F402802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 204 | 311 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0230427|Ga0451577_0230427_444_1073 |
| Length | 198 |
| Sequence | LFELEQSFIFLFCKNILFNYLIMTEEVQLVLDDAIERLGKIRAGKANPQMLDGLMIDYYGSMTPLTQVANINTPDPRTIAIQPWEKKMIQTIERALMAANLGMTPENNGEIIRLNVPPLTEERRKSLVKQAKQESEDAKVSVRSIRRDMIEEFKKLKKDGLSEDAEKDAEAEAQKIHDRYIRKVDELMEKKEKDILTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 95 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 96 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 111 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 112 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 113 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 114 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 115 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 116 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 121 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 154 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 155 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 156 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 188 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 196 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 198 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 199 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 200 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 203 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 204 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 1.27 |
| Isolates | 0.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.55 |
| Nodule | 0 |
| Rhizoplane | 7.01 |
| Rhizosphere | 86.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2083883 | 2162886007 | Bacteria | 1756 |
| 2 | rootH1_10056096 | 3300003316 | Bacteria | 1469 |
| 3 | rootH2_10131447 | 3300003320 | Bacteria | 2713 |
| 4 | rootL2_10033832 | 3300003322 | Bacteria | 2214 |
| 5 | Ga0058863_11484990 | 3300004799 | Bacteria | 1018 |
| 6 | Ga0058861_11930275 | 3300004800 | Bacteria | 942 |
| 7 | Ga0065715_10319032 | 3300005293 | Bacteria | 1005 |
| 8 | Ga0065707_10215213 | 3300005295 | Bacteria | 1248 |
| 9 | Ga0070658_10106046 | 3300005327 | Bacteria | 2325 |
| 10 | Ga0068869_100079040 | 3300005334 | Bacteria | 2451 |
| 11 | Ga0070660_100608440 | 3300005339 | Bacteria | 914 |
| 12 | Ga0070689_100754464 | 3300005340 | Bacteria | 853 |
| 13 | Ga0070691_10110962 | 3300005341 | Bacteria | 1372 |
| 14 | Ga0070687_100502854 | 3300005343 | Bacteria | 816 |
| 15 | Ga0070669_101165391 | 3300005353 | Bacteria | 665 |
| 16 | Ga0070674_100034031 | 3300005356 | Bacteria | 3398 |
| 17 | Ga0070674_100233718 | 3300005356 | Bacteria | 1436 |
| 18 | Ga0070705_100029660 | 3300005440 | Bacteria | 3012 |
| 19 | Ga0070708_100000453 | 3300005445 | Bacteria | 30747 |
| 20 | Ga0070708_100232999 | 3300005445 | Bacteria | 1728 |
| 21 | Ga0070708_100505707 | 3300005445 | Bacteria | 1140 |
| 22 | Ga0070681_10071122 | 3300005458 | Bacteria | 3444 |
| 23 | Ga0070681_10087221 | 3300005458 | Bacteria | 3074 |
| 24 | Ga0070681_10644626 | 3300005458 | Bacteria | 974 |
| 25 | Ga0068867_100891486 | 3300005459 | Bacteria | 800 |
| 26 | Ga0068867_100954561 | 3300005459 | Bacteria | 775 |
| 27 | Ga0068867_101066816 | 3300005459 | Bacteria | 736 |
| 28 | Ga0070685_10485350 | 3300005466 | Bacteria | 872 |
| 29 | Ga0070706_100276873 | 3300005467 | Bacteria | 1566 |
| 30 | Ga0070707_100009790 | 3300005468 | Bacteria | 8912 |
| 31 | Ga0070707_100161997 | 3300005468 | Bacteria | 2180 |
| 32 | Ga0070698_100017643 | 3300005471 | Bacteria | 7520 |
| 33 | Ga0070698_100055771 | 3300005471 | Bacteria | 4005 |
| 34 | Ga0070698_100119054 | 3300005471 | Bacteria | 2601 |
| 35 | Ga0070699_100101981 | 3300005518 | Bacteria | 2516 |
| 36 | Ga0070697_100044685 | 3300005536 | Bacteria | 3588 |
| 37 | Ga0070672_100336412 | 3300005543 | Bacteria | 1285 |
| 38 | Ga0070695_100103990 | 3300005545 | Bacteria | 1917 |
| 39 | Ga0070695_100859209 | 3300005545 | Bacteria | 730 |
| 40 | Ga0070696_100128343 | 3300005546 | Bacteria | 1842 |
| 41 | Ga0070704_100114750 | 3300005549 | Bacteria | 2057 |
| 42 | Ga0070704_101073171 | 3300005549 | Bacteria | 731 |
| 43 | Ga0068855_100045894 | 3300005563 | Bacteria | 5166 |
| 44 | Ga0070664_100622356 | 3300005564 | Bacteria | 1002 |
| 45 | Ga0068859_100061493 | 3300005617 | Bacteria | 3784 |
| 46 | Ga0068859_100677014 | 3300005617 | Bacteria | 1123 |
| 47 | Ga0068859_101520926 | 3300005617 | Unclassified | 739 |
| 48 | Ga0068864_100210764 | 3300005618 | Bacteria | 1789 |
| 49 | Ga0068851_10293924 | 3300005834 | Bacteria | 932 |
| 50 | Ga0068858_100079942 | 3300005842 | Bacteria | 3038 |
| 51 | Ga0081455_10209492 | 3300005937 | Bacteria | 1453 |
| 52 | Ga0081539_10012932 | 3300005985 | Bacteria | 6349 |
| 53 | Ga0075364_10289823 | 3300006051 | Bacteria | 1114 |
| 54 | Ga0075370_10023835 | 3300006353 | Bacteria | 3375 |
| 55 | Ga0075434_100001709 | 3300006871 | Bacteria | 18796 |
| 56 | Ga0097620_100061494 | 3300006931 | Bacteria | 3784 |
| 57 | Ga0097620_101520976 | 3300006931 | Unclassified | 739 |
| 58 | Ga0075435_100163925 | 3300007076 | Bacteria | 1874 |
| 59 | Ga0105250_10241933 | 3300009092 | Bacteria | 769 |
| 60 | Ga0105240_10115711 | 3300009093 | Bacteria | 3237 |
| 61 | Ga0111539_10098459 | 3300009094 | Bacteria | 3435 |
| 62 | Ga0111539_10930435 | 3300009094 | Bacteria | 1011 |
| 63 | Ga0105245_10321042 | 3300009098 | Bacteria | 1525 |
| 64 | Ga0114129_10643056 | 3300009147 | Bacteria | 1370 |
| 65 | Ga0105243_10000018 | 3300009148 | Bacteria | 227618 |
| 66 | Ga0105243_10696389 | 3300009148 | Bacteria | 990 |
