F402784

General Info

Members Datasets Scaffolds Average Seq Length
314 191 286 209

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0235360|Ga0395905_0235360_875_1573
Length 232
Sequence MEFDFAALSAGQRYKLMAAAITPRPIAWLTTLSLDDRRNAGPYSFFNMMGADPPIVAIGLMRRPDGSLKDSARNILDRGEFVVNLVSESDVEAMNFTCIDAPPCFDELEQGAIVTAPSRRISPPRIASAPVAMECRLFQAIEAGQTTIVLGEVLHFHIRDALIKGDRLHVDTPAMGLVARMHGAGWYARSTDLFQLERPAYADWLADRSSERGIPGAERDNGEIADLPVRGT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
10 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
11 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
12 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
13 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
14 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
15 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
16 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
17 2941479691
18 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
19 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
20 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
21 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
22 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
23 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.08
Metatranscriptomes 0
Isolates 8.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 1.59
Rhizoplane 7.64
Rhizosphere 57.01
Stem 0
Stem Tuber 0
Unclassified 26.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2561031 2162886007 Bacteria 2553
2 SwRhRL2b_contig_647708 2162886007 Bacteria 19270
3 JGI24748J21848_1001017 3300002074 Bacteria 3052
4 JGI24034J26672_10064494 3300002239 Unclassified 648
5 JGI25156J39149_1000349 3300002705 Bacteria 29958
6 JGI25165J46597_1000230 3300003214 Bacteria 77964
7 rootH2_10100997 3300003320 Bacteria 2071
8 rootL2_10136789 3300003322 Bacteria 1852
9 rootL2_10202018 3300003322 Bacteria 1505
10 rootH1_10207098 3300003323 Bacteria 2296
11 Ga0055532_1000021 3300003758 Bacteria 261162
12 Ga0055527_1000015 3300003760 Bacteria 261162
13 Ga0055535_1000015 3300003761 Bacteria 261162
14 Ga0055542_1000026 3300003762 Bacteria 261162
15 Ga0055529_1000031 3300003763 Bacteria 261162
16 Ga0065704_10040465 3300005289 Bacteria 898
17 Ga0065704_10073706 3300005289 Bacteria 6864
18 Ga0065707_10016117 3300005295 Bacteria 1743
19 Ga0070683_100123240 3300005329 Bacteria 2449
20 Ga0070670_100032954 3300005331 Bacteria 4465
21 Ga0070666_10061631 3300005335 Bacteria 2540
22 Ga0070666_10394249 3300005335 Unclassified 995
23 Ga0070666_10710509 3300005335 Bacteria 737
24 Ga0070680_100183895 3300005336 Bacteria 1760
25 Ga0070682_100863766 3300005337 Bacteria 740
26 Ga0070668_100016465 3300005347 Bacteria 5528
27 Ga0070668_100018822 3300005347 Bacteria 5187
28 Ga0070669_100000236 3300005353 Bacteria 46103
29 Ga0070671_100000056 3300005355 Bacteria 76375
30 Ga0070671_100613581 3300005355 Bacteria 940
31 Ga0070673_100602177 3300005364 Bacteria 1002
32 Ga0070667_100014246 3300005367 Bacteria 6568
33 Ga0070667_100088228 3300005367 Bacteria 2663
34 Ga0070667_100484884 3300005367 Bacteria 1132
35 Ga0070713_100164060 3300005436 Bacteria 1985
36 Ga0070681_10334969 3300005458 Bacteria 1423
37 Ga0070679_100083903 3300005530 Bacteria 3174
38 Ga0070684_101327753 3300005535 Unclassified 677
39 Ga0068853_100466989 3300005539 Bacteria 1188
40 Ga0070665_100001590 3300005548 Bacteria 26151
41 Ga0070665_100003687 3300005548 Bacteria 16235
42 Ga0070665_100422239 3300005548 Bacteria 1342
43 Ga0068857_101001369 3300005577 Bacteria 804
44 Ga0068859_100327859 3300005617 Bacteria 1625
45 Ga0068863_100056197 3300005841 Bacteria 3727
46 Ga0068858_100008229 3300005842 Bacteria 10029
47 Ga0068858_100593478 3300005842 Bacteria 1074
48 Ga0068860_100076421 3300005843 Bacteria 3185
49 Ga0068862_100002093 3300005844 Bacteria 17980
50 Ga0068862_100166405 3300005844 Bacteria 1971
51 Ga0075363_100080371 3300006048 Bacteria 1783
52 Ga0075362_10003694 3300006177 Bacteria 5402
53 Ga0097620_100327815 3300006931 Bacteria 1625
54 Ga0105251_10006265 3300009011 Bacteria 7623
55 Ga0105251_10057625 3300009011 Bacteria 1836
56 Ga0105251_10088424 3300009011 Bacteria 1425
57 Ga0105250_10128855 3300009092 Bacteria 1043
58 Ga0105247_10042317 3300009101 Bacteria 2790
59 Ga0105247_10294768 3300009101 Unclassified 1123
60 Ga0105248_10002476 3300009177 Bacteria 20516
61 Ga0105248_11290734 3300009177 Bacteria 826
62 Ga0105238_11274021 3300009551 Bacteria 761
63 Ga0105249_10028145 3300009553 Bacteria 5074
