892 184
269 3300049743 Ga0501081_0155298 Ga0501081_0155298_364_921 184
270 3300049743 Ga0501081_0166328 Ga0501081_0166328_495_1052 184
271 3300049743 Ga0501081_0191035 Ga0501081_0191035_359_916 184
272 3300049822 Ga0501035_0028409 Ga0501035_0028409_148_705 184
273 3300049822 Ga0501035_0529558 Ga0501035_0529558_249_806 184
274 3300049824 Ga0501045_0013006 Ga0501045_0013006_3857_4414 184
275 3300049824 Ga0501045_0013539 Ga0501045_0013539_599_1156 184
276 3300050511 nmdc:mga08y16_246169_c1 nmdc:mga08y16_246169_c1_888_1445 184
277 3300050511 nmdc:mga08y16_59830_c1 nmdc:mga08y16_59830_c1_1021_1578 184
278 3300053077 Ga0495601_0286031 Ga0495601_0286031_423_980 184
279 3300053078 Ga0495612_0026309 Ga0495612_0026309_1103_1660 184
280 3300053139 Ga0500568_0020327 Ga0500568_0020327_1846_2406 184
281 3300054114 Ga0501084_0025037 Ga0501084_0025037_2662_3219 184
282 3300054114 Ga0501084_0028584 Ga0501084_0028584_1147_1704 184
283 3300059421 Ga0590071_000952 Ga0590071_000952_5539_6096 184
284 3300059423 Ga0590074_020544 Ga0590074_020544_394_951 184
285 3300059424 Ga0590075_023648 Ga0590075_023648_518_1075 184
286 3300059426 Ga0590077_003003 Ga0590077_003003_1200_1757 184
287 3300060353 Ga0501082_0013245 Ga0501082_0013245_4596_5153 184
288 3300060353 Ga0501082_0151984 Ga0501082_0151984_455_1012 184
289 3300061734 Ga0530510_0029998 Ga0530510_0029998_3120_3677 184
290 3300061734 Ga0530510_0055828 Ga0530510_0055828_1461_2018 184
291 3300061734 Ga0530510_0113311 Ga0530510_0113311_576_1133 184
292 3300005458 Ga0070681_10071122 Ga0070681_100711223 186
293 3300009093 Ga0105240_10115711 Ga0105240_101157113 186
294 3300009545 Ga0105237_10000864 Ga0105237_100008647 186
295 3300009551 Ga0105238_10088942 Ga0105238_100889423 186
296 3300009987 Ga0105030_100350 Ga0105030_1003502 186
297 3300013307 Ga0157372_10300150 Ga0157372_103001502 186
298 3300013874 Ga0157514_100289 Ga0157514_1002892 186
299 3300025914 Ga0207671_10000164 Ga0207671_1000016481 186
300 3300025924 Ga0207694_10007296 Ga0207694_100072968 186
301 3300037418 Ga0395900_0338089 Ga0395900_0338089_512_1075 186
302 2162886007 SwRhRL2b_contig_2083883 SwRhRL2b_0291.00003230 187
303 3300009148 Ga0105243_10000018 Ga0105243_10000018131 187
304 3300020077 Ga0206351_10603424 Ga0206351_106034241 187
305 3300025935 Ga0207709_10000021 Ga0207709_1000002165 187
306 3300031548 Ga0307408_100000209 Ga0307408_10000020920 187
307 3300031728 Ga0316578_10422512 Ga0316578_104225121 187
308 3300031852 Ga0307410_11076072 Ga0307410_110760721 187
309 3300032004 Ga0307414_10117171 Ga0307414_101171711 187
310 3300032004 Ga0307414_10720438 Ga0307414_107204381 187
311 3300032005 Ga0307411_10305417 Ga0307411_103054172 187
312 3300035088 Ga0373940_0032277 Ga0373940_0032277_714_1298 187
313 3300042876 Ga0451577_0118582 Ga0451577_0118582_769_1332 187
314 3300044673 Ga0453683_0022859 Ga0453683_0022859_889_1452 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

35

196

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lhp-assembly2.cif.gz_T crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9537 109 184
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.949 6 185
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9437 5 187
4jlr-assembly1.cif.gz_S crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab 0.9434 115 178
6xxv-assembly2.cif.gz_F crystal structure of a computationally designed immunogen s2_1.2 in complex with its elicited antibody c57 0.9351 107 180
ID Description Score Start End Superfamily
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9687 34 108 3.30.1360.40
4gfqA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9668 6 187 1.10.132.20
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9616 34 108 3.30.1360.40
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9614 6 180 1.10.132.20
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9588 8 185 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A3L6E905-F1-model_v4 Ribosome-recycling factor, chloroplastic (Ribosome-releasing factor, chloroplastic) 0.9769 5 187 GO:0006412
AF-A0A6A5L148-F1-model_v4 deleted 0.9766 1 187
AF-A0A2N9NL30-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9735 5 187 GO:0005737
GO:0006415
GO:0043023
AF-A0A7C6N339-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9726 5 187 GO:0005737
GO:0006415
GO:0043023
AF-A0A6A5L148-F1-model_v4 deleted 0.9715 1 187

Feature Viewer

pLDDT pTM Quality
91.46 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map