| 67 | Ga0105243_11178456 | 3300009148 | Archaea | 778 |
| 68 | Ga0105242_10303266 | 3300009176 | Bacteria | 1459 |
| 69 | Ga0105242_11259718 | 3300009176 | Bacteria | 761 |
| 70 | Ga0105248_10764847 | 3300009177 | Bacteria | 1090 |
| 71 | Ga0105237_10000864 | 3300009545 | Bacteria | 41160 |
| 72 | Ga0105238_10088942 | 3300009551 | Bacteria | 3075 |
| 73 | Ga0105249_11058512 | 3300009553 | Bacteria | 881 |
| 74 | Ga0105030_100350 | 3300009987 | Bacteria | 4019 |
| 75 | Ga0157372_10300150 | 3300013307 | Bacteria | 1868 |
| 76 | Ga0157375_10022966 | 3300013308 | Bacteria | 5749 |
| 77 | Ga0157514_100289 | 3300013874 | Bacteria | 1595 |
| 78 | Ga0163163_10046577 | 3300014325 | Bacteria | 4260 |
| 79 | Ga0163163_10131687 | 3300014325 | Bacteria | 2541 |
| 80 | Ga0157380_10382575 | 3300014326 | Bacteria | 1329 |
| 81 | Ga0163161_10054847 | 3300017792 | Bacteria | 2893 |
| 82 | Ga0206351_10603424 | 3300020077 | Bacteria | 769 |
| 83 | Ga0209566_100118 | 3300025225 | Bacteria | 105475 |
| 84 | Ga0207705_10410553 | 3300025909 | Unclassified | 1048 |
| 85 | Ga0207684_10198529 | 3300025910 | Bacteria | 1730 |
| 86 | Ga0207707_10556650 | 3300025912 | Bacteria | 974 |
| 87 | Ga0207671_10000164 | 3300025914 | Bacteria | 103302 |
| 88 | Ga0207660_10266909 | 3300025917 | Bacteria | 1355 |
| 89 | Ga0207646_10117822 | 3300025922 | Bacteria | 2385 |
| 90 | Ga0207646_10161039 | 3300025922 | Bacteria | 2025 |
| 91 | Ga0207646_10601795 | 3300025922 | Bacteria | 987 |
| 92 | Ga0207646_10792289 | 3300025922 | Unclassified | 844 |
| 93 | Ga0207694_10007296 | 3300025924 | Bacteria | 8388 |
| 94 | Ga0207686_10521101 | 3300025934 | Bacteria | 925 |
| 95 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 96 | Ga0207709_10403066 | 3300025935 | Bacteria | 1046 |
| 97 | Ga0207709_10480764 | 3300025935 | Bacteria | 966 |
| 98 | Ga0207669_10039812 | 3300025937 | Bacteria | 2720 |
| 99 | Ga0207669_10563937 | 3300025937 | Bacteria | 921 |
| 100 | Ga0207704_10075128 | 3300025938 | Bacteria | 2160 |
| 101 | Ga0207679_10618062 | 3300025945 | Bacteria | 978 |
| 102 | Ga0207679_10925063 | 3300025945 | Bacteria | 798 |
| 103 | Ga0207667_10042833 | 3300025949 | Bacteria | 4809 |
| 104 | Ga0207703_10022377 | 3300026035 | Bacteria | 4958 |
| 105 | Ga0207703_10410966 | 3300026035 | Bacteria | 1258 |
| 106 | Ga0207639_10859881 | 3300026041 | Bacteria | 847 |
| 107 | Ga0207648_10617892 | 3300026089 | Bacteria | 1000 |
| 108 | Ga0207676_10175800 | 3300026095 | Bacteria | 1870 |
| 109 | Ga0207675_100066970 | 3300026118 | Bacteria | 3357 |
| 110 | Ga0207675_100328170 | 3300026118 | Bacteria | 1495 |
| 111 | Ga0207683_10865803 | 3300026121 | Bacteria | 839 |
| 112 | Ga0209983_1008807 | 3300027665 | Bacteria | 2060 |
| 113 | Ga0209971_1010972 | 3300027682 | Bacteria | 2146 |
| 114 | Ga0209966_1004094 | 3300027695 | Bacteria | 2463 |
| 115 | Ga0209998_10000161 | 3300027717 | Bacteria | 24636 |
| 116 | Ga0209974_10001376 | 3300027876 | Bacteria | 8781 |
| 117 | Ga0207428_10334049 | 3300027907 | Bacteria | 1117 |
| 118 | Ga0268266_10566148 | 3300028379 | Bacteria | 1090 |
| 119 | Ga0265338_10061915 | 3300028800 | Bacteria | 3275 |
| 120 | Ga0265324_10009856 | 3300029957 | Bacteria | 3712 |
| 121 | Ga0307408_100000209 | 3300031548 | Bacteria | 62437 |
| 122 | Ga0316575_10057234 | 3300031665 | Bacteria | 1554 |
| 123 | Ga0316576_10033947 | 3300031727 | Bacteria | 3634 |
| 124 | Ga0316576_10047216 | 3300031727 | Bacteria | 3119 |
| 125 | Ga0316576_10072558 | 3300031727 | Bacteria | 2541 |
| 126 | Ga0316578_10422512 | 3300031728 | Bacteria | 789 |
| 127 | Ga0307405_10428999 | 3300031731 | Bacteria | 1042 |
| 128 | Ga0307413_10460855 | 3300031824 | Bacteria | 1011 |
| 129 | Ga0307410_10310789 | 3300031852 | Bacteria | 1247 |
| 130 | Ga0307410_11076072 | 3300031852 | Bacteria | 696 |
| 131 | Ga0307407_10693718 | 3300031903 | Bacteria | 766 |
| 132 | Ga0307409_100074142 | 3300031995 | Bacteria | 2718 |
| 133 | Ga0307416_101489223 | 3300032002 | Bacteria | 782 |
| 134 | Ga0307414_10117171 | 3300032004 | Bacteria | 2040 |
| 135 | Ga0307414_10720438 | 3300032004 | Bacteria | 904 |
| 136 | Ga0307411_10146247 | 3300032005 | Bacteria | 1750 |
| 137 | Ga0307411_10305417 | 3300032005 | Bacteria | 1278 |
| 138 | Ga0316593_10002144 | 3300032168 | Bacteria | 4601 |
| 139 | Ga0373940_0032277 | 3300035088 | Bacteria | 1403 |
| 140 | Ga0316574_0028247 | 3300035398 | Bacteria | 3382 |
| 141 | Ga0316584_0175668 | 3300036712 | Bacteria | 1587 |
| 142 | Ga0395900_0338089 | 3300037418 | Bacteria | 1482 |
| 143 | Ga0451835_0016181 | 3300041492 | Bacteria | 957 |
| 144 | Ga0451855_0451566 | 3300041511 | Bacteria | 871 |
| 145 | Ga0451855_0975324 | 3300041511 | Bacteria | 890 |
| 146 | Ga0451855_1591985 | 3300041511 | Bacteria | 763 |
| 147 | Ga0450920_087507 | 3300042122 | Bacteria | 641 |
| 148 | Ga0450923_010234 | 3300042125 | Bacteria | 1659 |
| 149 | Ga0450906_045637 | 3300042145 | Bacteria | 773 |
| 150 | Ga0439434_0014713 | 3300042435 | Bacteria | 2329 |
| 151 | Ga0450918_014902 | 3300042531 | Bacteria | 1351 |
| 152 | Ga0451577_0118582 | 3300042876 | Bacteria | 2370 |
| 153 | Ga0451577_0230427 | 3300042876 | Bacteria | 1675 |
| 154 | Ga0453683_0022859 | 3300044673 | Bacteria | 3987 |
| 155 | Ga0451576_0003470 | 3300045051 | Bacteria | 21606 |
| 156 | Ga0466967_0090351 | 3300045976 | Bacteria | 2782 |
| 157 | Ga0495592_0426466 | 3300046454 | Bacteria | 835 |
| 158 | Ga0495641_0089491 | 3300046461 | Bacteria | 1376 |
| 159 | Ga0495641_0384984 | 3300046461 | Unclassified | 636 |
| 160 | Ga0495651_0036152 | 3300046462 | Bacteria | 3845 |
| 161 | Ga0495582_0208734 | 3300046473 | Bacteria | 1116 |