64 Ga0105249_10312876 3300009553 Bacteria 1579
65 Ga0105249_10489631 3300009553 Bacteria 1273
66 Ga0157378_10185190 3300013297 Bacteria 1961
67 Ga0163162_10015862 3300013306 Bacteria 7362
68 Ga0163162_10074698 3300013306 Bacteria 3449
69 Ga0163162_10911230 3300013306 Bacteria 992
70 Ga0157375_10015245 3300013308 Bacteria 6878
71 Ga0157380_10143705 3300014326 Bacteria 2053
72 Ga0163161_10013895 3300017792 Bacteria 5608
73 Ga0163161_10390554 3300017792 Bacteria 1114
74 Ga0213876_10024757 3300021384 Bacteria 3169
75 Ga0209672_100021 3300025228 Bacteria 428473
76 Ga0209147_100025 3300025229 Bacteria 428473
77 Ga0207427_100414 3300025231 Bacteria 24562
78 Ga0209437_103940 3300025233 Bacteria 2637
79 Ga0209258_100037 3300025242 Bacteria 428473
80 Ga0209148_1000049 3300025254 Bacteria 428473
81 Ga0209759_1000433 3300025256 Bacteria 50171
82 Ga0209233_1000091 3300025261 Bacteria 309402
83 Ga0209233_1000565 3300025261 Bacteria 19853
84 Ga0209455_1000041 3300025272 Bacteria 428473
85 Ga0209675_1000143 3300025291 Bacteria 95249
86 Ga0207696_1004247 3300025711 Bacteria 6220
87 Ga0207713_1001541 3300025735 Bacteria 18120
88 Ga0207713_1008347 3300025735 Bacteria 5979
89 Ga0207713_1045208 3300025735 Bacteria 1800
90 Ga0207680_10043441 3300025903 Bacteria 2636
91 Ga0207680_10102786 3300025903 Bacteria 1839
92 Ga0207707_10121000 3300025912 Bacteria 2289
93 Ga0207663_10208801 3300025916 Bacteria 1414
94 Ga0207660_10240647 3300025917 Bacteria 1425
95 Ga0207652_10078157 3300025921 Bacteria 2888
96 Ga0207681_10000218 3300025923 Bacteria 45552
97 Ga0207681_10002553 3300025923 Bacteria 11560
98 Ga0207681_10044877 3300025923 Plasmid 2964
99 Ga0207681_10112795 3300025923 Bacteria 1981
100 Ga0207694_10021485 3300025924 Bacteria 4890
101 Ga0207650_10242330 3300025925 Bacteria 1457
102 Ga0207700_10222893 3300025928 Bacteria 1599
103 Ga0207644_10000601 3300025931 Bacteria 22934
104 Ga0207644_10002126 3300025931 Bacteria 12859
105 Ga0207711_10001069 3300025941 Bacteria 26180
106 Ga0207711_10083796 3300025941 Bacteria 2789
107 Ga0207711_10826433 3300025941 Bacteria 863
108 Ga0207661_10044778 3300025944 Unclassified 3500
109 Ga0207712_10193382 3300025961 Bacteria 1607
110 Ga0207712_10698094 3300025961 Bacteria 885
111 Ga0207668_10008380 3300025972 Bacteria 6158
112 Ga0207668_10109622 3300025972 Bacteria 2068
113 Ga0207658_10001124 3300025986 Bacteria 21570
114 Ga0207658_10068602 3300025986 Bacteria 2676
115 Ga0207658_10473055 3300025986 Bacteria 1112
116 Ga0207703_10216198 3300026035 Bacteria 1711
117 Ga0207641_10330717 3300026088 Bacteria 1447
118 Ga0207674_10586105 3300026116 Bacteria 1077
119 Ga0268266_10001606 3300028379 Bacteria 26383
120 Ga0268266_10276108 3300028379 Bacteria 1561
121 Ga0268266_10348158 3300028379 Bacteria 1392
122 Ga0268265_10041850 3300028380 Bacteria 3394
123 Ga0268265_10080609 3300028380 Bacteria 2567
124 Ga0268264_10000474 3300028381 Bacteria 54105
125 Ga0265336_10016244 3300028666 Bacteria 2436
126 Ga0265338_10027148 3300028800 Bacteria 5751
127 Ga0307511_10001617 3300030521 Bacteria 23881
128 Ga0307412_10005250 3300031911 Bacteria 7263
129 Ga0395898_0011597 3300037466 Bacteria 9149
130 Ga0395905_0235360 3300037471 Bacteria 1712
131 Ga0395901_0291337 3300038443 Bacteria 1694
132 Ga0436365_1061324 3300039437 Bacteria 11167
133 Ga0436361_0695112 3300039447 Bacteria 762
134 Ga0436361_1104882 3300039447 Bacteria 15220
135 Ga0495592_0145224 3300046454 Bacteria 1646
136 Ga0495603_0454063 3300046455 Unclassified 734
137 Ga0495590_0072251 3300046457 Bacteria 1212
138 Ga0495629_0304445 3300046459 Bacteria 1091
139 Ga0495638_0000011 3300046460 Bacteria 442453
140 Ga0495638_0003840 3300046460 Bacteria 11666
141 Ga0495651_0221705 3300046462 Bacteria 1308
142 Ga0495650_0007610 3300046471 Bacteria 6470
143 Ga0495650_0020886 3300046471 Bacteria 3181
144 Ga0495605_0001738 3300046474 Bacteria 13951
145 Ga0495585_0012839 3300046492 Bacteria 4925
146 Ga0495607_0000026 3300046501 Bacteria 158900
147 Ga0495607_0033856 3300046501 Bacteria 3106
148 Ga0495583_0000077 3300046506 Bacteria 171772
149 Ga0495583_0105181 3300046506 Bacteria 1201
150 Ga0495606_0036984 3300046507 Bacteria 3319
151 Ga0495628_0011215 3300046516 Bacteria 7584
152 Ga0495648_0000036 3300046524 Bacteria 195997
153 Ga0495642_0131750 3300046528 Bacteria 1076
154 Ga0495645_0071014 3300046543 Bacteria 2512
155 Ga0495645_0193860 3300046543 Bacteria 1382
156 Ga0495633_0045112 3300046558 Bacteria 2088
157 Ga0495625_0380234 3300046660 Bacteria 886
158 Ga0495599_0050200 3300046678 Bacteria 2614
159 Ga0495646_0077096 3300046680 Bacteria 1950
160 Ga0495669_0417646 3300046684 Bacteria 650
161 Ga0495670_0009991 3300046691 Bacteria 4667
162 Ga0495671_0000012 3300046692 Bacteria 358632
163 Ga0495589_0006685 3300046794 Bacteria 6074
164 Ga0495589_0135270 3300046794 Bacteria 1182
165 Ga0495600_0304583 3300046809 Bacteria 1005
166 Ga0495660_0100159 3300046810 Bacteria 1493
167 Ga0495636_0070250 3300047318 Bacteria 1493
168 Ga0495672_0106314 3300047320 Bacteria 1513
169 Ga0495673_0000029 3300047469 Bacteria 471019
170 Ga0495673_0096329 3300047469 Bacteria 1203
171 Ga0495686_0000048 3300047472 Bacteria 278044
172 Ga0496100_0029487 3300048903 Bacteria 3394
173 Ga0496100_0191115 3300048903 Unclassified 1486
174 Ga0496101_0015698 3300048904 Bacteria 5110
175 Ga0496101_0185144 3300048904 Bacteria 1605
176 Ga0496102_0000562 3300048905 Bacteria 39530
177 Ga0496102_0017678 3300048905 Bacteria 6251
178 Ga0496102_0051145 3300048905 Bacteria 3764
179 Ga0496102_0073487 3300048905 Bacteria 3142
180 Ga0496102_0193002 3300048905 Bacteria 1919
181 Ga0496102_0680334 3300048905 Bacteria 952
182 Ga0496103_0000161 3300048906 Bacteria 70714
183 Ga0496103_0009444 3300048906 Bacteria 5776
184 Ga0496103_0090138 3300048906 Bacteria 1935
185 Ga0496103_0345666 3300048906 Bacteria 956
186 Ga0496104_0000204 3300048907 Bacteria 52844
187 Ga0496104_0280910 3300048907 Bacteria 1578
188 Ga0496105_0000047 3300048908 Bacteria 98232
189 Ga0496105_0314709 3300048908 Bacteria 1256
190 Ga0496106_0118500 3300048909 Bacteria 2067
191 Ga0496107_0010053 3300048910 Bacteria 6564
192 Ga0496111_0343241 3300048914 Bacteria 1105
193 Ga0496111_0524165 3300048914 Bacteria 871
194 Ga0496113_0000067 3300048916 Bacteria 45110
195 Ga0496114_0154949 3300048917 Bacteria 1989
196 Ga0496116_0007900 3300048919 Bacteria 9329
197 Ga0496116_0018998 3300048919 Bacteria 5278
198 Ga0496116_0043505 3300048919 Bacteria 3059
199 Ga0496116_0063737 3300048919 Bacteria 2373
200 Ga0496116_0089608 3300048919 Bacteria 1875
201 Ga0496116_0203944 3300048919 Bacteria 1032
202 Ga0496117_0003244 3300048920 Bacteria 19152
203 Ga0496117_0005280 3300048920 Bacteria 13692
204 Ga0496117_0006142 3300048920 Bacteria 12279
205 Ga0496117_0010269 3300048920 Bacteria 8562
206 Ga0496117_0017378 3300048920 Bacteria 6007
207 Ga0496118_0000884 3300048921 Bacteria 47298
208 Ga0496118_0001668 3300048921 Bacteria 32572
209 Ga0496118_0003417 3300048921 Bacteria 20048
210 Ga0496118_0006460 3300048921 Bacteria 12872
211 Ga0496118_0301770 3300048921 Bacteria 879
212 Ga0496118_0352601 3300048921 Bacteria 783
213 Ga0496119_0000467 3300048922 Bacteria 55035
214 Ga0496119_0015863 3300048922 Bacteria 5768
215 Ga0496119_0022823 3300048922 Bacteria 4461
216 Ga0496119_0038377 3300048922 Bacteria 3096
217 Ga0496120_0000639 3300048923 Bacteria 52052
218 Ga0496120_0041606 3300048923 Bacteria 2690
219 Ga0496121_0000009 3300048924 Bacteria 836971
220 Ga0496121_0000157 3300048924 Bacteria 149289
221 Ga0496121_0001358 3300048924 Bacteria 41794
222 Ga0496121_0029826 3300048924 Bacteria 5028
223 Ga0496121_0050384 3300048924 Bacteria 3518
224 Ga0496121_0163851 3300048924 Bacteria 1623
225 Ga0496122_0000233 3300048925 Bacteria 125120
226 Ga0496122_0000542 3300048925 Bacteria 78290
227 Ga0496122_0095708 3300048925 Bacteria 2005
228 Ga0496122_0096522 3300048925 Bacteria 1993
229 Ga0496122_0111555 3300048925 Bacteria 1793
230 Ga0496122_0226172 3300048925 Bacteria 1068
231 Ga0496123_0000480 3300048926 Bacteria 69227
232 Ga0496123_0000769 3300048926 Bacteria 51882
233 Ga0496123_0027058 3300048926 Bacteria 4280
234 Ga0496123_0029956 3300048926 Bacteria 3994
235 Ga0496123_0176277 3300048926 Bacteria 1122
236 Ga0496124_0001889 3300048927 Bacteria 28796
237 Ga0496124_0003136 3300048927 Bacteria 20485
238 Ga0496124_0016776 3300048927 Bacteria 6944
239 Ga0496124_0089300 3300048927 Bacteria 2516
240 Ga0496124_0094057 3300048927 Bacteria 2438
241 Ga0496125_0000028 3300048928 Bacteria 387222
242 Ga0496125_0001880 3300048928 Bacteria 28851
243 Ga0496125_0010949 3300048928 Bacteria 9113
244 Ga0496125_0188161 3300048928 Bacteria 1366
245 Ga0496126_0000012 3300048929 Bacteria 727789
246 Ga0496126_0000028 3300048929 Bacteria 394082
247 Ga0496126_0000105 3300048929 Bacteria 198893
248 Ga0496126_0028694 3300048929 Bacteria 5299
249 Ga0496126_0049787 3300048929 Bacteria 3823
250 Ga0496126_0086536 3300048929 Bacteria 2762
251 Ga0496126_0127154 3300048929 Bacteria 2205