| 162 | Ga0495618_0266751 | 3300046514 | Bacteria | 1071 |
| 163 | Ga0495628_0345891 | 3300046516 | Bacteria | 1094 |
| 164 | Ga0495652_0189834 | 3300046529 | Bacteria | 1569 |
| 165 | Ga0495667_0426120 | 3300046559 | Bacteria | 835 |
| 166 | Ga0495657_0235080 | 3300046675 | Bacteria | 1107 |
| 167 | Ga0495599_0452574 | 3300046678 | Bacteria | 760 |
| 168 | Ga0495647_0048056 | 3300046681 | Bacteria | 1649 |
| 169 | Ga0495658_0166542 | 3300046683 | Bacteria | 1362 |
| 170 | Ga0495600_0372597 | 3300046809 | Bacteria | 892 |
| 171 | Ga0495581_0224100 | 3300047315 | Bacteria | 1100 |
| 172 | Ga0495604_0112356 | 3300047317 | Bacteria | 1985 |
| 173 | Ga0495676_0214513 | 3300047321 | Bacteria | 1330 |
| 174 | Ga0495680_0299915 | 3300047322 | Bacteria | 1128 |
| 175 | Ga0495602_0066687 | 3300048088 | Bacteria | 3100 |
| 176 | Ga0496100_0157863 | 3300048903 | Bacteria | 1623 |
| 177 | Ga0496101_0088638 | 3300048904 | Bacteria | 2298 |
| 178 | Ga0496101_0089402 | 3300048904 | Bacteria | 2289 |
| 179 | Ga0496101_0819008 | 3300048904 | Bacteria | 734 |
| 180 | Ga0496102_0290424 | 3300048905 | Bacteria | 1541 |
| 181 | Ga0496102_0766237 | 3300048905 | Bacteria | 888 |
| 182 | Ga0496104_0041275 | 3300048907 | Bacteria | 4326 |
| 183 | Ga0496104_0098269 | 3300048907 | Bacteria | 2802 |
| 184 | Ga0496105_0017090 | 3300048908 | Bacteria | 5808 |
| 185 | Ga0496106_0529306 | 3300048909 | Bacteria | 946 |
| 186 | Ga0496107_0755541 | 3300048910 | Bacteria | 713 |
| 187 | Ga0496108_0050300 | 3300048911 | Bacteria | 3488 |
| 188 | Ga0496108_0059616 | 3300048911 | Bacteria | 3209 |
| 189 | Ga0496109_0013464 | 3300048912 | Bacteria | 7096 |
| 190 | Ga0496109_0165544 | 3300048912 | Bacteria | 2072 |
| 191 | Ga0496110_0031154 | 3300048913 | Bacteria | 4600 |
| 192 | Ga0496110_0345954 | 3300048913 | Bacteria | 1354 |
| 193 | Ga0496111_0071758 | 3300048914 | Bacteria | 2520 |
| 194 | Ga0496112_0154146 | 3300048915 | Bacteria | 2265 |
| 195 | Ga0496113_0118885 | 3300048916 | Bacteria | 2064 |
| 196 | Ga0496114_0010043 | 3300048917 | Bacteria | 7527 |
| 197 | Ga0496114_1020287 | 3300048917 | Bacteria | 711 |
| 198 | Ga0496116_0063145 | 3300048919 | Bacteria | 2387 |
| 199 | Ga0496116_0160364 | 3300048919 | Bacteria | 1235 |
| 200 | Ga0496121_0162883 | 3300048924 | Bacteria | 1629 |
| 201 | Ga0496122_0247355 | 3300048925 | Bacteria | 1000 |
| 202 | Ga0501031_0020150 | 3300049568 | Bacteria | 4347 |
| 203 | Ga0501031_0140487 | 3300049568 | Bacteria | 1578 |
| 204 | Ga0501031_0462356 | 3300049568 | Bacteria | 819 |
| 205 | Ga0501032_0112280 | 3300049569 | Bacteria | 1803 |
| 206 | Ga0501032_0122815 | 3300049569 | Bacteria | 1716 |
| 207 | Ga0501033_0084554 | 3300049570 | Bacteria | 2325 |
| 208 | Ga0501036_0020226 | 3300049572 | Bacteria | 5590 |
| 209 | Ga0501036_0071505 | 3300049572 | Bacteria | 2933 |
| 210 | Ga0501036_0149755 | 3300049572 | Bacteria | 1968 |
| 211 | Ga0501037_0084236 | 3300049573 | Bacteria | 2303 |
| 212 | Ga0501038_0012694 | 3300049574 | Bacteria | 7699 |
| 213 | Ga0501038_0028877 | 3300049574 | Bacteria | 4923 |
| 214 | Ga0501038_0171978 | 3300049574 | Bacteria | 1753 |
| 215 | Ga0501039_0205242 | 3300049575 | Bacteria | 1549 |
| 216 | Ga0501039_0716931 | 3300049575 | Bacteria | 782 |
| 217 | Ga0501040_0001628 | 3300049576 | Bacteria | 14311 |
| 218 | Ga0501040_0003850 | 3300049576 | Bacteria | 9731 |
| 219 | Ga0501041_0009179 | 3300049577 | Bacteria | 5825 |
| 220 | Ga0501041_0024501 | 3300049577 | Bacteria | 3622 |
| 221 | Ga0501042_0001740 | 3300049578 | Bacteria | 13019 |
| 222 | Ga0501042_0026020 | 3300049578 | Bacteria | 4112 |
| 223 | Ga0501042_0337884 | 3300049578 | Bacteria | 1089 |
| 224 | Ga0501043_0125160 | 3300049579 | Bacteria | 2015 |
| 225 | Ga0501046_0015827 | 3300049580 | Bacteria | 6329 |
| 226 | Ga0501048_0028241 | 3300049582 | Bacteria | 4072 |
| 227 | Ga0501048_0031788 | 3300049582 | Bacteria | 3817 |
| 228 | Ga0501048_0331733 | 3300049582 | Bacteria | 1084 |
| 229 | Ga0501067_0019068 | 3300049583 | Bacteria | 3796 |
| 230 | Ga0501067_0019969 | 3300049583 | Bacteria | 3707 |
| 231 | Ga0501068_0061338 | 3300049584 | Bacteria | 2285 |
| 232 | Ga0501068_0151381 | 3300049584 | Bacteria | 1458 |
| 233 | Ga0501068_0179616 | 3300049584 | Bacteria | 1338 |
| 234 | Ga0501069_0014053 | 3300049585 | Bacteria | 4276 |
| 235 | Ga0501069_0037809 | 3300049585 | Bacteria | 2663 |
| 236 | Ga0501069_0137353 | 3300049585 | Bacteria | 1401 |
| 237 | Ga0501069_0288616 | 3300049585 | Bacteria | 961 |
| 238 | Ga0501070_0032019 | 3300049586 | Bacteria | 4403 |
| 239 | Ga0501070_0068893 | 3300049586 | Bacteria | 2929 |
| 240 | Ga0501070_0666908 | 3300049586 | Bacteria | 825 |
| 241 | Ga0501071_0000248 | 3300049587 | Bacteria | 25026 |
| 242 | Ga0501071_0003229 | 3300049587 | Bacteria | 10164 |
| 243 | Ga0501071_0096707 | 3300049587 | Bacteria | 2174 |
| 244 | Ga0501071_0229505 | 3300049587 | Bacteria | 1398 |
| 245 | Ga0501071_0232143 | 3300049587 | Bacteria | 1390 |
| 246 | Ga0501071_0994702 | 3300049587 | Bacteria | 648 |
| 247 | Ga0501072_0000230 | 3300049588 | Bacteria | 41301 |
| 248 | Ga0501072_0096666 | 3300049588 | Bacteria | 2347 |
| 249 | Ga0501072_0253204 | 3300049588 | Bacteria | 1402 |
| 250 | Ga0501072_0307748 | 3300049588 | Bacteria | 1260 |
| 251 | Ga0501074_0028392 | 3300049590 | Bacteria | 4055 |
| 252 | Ga0501074_0085373 | 3300049590 | Bacteria | 2262 |
| 253 | Ga0501074_0894915 | 3300049590 | Bacteria | 625 |
| 254 | Ga0501075_0005452 | 3300049591 | Bacteria | 8700 |
| 255 | Ga0501075_0011410 | 3300049591 | Bacteria | 6288 |
| 256 | Ga0501075_0016276 | 3300049591 | Bacteria | 5354 |