252 Ga0501032_0076337 3300049569 Bacteria 2231
253 Ga0501033_0000595 3300049570 Bacteria 33493
254 Ga0501034_0000014 3300049571 Bacteria 297798
255 Ga0501034_0004810 3300049571 Bacteria 14926
256 Ga0501036_0022716 3300049572 Bacteria 5280
257 Ga0501037_0003121 3300049573 Bacteria 12013
258 Ga0501037_0113495 3300049573 Bacteria 1951
259 Ga0501038_0004202 3300049574 Bacteria 13375
260 Ga0501039_0002096 3300049575 Bacteria 14785
261 Ga0501040_0057427 3300049576 Bacteria 2672
262 Ga0501046_0000029 3300049580 Bacteria 194168
263 Ga0501046_0002312 3300049580 Bacteria 17963
264 Ga0501046_0006237 3300049580 Bacteria 10583
265 Ga0501047_0005796 3300049581 Bacteria 11636
266 Ga0501047_0285572 3300049581 Bacteria 1494
267 Ga0501048_0000656 3300049582 Bacteria 24922
268 Ga0501067_0000976 3300049583 Bacteria 15332
269 Ga0501067_0012978 3300049583 Bacteria 4612
270 Ga0501067_0319313 3300049583 Bacteria 865
271 Ga0501070_0012676 3300049586 Bacteria 7110
272 Ga0501073_0046113 3300049589 Bacteria 3067
273 Ga0501249_000143 3300049679 Bacteria 22258
274 Ga0501080_0000063 3300049742 Bacteria 69819
275 Ga0501035_0000034 3300049822 Bacteria 174589
276 Ga0501035_0000448 3300049822 Bacteria 46130
277 Ga0501044_0000039 3300049823 Bacteria 158218
278 Ga0501044_0006238 3300049823 Bacteria 13182
279 Ga0501044_0169406 3300049823 Bacteria 2156
280 nmdc:mga03683_2093_c1 3300050489 Bacteria 6137
281 nmdc:mga03n38_90154_c1 3300050490 Bacteria 1458
282 Ga0500595_008109 3300053119 Bacteria 4310
283 Ga0500618_015545 3300053125 Bacteria 1920
284 Ga0500568_0012486 3300053139 Bacteria 3905
285 Ga0501082_0007844 3300060353 Bacteria 9210
286 Ga0501082_0339847 3300060353 Bacteria 1308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0011215 Ga0495628_0011215_6950_7495 179
2 3300046684 Ga0495669_0417646 Ga0495669_0417646_14_568 182
3 iso_pu_bacteria 2856334872 2856337285 196
4 iso_pu_bacteria 2958122699 2958126870 196
5 iso_pu_bacteria 2965032056 2965033944 196
6 iso_pu_bacteria 2977872689 2977875724 196
7 iso_pu_bacteria 3004239961 3004245178 196
8 3300006048 Ga0075363_100080371 Ga0075363_1000803712 199
9 3300006177 Ga0075362_10003694 Ga0075362_100036942 199
10 3300050489 nmdc:mga03683_2093_c1 nmdc:mga03683_2093_c1_1471_2100 199
11 3300050490 nmdc:mga03n38_90154_c1 nmdc:mga03n38_90154_c1_803_1432 199
12 iso_pu_bacteria 2941479691 2941481706 199
13 3300025924 Ga0207694_10021485 Ga0207694_100214853 200
14 3300028666 Ga0265336_10016244 Ga0265336_100162442 200
15 3300028800 Ga0265338_10027148 Ga0265338_100271482 200
16 3300046543 Ga0495645_0071014 Ga0495645_0071014_87_689 200
17 3300049569 Ga0501032_0076337 Ga0501032_0076337_1378_1986 200
18 3300049570 Ga0501033_0000595 Ga0501033_0000595_25334_25942 200
19 3300049571 Ga0501034_0004810 Ga0501034_0004810_10276_10884 200
20 3300049572 Ga0501036_0022716 Ga0501036_0022716_2577_3185 200
21 3300049573 Ga0501037_0113495 Ga0501037_0113495_409_1017 200
22 3300049574 Ga0501038_0004202 Ga0501038_0004202_7562_8170 200
23 3300049581 Ga0501047_0285572 Ga0501047_0285572_795_1403 200
24 3300049822 Ga0501035_0000448 Ga0501035_0000448_7563_8171 200
25 3300049823 Ga0501044_0006238 Ga0501044_0006238_7005_7613 200
26 iso_pu_bacteria 2857576091 2857577352 200
27 iso_pu_bacteria 2919138771 2919142951 200
28 iso_pu_bacteria 2919688452 2919692100 200
29 3300005329 Ga0070683_100123240 Ga0070683_1001232401 201
30 3300005336 Ga0070680_100183895 Ga0070680_1001838953 201
31 3300005436 Ga0070713_100164060 Ga0070713_1001640602 201
32 3300005458 Ga0070681_10334969 Ga0070681_103349693 201
33 3300005530 Ga0070679_100083903 Ga0070679_1000839032 201
34 3300005535 Ga0070684_101327753 Ga0070684_1013277531 201
35 3300021384 Ga0213876_10024757 Ga0213876_100247573 201
36 3300025912 Ga0207707_10121000 Ga0207707_101210001 201
37 3300025917 Ga0207660_10240647 Ga0207660_102406472 201
38 3300025921 Ga0207652_10078157 Ga0207652_100781571 201
39 3300025928 Ga0207700_10222893 Ga0207700_102228932 201
40 3300025944 Ga0207661_10044778 Ga0207661_100447785 201
41 3300039437 Ga0436365_1061324 Ga0436365_1061324_9608_10294 201
42 3300048907 Ga0496104_0280910 Ga0496104_0280910_479_1084 201
43 3300053139 Ga0500568_0012486 Ga0500568_0012486_1008_1628 201
44 3300049580 Ga0501046_0000029 Ga0501046_0000029_85783_86397 202
45 3300005289 Ga0065704_10040465 Ga0065704_100404651 203
46 3300005295 Ga0065707_10016117 Ga0065707_100161172 203
47 3300005617 Ga0068859_100327859 Ga0068859_1003278592 203
48 3300006931 Ga0097620_100327815 Ga0097620_1003278152 203