| 257 | Ga0501076_0006142 | 3300049592 | Bacteria | 8695 |
| 258 | Ga0501076_0033432 | 3300049592 | Bacteria | 4015 |
| 259 | Ga0501076_0038561 | 3300049592 | Bacteria | 3751 |
| 260 | Ga0501076_0060779 | 3300049592 | Bacteria | 3007 |
| 261 | Ga0501076_0565125 | 3300049592 | Bacteria | 938 |
| 262 | Ga0501077_0002181 | 3300049593 | Bacteria | 11828 |
| 263 | Ga0501077_0026951 | 3300049593 | Bacteria | 3649 |
| 264 | Ga0501077_0186607 | 3300049593 | Bacteria | 1317 |
| 265 | Ga0501079_0001980 | 3300049741 | Bacteria | 14676 |
| 266 | Ga0501079_0003803 | 3300049741 | Bacteria | 11151 |
| 267 | Ga0501079_0209673 | 3300049741 | Bacteria | 1522 |
| 268 | Ga0501080_0014324 | 3300049742 | Bacteria | 7302 |
| 269 | Ga0501080_0188490 | 3300049742 | Bacteria | 1896 |
| 270 | Ga0501080_0400931 | 3300049742 | Bacteria | 1234 |
| 271 | Ga0501081_0030009 | 3300049743 | Bacteria | 3677 |
| 272 | Ga0501081_0038768 | 3300049743 | Bacteria | 3258 |
| 273 | Ga0501081_0054156 | 3300049743 | Bacteria | 2772 |
| 274 | Ga0501081_0058930 | 3300049743 | Bacteria | 2657 |
| 275 | Ga0501081_0155298 | 3300049743 | Bacteria | 1646 |
| 276 | Ga0501081_0166328 | 3300049743 | Bacteria | 1591 |
| 277 | Ga0501081_0191035 | 3300049743 | Bacteria | 1483 |
| 278 | Ga0501083_0222599 | 3300049744 | Bacteria | 1229 |
| 279 | Ga0501035_0028409 | 3300049822 | Bacteria | 5105 |
| 280 | Ga0501035_0529558 | 3300049822 | Bacteria | 967 |
| 281 | Ga0501035_0803615 | 3300049822 | Bacteria | 751 |
| 282 | Ga0501045_0013006 | 3300049824 | Bacteria | 5867 |
| 283 | Ga0501045_0013539 | 3300049824 | Bacteria | 5762 |
| 284 | Ga0501045_0021276 | 3300049824 | Bacteria | 4639 |
| 285 | nmdc:mga03n38_124444_c1 | 3300050490 | Bacteria | 1271 |
| 286 | nmdc:mga00v17_437988_c1 | 3300050491 | Bacteria | 849 |
| 287 | nmdc:mga06z11_626447_c1 | 3300050494 | Bacteria | 655 |
| 288 | nmdc:mga07m45_23426_c1 | 3300050496 | Bacteria | 3375 |
| 289 | nmdc:mga08y16_246169_c1 | 3300050511 | Bacteria | 1847 |
| 290 | nmdc:mga08y16_59830_c1 | 3300050511 | Bacteria | 3979 |
| 291 | nmdc:mga0n895_127221_c1 | 3300050512 | Bacteria | 2572 |
| 292 | nmdc:mga0rr50_447708_c1 | 3300050513 | Bacteria | 1095 |
| 293 | nmdc:mga08x19_505052_c1 | 3300050514 | Bacteria | 854 |
| 294 | Ga0495601_0286031 | 3300053077 | Bacteria | 1075 |
| 295 | Ga0495612_0026309 | 3300053078 | Bacteria | 2338 |
| 296 | Ga0500568_0020327 | 3300053139 | Bacteria | 2874 |
| 297 | Ga0501084_0025037 | 3300054114 | Bacteria | 4980 |
| 298 | Ga0501084_0028584 | 3300054114 | Bacteria | 4661 |
| 299 | Ga0501084_0194314 | 3300054114 | Bacteria | 1712 |
| 300 | Ga0590071_000952 | 3300059421 | Bacteria | 8005 |
| 301 | Ga0590074_020544 | 3300059423 | Bacteria | 1137 |
| 302 | Ga0590075_023648 | 3300059424 | Bacteria | 1540 |
| 303 | Ga0590077_003003 | 3300059426 | Bacteria | 3531 |
| 304 | Ga0501082_0013245 | 3300060353 | Bacteria | 7092 |
| 305 | Ga0501082_0151984 | 3300060353 | Bacteria | 2011 |
| 306 | Ga0501082_0658259 | 3300060353 | Bacteria | 917 |
| 307 | Ga0530510_0024351 | 3300061734 | Bacteria | 4319 |
| 308 | Ga0530510_0029998 | 3300061734 | Bacteria | 3904 |
| 309 | Ga0530510_0038591 | 3300061734 | Bacteria | 3448 |
| 310 | Ga0530510_0055828 | 3300061734 | Bacteria | 2853 |
| 311 | Ga0530510_0113311 | 3300061734 | Bacteria | 1987 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041511 | Ga0451855_0451566 | Ga0451855_0451566_147_707 | 133 |
| 2 | 3300041511 | Ga0451855_0975324 | Ga0451855_0975324_13_531 | 137 |
| 3 | 3300009148 | Ga0105243_10696389 | Ga0105243_106963891 | 148 |
| 4 | 3300042122 | Ga0450920_087507 | Ga0450920_087507_152_601 | 148 |
| 5 | 3300049822 | Ga0501035_0803615 | Ga0501035_0803615_19_468 | 148 |
| 6 | 3300049587 | Ga0501071_0994702 | Ga0501071_0994702_21_473 | 149 |
| 7 | 3300049585 | Ga0501069_0037809 | Ga0501069_0037809_1256_1813 | 153 |
| 8 | 3300061734 | Ga0530510_0038591 | Ga0530510_0038591_159_716 | 153 |
| 9 | 3300049583 | Ga0501067_0019068 | Ga0501067_0019068_387_944 | 155 |
| 10 | 3300005468 | Ga0070707_100009790 | Ga0070707_10000979013 | 156 |
| 11 | 3300005471 | Ga0070698_100055771 | Ga0070698_1000557712 | 156 |
| 12 | 3300025910 | Ga0207684_10198529 | Ga0207684_101985292 | 156 |
| 13 | 3300025922 | Ga0207646_10117822 | Ga0207646_101178222 | 156 |
| 14 | 3300049588 | Ga0501072_0307748 | Ga0501072_0307748_159_680 | 156 |
| 15 | 3300005536 | Ga0070697_100044685 | Ga0070697_1000446852 | 157 |
| 16 | 3300005545 | Ga0070695_100103990 | Ga0070695_1001039902 | 157 |
| 17 | 3300006871 | Ga0075434_100001709 | Ga0075434_1000017093 | 157 |
| 18 | 3300007076 | Ga0075435_100163925 | Ga0075435_1001639252 | 157 |
| 19 | 3300050514 | nmdc:mga08x19_505052_c1 | nmdc:mga08x19_505052_c1_275_832 | 157 |
| 20 | 3300050512 | nmdc:mga0n895_127221_c1 | nmdc:mga0n895_127221_c1_802_1359 | 158 |
| 21 | 3300050513 | nmdc:mga0rr50_447708_c1 | nmdc:mga0rr50_447708_c1_402_959 | 158 |
| 22 | 3300060353 | Ga0501082_0658259 | Ga0501082_0658259_214_771 | 158 |
| 23 | 3300005459 | Ga0068867_100891486 | Ga0068867_1008914862 | 160 |
| 24 | 3300005467 | Ga0070706_100276873 | Ga0070706_1002768732 | 160 |
| 25 | 3300005545 | Ga0070695_100859209 | Ga0070695_1008592091 | 160 |
| 26 | 3300041511 | Ga0451855_1591985 | Ga0451855_1591985_99_659 | 161 |
| 27 | 3300048919 | Ga0496116_0063145 | Ga0496116_0063145_878_1432 | 165 |
| 28 | 3300048925 | Ga0496122_0247355 | Ga0496122_0247355_406_960 | 165 |
| 29 | 3300048910 | Ga0496107_0755541 | Ga0496107_0755541_174_686 | 169 |
| 30 | 3300009147 | Ga0114129_10643056 | Ga0114129_106430562 | 172 |
| 31 | 3300032168 | Ga0316593_10002144 | Ga0316593_100021445 | 172 |
| 32 | 3300042125 | Ga0450923_010234 | Ga0450923_010234_20_541 | 172 |
| 33 | 3300046461 | Ga0495641_0384984 | Ga0495641_0384984_92_613 | 172 |
| 34 | 3300047322 | Ga0495680_0299915 | Ga0495680_0299915_584_1105 | 172 |
| 35 | 3300048916 | Ga0496113_0118885 | Ga0496113_0118885_20_541 | 172 |
| 36 | 3300048917 | Ga0496114_1020287 | Ga0496114_1020287_11_532 | 172 |
| 37 | 3300049575 | Ga0501039_0716931 | Ga0501039_0716931_26_547 | 172 |
| 38 | 3300049744 | Ga0501083_0222599 | Ga0501083_0222599_677_1198 | 172 |
| 39 | 3300005445 | Ga0070708_100000453 | Ga0070708_10000045316 | 173 |
| 40 | 3300025922 | Ga0207646_10792289 | Ga0207646_107922891 | 173 |
| 41 | 3300005563 | Ga0068855_100045894 | Ga0068855_1000458943 | 174 |
| 42 | 3300025949 | Ga0207667_10042833 | Ga0207667_100428334 | 174 |
| 43 | 3300041492 | Ga0451835_0016181 | Ga0451835_0016181_294_851 | 174 |
| 44 | 3300048905 | Ga0496102_0290424 | Ga0496102_0290424_668_1225 | 174 |
| 45 | 3300048907 | Ga0496104_0041275 | Ga0496104_0041275_1052_1609 | 174 |
| 46 | 3300048909 | Ga0496106_0529306 | Ga0496106_0529306_180_737 | 174 |
| 47 | 3300048911 | Ga0496108_0059616 | Ga0496108_0059616_1964_2521 | 174 |
| 48 | 3300042876 | Ga0451577_0230427 | Ga0451577_0230427_444_1073 | 176 |
| 49 | 3300045051 | Ga0451576_0003470 | Ga0451576_0003470_1843_2472 | 176 |
| 50 | 3300049569 | Ga0501032_0122815 | Ga0501032_0122815_58_615 | 179 |
| 51 | 3300049572 | Ga0501036_0071505 | Ga0501036_0071505_1266_1823 | 179 |
| 52 | 3300049574 | Ga0501038_0012694 | Ga0501038_0012694_526_1083 | 179 |
| 53 | 3300049576 | Ga0501040_0003850 | Ga0501040_0003850_3000_3557 | 179 |
| 54 | 3300049577 | Ga0501041_0024501 | Ga0501041_0024501_2716_3273 | 179 |
| 55 | 3300049578 | Ga0501042_0026020 | Ga0501042_0026020_621_1178 | 179 |
| 56 | 3300049582 | Ga0501048_0028241 | Ga0501048_0028241_3111_3668 | 179 |
| 57 | 3300049584 | Ga0501068_0151381 | Ga0501068_0151381_43_600 | 179 |
| 58 | 3300049585 | Ga0501069_0137353 | Ga0501069_0137353_445_1002 | 179 |
| 59 | 3300049587 | Ga0501071_0003229 | Ga0501071_0003229_6499_7056 | 179 |
| 60 | 3300049590 | Ga0501074_0085373 | Ga0501074_0085373_1653_2210 | 179 |
| 61 | 3300049591 | Ga0501075_0005452 | Ga0501075_0005452_1881_2438 | 179 |
| 62 | 3300049592 | Ga0501076_0038561 | Ga0501076_0038561_2685_3242 | 179 |
| 63 | 3300049593 | Ga0501077_0026951 | Ga0501077_0026951_1142_1699 | 179 |
| 64 | 3300049741 | Ga0501079_0003803 | Ga0501079_0003803_1431_1988 | 179 |
| 65 | 3300049743 | Ga0501081_0058930 | Ga0501081_0058930_14_571 | 179 |
| 66 | 3300049824 | Ga0501045_0021276 | Ga0501045_0021276_3045_3602 | 179 |
| 67 | 3300054114 | Ga0501084_0194314 | Ga0501084_0194314_285_842 | 179 |
| 68 | 3300061734 | Ga0530510_0024351 | Ga0530510_0024351_3303_3860 | 179 |
| 69 | iso_pu_bacteria | 2857472729 | 2857472869 | 179 |
| 70 | iso_pu_bacteria | 8002317523 | 8002321801 | 179 |
| 71 | iso_pu_bacteria | 8046991243 | 8046997937 | 179 |
| 72 | 3300006051 | Ga0075364_10289823 | Ga0075364_102898231 | 182 |
| 73 | 3300050491 | nmdc:mga00v17_437988_c1 | nmdc:mga00v17_437988_c1_229_780 | 182 |
| 74 | 3300005842 | Ga0068858_100079942 | Ga0068858_1000799423 | 183 |
| 75 | 3300006353 | Ga0075370_10023835 | Ga0075370_100238352 | 183 |
| 76 | 3300025225 | Ga0209566_100118 | Ga0209566_10011885 | 183 |
| 77 | 3300026035 | Ga0207703_10022377 | Ga0207703_100223775 | 183 |
| 78 | 3300031727 | Ga0316576_10072558 | Ga0316576_100725582 | 183 |
| 79 | 3300045976 | Ga0466967_0090351 | Ga0466967_0090351_1858_2412 | 183 |
| 80 | 3300048919 | Ga0496116_0160364 | Ga0496116_0160364_529_1083 | 183 |
| 81 | 3300048924 | Ga0496121_0162883 | Ga0496121_0162883_98_652 | 183 |
| 82 | 3300049586 | Ga0501070_0666908 | Ga0501070_0666908_26_580 | 183 |
| 83 | 3300050490 | nmdc:mga03n38_124444_c1 | nmdc:mga03n38_124444_c1_702_1256 | 183 |
| 84 | 3300050494 | nmdc:mga06z11_626447_c1 | nmdc:mga06z11_626447_c1_32_586 | 183 |
| 85 | 3300050496 | nmdc:mga07m45_23426_c1 | nmdc:mga07m45_23426_c1_1984_2538 | 183 |
| 86 | 3300003316 | rootH1_10056096 | rootH1_100560962 | 184 |
| 87 | 3300003320 | rootH2_10131447 | rootH2_101314473 | 184 |
| 88 | 3300003322 | rootL2_10033832 | rootL2_100338322 | 184 |
| 89 | 3300004799 | Ga0058863_11484990 | Ga0058863_114849902 | 184 |
| 90 | 3300004800 | Ga0058861_11930275 | Ga0058861_119302751 | 184 |
| 91 | 3300005293 | Ga0065715_10319032 | Ga0065715_103190321 | 184 |
| 92 | 3300005295 | Ga0065707_10215213 | Ga0065707_102152132 | 184 |
| 93 | 3300005327 | Ga0070658_10106046 | Ga0070658_101060463 | 184 |
| 94 | 3300005334 | Ga0068869_100079040 | Ga0068869_1000790403 | 184 |
| 95 | 3300005339 | Ga0070660_100608440 | Ga0070660_1006084402 | 184 |
| 96 | 3300005340 | Ga0070689_100754464 | Ga0070689_1007544641 | 184 |
| 97 | 3300005341 | Ga0070691_10110962 | Ga0070691_101109622 | 184 |
| 98 | 3300005343 | Ga0070687_100502854 | Ga0070687_1005028542 | 184 |
| 99 | 3300005353 | Ga0070669_101165391 | Ga0070669_1011653911 | 184 |
| 100 | 3300005356 | Ga0070674_100034031 | Ga0070674_1000340312 | 184 |
| 101 | 3300005356 | Ga0070674_100233718 | Ga0070674_1002337181 | 184 |
| 102 | 3300005440 | Ga0070705_100029660 | Ga0070705_1000296602 | 184 |
| 103 | 3300005445 | Ga0070708_100232999 | Ga0070708_1002329993 | 184 |
| 104 | 3300005445 | Ga0070708_100505707 | Ga0070708_1005057072 | 184 |
| 105 | 3300005458 | Ga0070681_10087221 | Ga0070681_100872213 | 184 |
| 106 | 3300005458 | Ga0070681_10644626 | Ga0070681_106446262 | 184 |
| 107 | 3300005459 | Ga0068867_100954561 | Ga0068867_1009545611 | 184 |
| 108 | 3300005459 | Ga0068867_101066816 | Ga0068867_1010668161 | 184 |
| 109 | 3300005466 | Ga0070685_10485350 | Ga0070685_104853501 | 184 |