49 3300009011 Ga0105251_10057625 Ga0105251_100576252 203
50 3300009101 Ga0105247_10294768 Ga0105247_102947682 203
51 3300009553 Ga0105249_10028145 Ga0105249_100281452 203
52 3300014326 Ga0157380_10143705 Ga0157380_101437052 203
53 3300017792 Ga0163161_10013895 Ga0163161_100138959 203
54 3300025735 Ga0207713_1045208 Ga0207713_10452082 203
55 3300025923 Ga0207681_10044877 Ga0207681_100448773 203
56 3300031911 Ga0307412_10005250 Ga0307412_100052505 203
57 3300048919 Ga0496116_0007900 Ga0496116_0007900_6947_7564 203
58 3300048919 Ga0496116_0089608 Ga0496116_0089608_571_1188 203
59 3300048921 Ga0496118_0301770 Ga0496118_0301770_33_650 203
60 3300048921 Ga0496118_0352601 Ga0496118_0352601_20_637 203
61 3300048922 Ga0496119_0022823 Ga0496119_0022823_1351_1968 203
62 3300048924 Ga0496121_0000157 Ga0496121_0000157_13327_13944 203
63 3300048924 Ga0496121_0029826 Ga0496121_0029826_2016_2633 203
64 3300048925 Ga0496122_0000542 Ga0496122_0000542_63453_64070 203
65 3300048925 Ga0496122_0095708 Ga0496122_0095708_233_853 203
66 3300048925 Ga0496122_0111555 Ga0496122_0111555_504_1121 203
67 3300048925 Ga0496122_0226172 Ga0496122_0226172_53_670 203
68 3300048926 Ga0496123_0000480 Ga0496123_0000480_59988_60605 203
69 3300048926 Ga0496123_0029956 Ga0496123_0029956_2098_2715 203
70 3300048926 Ga0496123_0176277 Ga0496123_0176277_263_883 203
71 3300048927 Ga0496124_0016776 Ga0496124_0016776_1300_1920 203
72 3300048927 Ga0496124_0089300 Ga0496124_0089300_41_658 203
73 3300048927 Ga0496124_0094057 Ga0496124_0094057_1161_1778 203
74 3300048928 Ga0496125_0000028 Ga0496125_0000028_337377_337994 203
75 3300048928 Ga0496125_0010949 Ga0496125_0010949_5025_5645 203
76 3300048928 Ga0496125_0188161 Ga0496125_0188161_222_839 203
77 3300048929 Ga0496126_0028694 Ga0496126_0028694_2931_3548 203
78 3300048929 Ga0496126_0086536 Ga0496126_0086536_2111_2728 203
79 3300048929 Ga0496126_0127154 Ga0496126_0127154_1153_1773 203
80 3300046501 Ga0495607_0000026 Ga0495607_0000026_59373_59993 204
81 iso_pu_bacteria 3000865235 3000867541 205
82 iso_pu_bacteria 2904483920 2904490419 206
83 iso_pu_bacteria 2928100450 2928102951 206
84 2162886007 SwRhRL2b_contig_647708 SwRhRL2b_0967.00003090 207
85 3300002074 JGI24748J21848_1001017 JGI24748J21848_10010173 207
86 3300002239 JGI24034J26672_10064494 JGI24034J26672_100644941 207
87 3300005289 Ga0065704_10073706 Ga0065704_100737061 207
88 3300005335 Ga0070666_10394249 Ga0070666_103942491 207
89 3300005347 Ga0070668_100016465 Ga0070668_1000164651 207
90 3300005353 Ga0070669_100000236 Ga0070669_10000023623 207
91 3300005355 Ga0070671_100613581 Ga0070671_1006135811 207
92 3300005548 Ga0070665_100003687 Ga0070665_1000036871 207
93 3300005577 Ga0068857_101001369 Ga0068857_1010013691 207
94 3300005842 Ga0068858_100593478 Ga0068858_1005934781 207
95 3300005844 Ga0068862_100166405 Ga0068862_1001664053 207
96 3300009553 Ga0105249_10312876 Ga0105249_103128761 207
97 3300013306 Ga0163162_10074698 Ga0163162_100746984 207
98 3300013306 Ga0163162_10911230 Ga0163162_109112302 207
99 3300017792 Ga0163161_10390554 Ga0163161_103905542 207
100 3300025233 Ga0209437_103940 Ga0209437_1039403 207
101 3300025261 Ga0209233_1000565 Ga0209233_100056515 207
102 3300025711 Ga0207696_1004247 Ga0207696_10042471 207
103 3300025735 Ga0207713_1008347 Ga0207713_10083475 207
104 3300025903 Ga0207680_10102786 Ga0207680_101027861 207
105 3300025923 Ga0207681_10000218 Ga0207681_1000021818 207
106 3300025931 Ga0207644_10000601 Ga0207644_100006012 207
107 3300025961 Ga0207712_10193382 Ga0207712_101933821 207
108 3300025972 Ga0207668_10109622 Ga0207668_101096221 207
109 3300025986 Ga0207658_10001124 Ga0207658_1000112415 207
110 3300026116 Ga0207674_10586105 Ga0207674_105861052 207
111 3300028379 Ga0268266_10276108 Ga0268266_102761081 207
112 3300028380 Ga0268265_10041850 Ga0268265_100418501 207
113 3300037466 Ga0395898_0011597 Ga0395898_0011597_4890_5519 207
114 3300038443 Ga0395901_0291337 Ga0395901_0291337_81_710 207
115 3300046460 Ga0495638_0000011 Ga0495638_0000011_171910_172539 207
116 3300046506 Ga0495583_0000077 Ga0495583_0000077_83721_84350 207
117 3300046524 Ga0495648_0000036 Ga0495648_0000036_171764_172393 207
118 3300046558 Ga0495633_0045112 Ga0495633_0045112_98_727 207
119 3300046692 Ga0495671_0000012 Ga0495671_0000012_270572_271201 207
120 3300047469 Ga0495673_0000029 Ga0495673_0000029_87432_88061 207
121 3300048903 Ga0496100_0029487 Ga0496100_0029487_164_787 207
122 3300048904 Ga0496101_0015698 Ga0496101_0015698_4346_4969 207
123 3300048905 Ga0496102_0000562 Ga0496102_0000562_38433_39056 207
124 3300048906 Ga0496103_0000161 Ga0496103_0000161_95_718 207
125 3300048907 Ga0496104_0000204 Ga0496104_0000204_44554_45177 207
126 3300048908 Ga0496105_0000047 Ga0496105_0000047_52297_52920 207
127 3300048914 Ga0496111_0524165 Ga0496111_0524165_135_758 207
128 3300048916 Ga0496113_0000067 Ga0496113_0000067_44304_44927 207
129 3300048920 Ga0496117_0006142 Ga0496117_0006142_4383_5006 207
130 3300048921 Ga0496118_0000884 Ga0496118_0000884_17164_17787 207
131 3300048922 Ga0496119_0000467 Ga0496119_0000467_22237_22860 207
132 3300048923 Ga0496120_0000639 Ga0496120_0000639_27359_27982 207
133 3300048924 Ga0496121_0050384 Ga0496121_0050384_2699_3322 207
134 3300048925 Ga0496122_0000233 Ga0496122_0000233_102389_103012 207
135 3300048926 Ga0496123_0000769 Ga0496123_0000769_11439_12062 207
136 3300048927 Ga0496124_0001889 Ga0496124_0001889_14667_15290 207
137 3300048928 Ga0496125_0001880 Ga0496125_0001880_14124_14747 207
138 3300048929 Ga0496126_0000012 Ga0496126_0000012_563107_563778 207
139 3300048929 Ga0496126_0000028 Ga0496126_0000028_348413_349036 207
140 3300049583 Ga0501067_0319313 Ga0501067_0319313_137_799 207
141 iso_pu_bacteria 2738541275 2738709260 207
142 iso_pu_bacteria 2738541301 2738847685 207
143 iso_pu_bacteria 2738541304 2738863414 207
144 iso_pu_bacteria 2738543022 2739295932 207
145 iso_pu_bacteria 2738543033 2739357610 207
146 iso_pu_bacteria 2928959182 2928959516 207
147 3300053125 Ga0500618_015545 Ga0500618_015545_1232_1858 208
148 iso_pu_bacteria 2643221563 2643832337 208
149 iso_pu_bacteria 2643221608 2644053868 208
150 iso_pu_bacteria 2738541275 2738710874 208
151 iso_pu_bacteria 2738541301 2738849299 208
152 iso_pu_bacteria 2738541304 2738865028 208
153 iso_pu_bacteria 2738543022 2739297546 208
154 iso_pu_bacteria 2738543033 2739359224 208
155 3300005539 Ga0068853_100466989 Ga0068853_1004669892 209
156 3300025291 Ga0209675_1000143 Ga0209675_100014329 209
157 3300039447 Ga0436361_0695112 Ga0436361_0695112_110_745 209
158 3300039447 Ga0436361_1104882 Ga0436361_1104882_475_1110 209
159 3300046462 Ga0495651_0221705 Ga0495651_0221705_267_902 209
160 3300048904 Ga0496101_0185144 Ga0496101_0185144_143_778 209
161 3300048905 Ga0496102_0051145 Ga0496102_0051145_220_855 209
162 3300048914 Ga0496111_0343241 Ga0496111_0343241_41_676 209
163 3300048919 Ga0496116_0203944 Ga0496116_0203944_297_932 209
164 3300049571 Ga0501034_0000014 Ga0501034_0000014_209145_209780 209
165 3300049573 Ga0501037_0003121 Ga0501037_0003121_575_1210 209
166 3300049575 Ga0501039_0002096 Ga0501039_0002096_1784_2419 209
167 3300049580 Ga0501046_0006237 Ga0501046_0006237_3985_4620 209
168 3300049581 Ga0501047_0005796 Ga0501047_0005796_7689_8324 209
169 3300049583 Ga0501067_0000976 Ga0501067_0000976_2719_3354 209
170 3300049586 Ga0501070_0012676 Ga0501070_0012676_3179_3814 209
171 3300049589 Ga0501073_0046113 Ga0501073_0046113_2272_2907 209
172 3300049742 Ga0501080_0000063 Ga0501080_0000063_40873_41508 209
173 3300049822 Ga0501035_0000034 Ga0501035_0000034_11117_11752 209
174 3300049823 Ga0501044_0000039 Ga0501044_0000039_8054_8689 209
175 3300060353 Ga0501082_0007844 Ga0501082_0007844_3410_4045 209
176 3300002705 JGI25156J39149_1000349 JGI25156J39149_100034924 210
177 3300003214 JGI25165J46597_1000230 JGI25165J46597_100023062 210
178 3300003322 rootL2_10136789 rootL2_101367893 210
179 3300003322 rootL2_10202018 rootL2_102020182 210
180 3300003758 Ga0055532_1000021 Ga0055532_1000021253 210
181 3300003760 Ga0055527_1000015 Ga0055527_100001531 210
182 3300003761 Ga0055535_1000015 Ga0055535_100001531 210
183 3300003762 Ga0055542_1000026 Ga0055542_100002631 210
184 3300003763 Ga0055529_1000031 Ga0055529_100003131 210
185 3300005335 Ga0070666_10710509 Ga0070666_107105091 210
186 3300005337 Ga0070682_100863766 Ga0070682_1008637661 210
187 3300005364 Ga0070673_100602177 Ga0070673_1006021771 210
188 3300005367 Ga0070667_100088228 Ga0070667_1000882282 210
189 3300005548 Ga0070665_100422239 Ga0070665_1004222392 210
190 3300009011 Ga0105251_10088424 Ga0105251_100884242 210
191 3300009092 Ga0105250_10128855 Ga0105250_101288552 210
192 3300009177 Ga0105248_11290734 Ga0105248_112907341 210
193 3300009551 Ga0105238_11274021 Ga0105238_112740211 210
194 3300013297 Ga0157378_10185190 Ga0157378_101851902 210
195 3300013306 Ga0163162_10015862 Ga0163162_100158625 210
196 3300013308 Ga0157375_10015245 Ga0157375_100152455 210