| 110 | 3300005468 | Ga0070707_100161997 | Ga0070707_1001619972 | 184 |
| 111 | 3300005471 | Ga0070698_100017643 | Ga0070698_1000176435 | 184 |
| 112 | 3300005471 | Ga0070698_100119054 | Ga0070698_1001190541 | 184 |
| 113 | 3300005518 | Ga0070699_100101981 | Ga0070699_1001019812 | 184 |
| 114 | 3300005543 | Ga0070672_100336412 | Ga0070672_1003364121 | 184 |
| 115 | 3300005546 | Ga0070696_100128343 | Ga0070696_1001283433 | 184 |
| 116 | 3300005549 | Ga0070704_100114750 | Ga0070704_1001147503 | 184 |
| 117 | 3300005549 | Ga0070704_101073171 | Ga0070704_1010731712 | 184 |
| 118 | 3300005564 | Ga0070664_100622356 | Ga0070664_1006223562 | 184 |
| 119 | 3300005617 | Ga0068859_100061493 | Ga0068859_1000614932 | 184 |
| 120 | 3300005617 | Ga0068859_100677014 | Ga0068859_1006770142 | 184 |
| 121 | 3300005617 | Ga0068859_101520926 | Ga0068859_1015209261 | 184 |
| 122 | 3300005618 | Ga0068864_100210764 | Ga0068864_1002107642 | 184 |
| 123 | 3300005834 | Ga0068851_10293924 | Ga0068851_102939242 | 184 |
| 124 | 3300005937 | Ga0081455_10209492 | Ga0081455_102094922 | 184 |
| 125 | 3300005985 | Ga0081539_10012932 | Ga0081539_100129326 | 184 |
| 126 | 3300006931 | Ga0097620_100061494 | Ga0097620_1000614942 | 184 |
| 127 | 3300006931 | Ga0097620_101520976 | Ga0097620_1015209762 | 184 |
| 128 | 3300009092 | Ga0105250_10241933 | Ga0105250_102419332 | 184 |
| 129 | 3300009094 | Ga0111539_10098459 | Ga0111539_100984592 | 184 |
| 130 | 3300009094 | Ga0111539_10930435 | Ga0111539_109304352 | 184 |
| 131 | 3300009098 | Ga0105245_10321042 | Ga0105245_103210422 | 184 |
| 132 | 3300009148 | Ga0105243_11178456 | Ga0105243_111784561 | 184 |
| 133 | 3300009176 | Ga0105242_10303266 | Ga0105242_103032662 | 184 |
| 134 | 3300009176 | Ga0105242_11259718 | Ga0105242_112597182 | 184 |
| 135 | 3300009177 | Ga0105248_10764847 | Ga0105248_107648471 | 184 |
| 136 | 3300009553 | Ga0105249_11058512 | Ga0105249_110585122 | 184 |
| 137 | 3300013308 | Ga0157375_10022966 | Ga0157375_100229663 | 184 |
| 138 | 3300014325 | Ga0163163_10046577 | Ga0163163_100465775 | 184 |
| 139 | 3300014325 | Ga0163163_10131687 | Ga0163163_101316874 | 184 |
| 140 | 3300014326 | Ga0157380_10382575 | Ga0157380_103825752 | 184 |
| 141 | 3300017792 | Ga0163161_10054847 | Ga0163161_100548472 | 184 |
| 142 | 3300025909 | Ga0207705_10410553 | Ga0207705_104105532 | 184 |
| 143 | 3300025912 | Ga0207707_10556650 | Ga0207707_105566502 | 184 |
| 144 | 3300025917 | Ga0207660_10266909 | Ga0207660_102669092 | 184 |
| 145 | 3300025922 | Ga0207646_10161039 | Ga0207646_101610392 | 184 |
| 146 | 3300025922 | Ga0207646_10601795 | Ga0207646_106017952 | 184 |
| 147 | 3300025934 | Ga0207686_10521101 | Ga0207686_105211012 | 184 |
| 148 | 3300025935 | Ga0207709_10403066 | Ga0207709_104030662 | 184 |
| 149 | 3300025935 | Ga0207709_10480764 | Ga0207709_104807642 | 184 |
| 150 | 3300025937 | Ga0207669_10039812 | Ga0207669_100398122 | 184 |
| 151 | 3300025937 | Ga0207669_10563937 | Ga0207669_105639372 | 184 |
| 152 | 3300025938 | Ga0207704_10075128 | Ga0207704_100751282 | 184 |
| 153 | 3300025945 | Ga0207679_10618062 | Ga0207679_106180622 | 184 |
| 154 | 3300025945 | Ga0207679_10925063 | Ga0207679_109250631 | 184 |
| 155 | 3300026035 | Ga0207703_10410966 | Ga0207703_104109662 | 184 |
| 156 | 3300026041 | Ga0207639_10859881 | Ga0207639_108598812 | 184 |
| 157 | 3300026089 | Ga0207648_10617892 | Ga0207648_106178922 | 184 |
| 158 | 3300026095 | Ga0207676_10175800 | Ga0207676_101758002 | 184 |
| 159 | 3300026118 | Ga0207675_100066970 | Ga0207675_1000669702 | 184 |
| 160 | 3300026118 | Ga0207675_100328170 | Ga0207675_1003281702 | 184 |
| 161 | 3300026121 | Ga0207683_10865803 | Ga0207683_108658032 | 184 |
| 162 | 3300027665 | Ga0209983_1008807 | Ga0209983_10088073 | 184 |
| 163 | 3300027682 | Ga0209971_1010972 | Ga0209971_10109723 | 184 |
| 164 | 3300027695 | Ga0209966_1004094 | Ga0209966_10040943 | 184 |
| 165 | 3300027717 | Ga0209998_10000161 | Ga0209998_1000016121 | 184 |
| 166 | 3300027876 | Ga0209974_10001376 | Ga0209974_1000137610 | 184 |
| 167 | 3300027907 | Ga0207428_10334049 | Ga0207428_103340492 | 184 |
| 168 | 3300028379 | Ga0268266_10566148 | Ga0268266_105661482 | 184 |
| 169 | 3300028800 | Ga0265338_10061915 | Ga0265338_100619151 | 184 |
| 170 | 3300029957 | Ga0265324_10009856 | Ga0265324_100098562 | 184 |
| 171 | 3300031665 | Ga0316575_10057234 | Ga0316575_100572342 | 184 |
| 172 | 3300031727 | Ga0316576_10033947 | Ga0316576_100339474 | 184 |
| 173 | 3300031727 | Ga0316576_10047216 | Ga0316576_100472163 | 184 |
| 174 | 3300031731 | Ga0307405_10428999 | Ga0307405_104289992 | 184 |
| 175 | 3300031824 | Ga0307413_10460855 | Ga0307413_104608552 | 184 |
| 176 | 3300031852 | Ga0307410_10310789 | Ga0307410_103107892 | 184 |
| 177 | 3300031903 | Ga0307407_10693718 | Ga0307407_106937182 | 184 |
| 178 | 3300031995 | Ga0307409_100074142 | Ga0307409_1000741424 | 184 |
| 179 | 3300032002 | Ga0307416_101489223 | Ga0307416_1014892232 | 184 |
| 180 | 3300032005 | Ga0307411_10146247 | Ga0307411_101462472 | 184 |
| 181 | 3300035398 | Ga0316574_0028247 | Ga0316574_0028247_1422_1979 | 184 |
| 182 | 3300036712 | Ga0316584_0175668 | Ga0316584_0175668_884_1441 | 184 |
| 183 | 3300042145 | Ga0450906_045637 | Ga0450906_045637_148_705 | 184 |
| 184 | 3300042435 | Ga0439434_0014713 | Ga0439434_0014713_709_1266 | 184 |
| 185 | 3300042531 | Ga0450918_014902 | Ga0450918_014902_574_1131 | 184 |
| 186 | 3300046454 | Ga0495592_0426466 | Ga0495592_0426466_227_784 | 184 |
| 187 | 3300046461 | Ga0495641_0089491 | Ga0495641_0089491_108_665 | 184 |
| 188 | 3300046462 | Ga0495651_0036152 | Ga0495651_0036152_17_574 | 184 |
| 189 | 3300046473 | Ga0495582_0208734 | Ga0495582_0208734_400_957 | 184 |
| 190 | 3300046514 | Ga0495618_0266751 | Ga0495618_0266751_450_1007 | 184 |
| 191 | 3300046516 | Ga0495628_0345891 | Ga0495628_0345891_372_929 | 184 |
| 192 | 3300046529 | Ga0495652_0189834 | Ga0495652_0189834_25_582 | 184 |
| 193 | 3300046559 | Ga0495667_0426120 | Ga0495667_0426120_229_786 | 184 |
| 194 | 3300046675 | Ga0495657_0235080 | Ga0495657_0235080_26_583 | 184 |
| 195 | 3300046678 | Ga0495599_0452574 | Ga0495599_0452574_24_581 | 184 |
| 196 | 3300046681 | Ga0495647_0048056 | Ga0495647_0048056_177_734 | 184 |
| 197 | 3300046683 | Ga0495658_0166542 | Ga0495658_0166542_54_611 | 184 |
| 198 | 3300046809 | Ga0495600_0372597 | Ga0495600_0372597_116_673 | 184 |
| 199 | 3300047315 | Ga0495581_0224100 | Ga0495581_0224100_98_655 | 184 |
| 200 | 3300047317 | Ga0495604_0112356 | Ga0495604_0112356_1002_1559 | 184 |
| 201 | 3300047321 | Ga0495676_0214513 | Ga0495676_0214513_229_786 | 184 |
| 202 | 3300048088 | Ga0495602_0066687 | Ga0495602_0066687_1294_1851 | 184 |
| 203 | 3300048903 | Ga0496100_0157863 | Ga0496100_0157863_763_1320 | 184 |
| 204 | 3300048904 | Ga0496101_0088638 | Ga0496101_0088638_1622_2179 | 184 |
| 205 | 3300048904 | Ga0496101_0089402 | Ga0496101_0089402_16_573 | 184 |
| 206 | 3300048904 | Ga0496101_0819008 | Ga0496101_0819008_153_710 | 184 |
| 207 | 3300048905 | Ga0496102_0766237 | Ga0496102_0766237_194_751 | 184 |
| 208 | 3300048907 | Ga0496104_0098269 | Ga0496104_0098269_1118_1675 | 184 |
| 209 | 3300048908 | Ga0496105_0017090 | Ga0496105_0017090_3621_4178 | 184 |
| 210 | 3300048911 | Ga0496108_0050300 | Ga0496108_0050300_745_1302 | 184 |
| 211 | 3300048912 | Ga0496109_0013464 | Ga0496109_0013464_5969_6526 | 184 |
| 212 | 3300048912 | Ga0496109_0165544 | Ga0496109_0165544_777_1334 | 184 |
| 213 | 3300048913 | Ga0496110_0031154 | Ga0496110_0031154_2346_2903 | 184 |
| 214 | 3300048913 | Ga0496110_0345954 | Ga0496110_0345954_563_1120 | 184 |
| 215 | 3300048914 | Ga0496111_0071758 | Ga0496111_0071758_806_1363 | 184 |
| 216 | 3300048915 | Ga0496112_0154146 | Ga0496112_0154146_1608_2165 | 184 |
| 217 | 3300048917 | Ga0496114_0010043 | Ga0496114_0010043_6118_6675 | 184 |
| 218 | 3300049568 | Ga0501031_0020150 | Ga0501031_0020150_1372_1929 | 184 |
| 219 | 3300049568 | Ga0501031_0140487 | Ga0501031_0140487_548_1105 | 184 |
| 220 | 3300049568 | Ga0501031_0462356 | Ga0501031_0462356_147_704 | 184 |
| 221 | 3300049569 | Ga0501032_0112280 | Ga0501032_0112280_222_779 | 184 |
| 222 | 3300049570 | Ga0501033_0084554 | Ga0501033_0084554_1243_1800 | 184 |
| 223 | 3300049572 | Ga0501036_0020226 | Ga0501036_0020226_533_1090 | 184 |
| 224 | 3300049572 | Ga0501036_0149755 | Ga0501036_0149755_1275_1832 | 184 |
| 225 | 3300049573 | Ga0501037_0084236 | Ga0501037_0084236_416_973 | 184 |
| 226 | 3300049574 | Ga0501038_0028877 | Ga0501038_0028877_2167_2724 | 184 |
| 227 | 3300049574 | Ga0501038_0171978 | Ga0501038_0171978_756_1313 | 184 |
| 228 | 3300049575 | Ga0501039_0205242 | Ga0501039_0205242_395_952 | 184 |
| 229 | 3300049576 | Ga0501040_0001628 | Ga0501040_0001628_1662_2219 | 184 |
| 230 | 3300049577 | Ga0501041_0009179 | Ga0501041_0009179_3850_4407 | 184 |
| 231 | 3300049578 | Ga0501042_0001740 | Ga0501042_0001740_1762_2319 | 184 |
| 232 | 3300049578 | Ga0501042_0337884 | Ga0501042_0337884_253_810 | 184 |
| 233 | 3300049579 | Ga0501043_0125160 | Ga0501043_0125160_20_577 | 184 |
| 234 | 3300049580 | Ga0501046_0015827 | Ga0501046_0015827_4383_4940 | 184 |
| 235 | 3300049582 | Ga0501048_0031788 | Ga0501048_0031788_969_1526 | 184 |
| 236 | 3300049582 | Ga0501048_0331733 | Ga0501048_0331733_249_806 | 184 |
| 237 | 3300049583 | Ga0501067_0019969 | Ga0501067_0019969_2374_2931 | 184 |
| 238 | 3300049584 | Ga0501068_0061338 | Ga0501068_0061338_418_975 | 184 |
| 239 | 3300049584 | Ga0501068_0179616 | Ga0501068_0179616_544_1101 | 184 |
| 240 | 3300049585 | Ga0501069_0014053 | Ga0501069_0014053_3202_3759 | 184 |
| 241 | 3300049585 | Ga0501069_0288616 | Ga0501069_0288616_68_625 | 184 |
| 242 | 3300049586 | Ga0501070_0032019 | Ga0501070_0032019_2857_3414 | 184 |
| 243 | 3300049586 | Ga0501070_0068893 | Ga0501070_0068893_755_1312 | 184 |
| 244 | 3300049587 | Ga0501071_0000248 | Ga0501071_0000248_4903_5460 | 184 |
| 245 | 3300049587 | Ga0501071_0096707 | Ga0501071_0096707_540_1097 | 184 |
| 246 | 3300049587 | Ga0501071_0229505 | Ga0501071_0229505_121_678 | 184 |
| 247 | 3300049587 | Ga0501071_0232143 | Ga0501071_0232143_414_971 | 184 |
| 248 | 3300049588 | Ga0501072_0000230 | Ga0501072_0000230_12023_12580 | 184 |
| 249 | 3300049588 | Ga0501072_0096666 | Ga0501072_0096666_346_903 | 184 |
| 250 | 3300049588 | Ga0501072_0253204 | Ga0501072_0253204_320_877 | 184 |
| 251 | 3300049590 | Ga0501074_0028392 | Ga0501074_0028392_407_964 | 184 |
| 252 | 3300049590 | Ga0501074_0894915 | Ga0501074_0894915_34_591 | 184 |
| 253 | 3300049591 | Ga0501075_0011410 | Ga0501075_0011410_1097_1654 | 184 |
| 254 | 3300049591 | Ga0501075_0016276 | Ga0501075_0016276_1496_2053 | 184 |
| 255 | 3300049592 | Ga0501076_0006142 | Ga0501076_0006142_6413_6970 | 184 |
| 256 | 3300049592 | Ga0501076_0033432 | Ga0501076_0033432_2036_2593 | 184 |
| 257 | 3300049592 | Ga0501076_0060779 | Ga0501076_0060779_1203_1760 | 184 |
| 258 | 3300049592 | Ga0501076_0565125 | Ga0501076_0565125_284_841 | 184 |
| 259 | 3300049593 | Ga0501077_0002181 | Ga0501077_0002181_5328_5885 | 184 |
| 260 | 3300049593 | Ga0501077_0186607 | Ga0501077_0186607_364_921 | 184 |
| 261 | 3300049741 | Ga0501079_0001980 | Ga0501079_0001980_12140_12697 | 184 |
| 262 | 3300049741 | Ga0501079_0209673 | Ga0501079_0209673_457_1014 | 184 |