197 3300025228 Ga0209672_100021 Ga0209672_100021288 210
198 3300025229 Ga0209147_100025 Ga0209147_100025288 210
199 3300025231 Ga0207427_100414 Ga0207427_10041421 210
200 3300025242 Ga0209258_100037 Ga0209258_100037288 210
201 3300025254 Ga0209148_1000049 Ga0209148_1000049288 210
202 3300025256 Ga0209759_1000433 Ga0209759_100043358 210
203 3300025261 Ga0209233_1000091 Ga0209233_1000091286 210
204 3300025272 Ga0209455_1000041 Ga0209455_1000041288 210
205 3300025916 Ga0207663_10208801 Ga0207663_102088012 210
206 3300025941 Ga0207711_10826433 Ga0207711_108264331 210
207 3300025986 Ga0207658_10068602 Ga0207658_100686021 210
208 3300028379 Ga0268266_10348158 Ga0268266_103481582 210
209 3300046454 Ga0495592_0145224 Ga0495592_0145224_745_1383 210
210 3300046455 Ga0495603_0454063 Ga0495603_0454063_20_658 210
211 3300046457 Ga0495590_0072251 Ga0495590_0072251_231_911 210
212 3300046459 Ga0495629_0304445 Ga0495629_0304445_284_922 210
213 3300046460 Ga0495638_0003840 Ga0495638_0003840_6301_6939 210
214 3300046471 Ga0495650_0007610 Ga0495650_0007610_5346_5984 210
215 3300046471 Ga0495650_0020886 Ga0495650_0020886_560_1198 210
216 3300046474 Ga0495605_0001738 Ga0495605_0001738_12392_13030 210
217 3300046492 Ga0495585_0012839 Ga0495585_0012839_2918_3556 210
218 3300046501 Ga0495607_0033856 Ga0495607_0033856_885_1523 210
219 3300046506 Ga0495583_0105181 Ga0495583_0105181_349_987 210
220 3300046507 Ga0495606_0036984 Ga0495606_0036984_945_1583 210
221 3300046528 Ga0495642_0131750 Ga0495642_0131750_245_883 210
222 3300046543 Ga0495645_0193860 Ga0495645_0193860_224_862 210
223 3300046660 Ga0495625_0380234 Ga0495625_0380234_178_816 210
224 3300046678 Ga0495599_0050200 Ga0495599_0050200_1778_2416 210
225 3300046680 Ga0495646_0077096 Ga0495646_0077096_438_1076 210
226 3300046691 Ga0495670_0009991 Ga0495670_0009991_2483_3121 210
227 3300046794 Ga0495589_0006685 Ga0495589_0006685_1782_2420 210
228 3300046794 Ga0495589_0135270 Ga0495589_0135270_425_1063 210
229 3300046809 Ga0495600_0304583 Ga0495600_0304583_140_778 210
230 3300046810 Ga0495660_0100159 Ga0495660_0100159_815_1453 210
231 3300047318 Ga0495636_0070250 Ga0495636_0070250_737_1375 210
232 3300047320 Ga0495672_0106314 Ga0495672_0106314_695_1333 210
233 3300047469 Ga0495673_0096329 Ga0495673_0096329_478_1116 210
234 3300047472 Ga0495686_0000048 Ga0495686_0000048_193845_194483 210
235 3300048903 Ga0496100_0191115 Ga0496100_0191115_423_1061 210
236 3300048905 Ga0496102_0017678 Ga0496102_0017678_2386_3024 210
237 3300048905 Ga0496102_0073487 Ga0496102_0073487_140_778 210
238 3300048905 Ga0496102_0680334 Ga0496102_0680334_50_688 210
239 3300048906 Ga0496103_0090138 Ga0496103_0090138_42_680 210
240 3300048908 Ga0496105_0314709 Ga0496105_0314709_378_1016 210
241 3300048909 Ga0496106_0118500 Ga0496106_0118500_540_1178 210
242 3300048910 Ga0496107_0010053 Ga0496107_0010053_804_1442 210
243 3300048917 Ga0496114_0154949 Ga0496114_0154949_564_1202 210
244 3300048920 Ga0496117_0003244 Ga0496117_0003244_5135_5773 210
245 3300048921 Ga0496118_0003417 Ga0496118_0003417_7071_7709 210
246 3300048924 Ga0496121_0163851 Ga0496121_0163851_578_1216 210
247 3300048929 Ga0496126_0000105 Ga0496126_0000105_98813_99451 210
248 iso_pu_bacteria 2896253425 2896254048 210
249 3300003323 rootH1_10207098 rootH1_102070981 211
250 3300049576 Ga0501040_0057427 Ga0501040_0057427_499_1149 211
251 3300049580 Ga0501046_0002312 Ga0501046_0002312_718_1368 211
252 3300049583 Ga0501067_0012978 Ga0501067_0012978_2892_3542 211
253 3300049679 Ga0501249_000143 Ga0501249_000143_12272_12916 211
254 3300049823 Ga0501044_0169406 Ga0501044_0169406_416_1066 211
255 3300053119 Ga0500595_008109 Ga0500595_008109_3551_4198 211
256 3300060353 Ga0501082_0339847 Ga0501082_0339847_137_787 211
257 iso_pu_bacteria 2928100450 2928100978 211
258 iso_pu_bacteria 2928959182 2928962191 211
259 3300003320 rootH2_10100997 rootH2_101009971 212
260 3300005331 Ga0070670_100032954 Ga0070670_1000329543 212
261 3300005335 Ga0070666_10061631 Ga0070666_100616312 212
262 3300005347 Ga0070668_100018822 Ga0070668_1000188224 212
263 3300005355 Ga0070671_100000056 Ga0070671_10000005614 212
264 3300005367 Ga0070667_100014246 Ga0070667_1000142465 212
265 3300005367 Ga0070667_100484884 Ga0070667_1004848842 212
266 3300005548 Ga0070665_100001590 Ga0070665_10000159011 212
267 3300005841 Ga0068863_100056197 Ga0068863_1000561973 212
268 3300005842 Ga0068858_100008229 Ga0068858_1000082294 212
269 3300005843 Ga0068860_100076421 Ga0068860_1000764212 212
270 3300005844 Ga0068862_100002093 Ga0068862_1000020935 212
271 3300009011 Ga0105251_10006265 Ga0105251_100062656 212
272 3300009101 Ga0105247_10042317 Ga0105247_100423173 212
273 3300009177 Ga0105248_10002476 Ga0105248_100024769 212
274 3300009553 Ga0105249_10489631 Ga0105249_104896312 212
275 3300025735 Ga0207713_1001541 Ga0207713_10015414 212
276 3300025903 Ga0207680_10043441 Ga0207680_100434412 212
277 3300025923 Ga0207681_10002553 Ga0207681_100025538 212
278 3300025923 Ga0207681_10112795 Ga0207681_101127952 212
279 3300025925 Ga0207650_10242330 Ga0207650_102423302 212
280 3300025931 Ga0207644_10002126 Ga0207644_100021262 212
281 3300025941 Ga0207711_10001069 Ga0207711_1000106921 212
282 3300025941 Ga0207711_10083796 Ga0207711_100837962 212
283 3300025961 Ga0207712_10698094 Ga0207712_106980942 212
284 3300025972 Ga0207668_10008380 Ga0207668_100083803 212
285 3300025986 Ga0207658_10473055 Ga0207658_104730552 212
286 3300026035 Ga0207703_10216198 Ga0207703_102161982 212
287 3300026088 Ga0207641_10330717 Ga0207641_103307172 212
288 3300028379 Ga0268266_10001606 Ga0268266_1000160611 212
289 3300028380 Ga0268265_10080609 Ga0268265_100806091 212
290 3300028381 Ga0268264_10000474 Ga0268264_1000047412 212
291 3300030521 Ga0307511_10001617 Ga0307511_100016174 212
292 3300048905 Ga0496102_0193002 Ga0496102_0193002_978_1649 212
293 3300048906 Ga0496103_0009444 Ga0496103_0009444_931_1569 212
294 3300048906 Ga0496103_0345666 Ga0496103_0345666_23_694 212
295 3300048919 Ga0496116_0018998 Ga0496116_0018998_3297_3935 212
296 3300048919 Ga0496116_0043505 Ga0496116_0043505_2356_2997 212
297 3300048919 Ga0496116_0063737 Ga0496116_0063737_1329_1991 212
298 3300048920 Ga0496117_0005280 Ga0496117_0005280_10971_11609 212
299 3300048920 Ga0496117_0010269 Ga0496117_0010269_1870_2520 212
300 3300048920 Ga0496117_0017378 Ga0496117_0017378_5052_5714 212
301 3300048921 Ga0496118_0001668 Ga0496118_0001668_15523_16161 212
302 3300048921 Ga0496118_0006460 Ga0496118_0006460_7757_8407 212
303 3300048922 Ga0496119_0015863 Ga0496119_0015863_1578_2249 212
304 3300048922 Ga0496119_0038377 Ga0496119_0038377_51_689 212
305 3300048923 Ga0496120_0041606 Ga0496120_0041606_1550_2188 212
306 3300048924 Ga0496121_0000009 Ga0496121_0000009_441099_441770 212
307 3300048924 Ga0496121_0001358 Ga0496121_0001358_25516_26154 212
308 3300048925 Ga0496122_0096522 Ga0496122_0096522_760_1398 212
309 3300048926 Ga0496123_0027058 Ga0496123_0027058_169_807 212
310 3300048927 Ga0496124_0003136 Ga0496124_0003136_8159_8797 212
311 3300048929 Ga0496126_0049787 Ga0496126_0049787_36_674 212
312 3300049582 Ga0501048_0000656 Ga0501048_0000656_14737_15378 212
313 2162886007 SwRhRL2b_contig_2561031 SwRhRL2b_0423.00001040 215
314 3300037471 Ga0395905_0235360 Ga0395905_0235360_875_1573 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

17

172

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hx6-assembly1.cif.gz_B streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9414 25 158
4hx6-assembly4.cif.gz_H streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9325 25 158
4hx6-assembly4.cif.gz_G streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9257 25 158
4hx6-assembly3.cif.gz_E streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9237 25 158
5zc2-assembly1.cif.gz_B acinetobacter baumannii p-hydroxyphenylacetate 3-hydroxylase (hpah), reductase component (c1) 0.9231 25 159
ID Description Score Start End Superfamily
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9043 25 158 2.30.110.10
4hx6A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9042 25 158 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.902 25 160 2.30.110.10
3rh7E01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9011 25 160 2.30.110.10
1ejeA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8996 18 197 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A317Z3M1-F1-model_v4 Flavin reductase like domain-containing protein 0.9505 53 162 GO:0010181
GO:0016646
AF-A0A0F9Y8N8-F1-model_v4 Flavin reductase domain protein FMN-binding protein 0.944 25 189 GO:0010181
GO:0016646
AF-A0A524N1W7-F1-model_v4 Flavin reductase family protein 0.9414 25 189 GO:0010181
AF-A0A418AIB2-F1-model_v4 Flavin reductase like domain-containing protein 0.9409 25 200 GO:0010181
AF-A0A7J2ZLH6-F1-model_v4 Flavin reductase family protein 0.9398 25 189 GO:0010181

Feature Viewer

pLDDT pTM Quality
94.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map