| 263 | 3300049742 | Ga0501080_0014324 | Ga0501080_0014324_4513_5070 | 184 |
| 264 | 3300049742 | Ga0501080_0188490 | Ga0501080_0188490_1243_1800 | 184 |
| 265 | 3300049742 | Ga0501080_0400931 | Ga0501080_0400931_287_844 | 184 |
| 266 | 3300049743 | Ga0501081_0030009 | Ga0501081_0030009_2421_2978 | 184 |
| 267 | 3300049743 | Ga0501081_0038768 | Ga0501081_0038768_732_1289 | 184 |
| 268 | 3300049743 | Ga0501081_0054156 | Ga0501081_0054156_1335_1892 | 184 |
| 269 | 3300049743 | Ga0501081_0155298 | Ga0501081_0155298_364_921 | 184 |
| 270 | 3300049743 | Ga0501081_0166328 | Ga0501081_0166328_495_1052 | 184 |
| 271 | 3300049743 | Ga0501081_0191035 | Ga0501081_0191035_359_916 | 184 |
| 272 | 3300049822 | Ga0501035_0028409 | Ga0501035_0028409_148_705 | 184 |
| 273 | 3300049822 | Ga0501035_0529558 | Ga0501035_0529558_249_806 | 184 |
| 274 | 3300049824 | Ga0501045_0013006 | Ga0501045_0013006_3857_4414 | 184 |
| 275 | 3300049824 | Ga0501045_0013539 | Ga0501045_0013539_599_1156 | 184 |
| 276 | 3300050511 | nmdc:mga08y16_246169_c1 | nmdc:mga08y16_246169_c1_888_1445 | 184 |
| 277 | 3300050511 | nmdc:mga08y16_59830_c1 | nmdc:mga08y16_59830_c1_1021_1578 | 184 |
| 278 | 3300053077 | Ga0495601_0286031 | Ga0495601_0286031_423_980 | 184 |
| 279 | 3300053078 | Ga0495612_0026309 | Ga0495612_0026309_1103_1660 | 184 |
| 280 | 3300053139 | Ga0500568_0020327 | Ga0500568_0020327_1846_2406 | 184 |
| 281 | 3300054114 | Ga0501084_0025037 | Ga0501084_0025037_2662_3219 | 184 |
| 282 | 3300054114 | Ga0501084_0028584 | Ga0501084_0028584_1147_1704 | 184 |
| 283 | 3300059421 | Ga0590071_000952 | Ga0590071_000952_5539_6096 | 184 |
| 284 | 3300059423 | Ga0590074_020544 | Ga0590074_020544_394_951 | 184 |
| 285 | 3300059424 | Ga0590075_023648 | Ga0590075_023648_518_1075 | 184 |
| 286 | 3300059426 | Ga0590077_003003 | Ga0590077_003003_1200_1757 | 184 |
| 287 | 3300060353 | Ga0501082_0013245 | Ga0501082_0013245_4596_5153 | 184 |
| 288 | 3300060353 | Ga0501082_0151984 | Ga0501082_0151984_455_1012 | 184 |
| 289 | 3300061734 | Ga0530510_0029998 | Ga0530510_0029998_3120_3677 | 184 |
| 290 | 3300061734 | Ga0530510_0055828 | Ga0530510_0055828_1461_2018 | 184 |
| 291 | 3300061734 | Ga0530510_0113311 | Ga0530510_0113311_576_1133 | 184 |
| 292 | 3300005458 | Ga0070681_10071122 | Ga0070681_100711223 | 186 |
| 293 | 3300009093 | Ga0105240_10115711 | Ga0105240_101157113 | 186 |
| 294 | 3300009545 | Ga0105237_10000864 | Ga0105237_100008647 | 186 |
| 295 | 3300009551 | Ga0105238_10088942 | Ga0105238_100889423 | 186 |
| 296 | 3300009987 | Ga0105030_100350 | Ga0105030_1003502 | 186 |
| 297 | 3300013307 | Ga0157372_10300150 | Ga0157372_103001502 | 186 |
| 298 | 3300013874 | Ga0157514_100289 | Ga0157514_1002892 | 186 |
| 299 | 3300025914 | Ga0207671_10000164 | Ga0207671_1000016481 | 186 |
| 300 | 3300025924 | Ga0207694_10007296 | Ga0207694_100072968 | 186 |
| 301 | 3300037418 | Ga0395900_0338089 | Ga0395900_0338089_512_1075 | 186 |
| 302 | 2162886007 | SwRhRL2b_contig_2083883 | SwRhRL2b_0291.00003230 | 187 |
| 303 | 3300009148 | Ga0105243_10000018 | Ga0105243_10000018131 | 187 |
| 304 | 3300020077 | Ga0206351_10603424 | Ga0206351_106034241 | 187 |
| 305 | 3300025935 | Ga0207709_10000021 | Ga0207709_1000002165 | 187 |
| 306 | 3300031548 | Ga0307408_100000209 | Ga0307408_10000020920 | 187 |
| 307 | 3300031728 | Ga0316578_10422512 | Ga0316578_104225121 | 187 |
| 308 | 3300031852 | Ga0307410_11076072 | Ga0307410_110760721 | 187 |
| 309 | 3300032004 | Ga0307414_10117171 | Ga0307414_101171711 | 187 |
| 310 | 3300032004 | Ga0307414_10720438 | Ga0307414_107204381 | 187 |
| 311 | 3300032005 | Ga0307411_10305417 | Ga0307411_103054172 | 187 |
| 312 | 3300035088 | Ga0373940_0032277 | Ga0373940_0032277_714_1298 | 187 |
| 313 | 3300042876 | Ga0451577_0118582 | Ga0451577_0118582_769_1332 | 187 |
| 314 | 3300044673 | Ga0453683_0022859 | Ga0453683_0022859_889_1452 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lhp-assembly2.cif.gz_T | crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex | 0.9537 | 109 | 184 |
| 5wp3-assembly1.cif.gz_B | crystal structure of eed in complex with eb22 | 0.949 | 6 | 185 |
| 3lf9-assembly1.cif.gz_A | crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c | 0.9437 | 5 | 187 |
| 4jlr-assembly1.cif.gz_S | crystal structure of a designed respiratory syncytial virus immunogen in complex with motavizumab | 0.9434 | 115 | 178 |
| 6xxv-assembly2.cif.gz_F | crystal structure of a computationally designed immunogen s2_1.2 in complex with its elicited antibody c57 | 0.9351 | 107 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGY1_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9687 | 34 | 108 | 3.30.1360.40 |
| 4gfqA01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9668 | 6 | 187 | 1.10.132.20 |
| af_P0A805_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9616 | 34 | 108 | 3.30.1360.40 |
| 4kc6A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9614 | 6 | 180 | 1.10.132.20 |
| 1wqhA01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9588 | 8 | 185 | 1.10.132.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L6E905-F1-model_v4 | Ribosome-recycling factor, chloroplastic (Ribosome-releasing factor, chloroplastic) | 0.9769 | 5 | 187 |
GO:0006412
|
| AF-A0A6A5L148-F1-model_v4 | deleted | 0.9766 | 1 | 187 |
|
| AF-A0A2N9NL30-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9735 | 5 | 187 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A7C6N339-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9726 | 5 | 187 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A6A5L148-F1-model_v4 | deleted | 0.9715 | 1 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar