F402718

General Info

Members Datasets Scaffolds Average Seq Length
314 182 628 229

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10263499|Ga0207662_102634992
Length 277
Sequence MLSPAETEALFLSLSVAARSVAFNLPFAILVAWLLARTRFAGRTVFDAFVHLPLVLPPVVVGYLLLVLFGIRGPIGGWLYENFGIQLAFTSTGAALATAVMSFPLVVRSIRLSLESLDRGLEDAAKTLGAGPIDRFFSVTLPLIAPGILAGAVTAFAAGLGEFGAVITFASNIPGETRTLPLALYTALQTPDGDMLAARLAIISLSLGLAGLLVSEVLSRAIGRRLAALRAKPGDTATRMMLAYLYAQKGEAKLSGEAARLPLGQPVEITPALRGSQ

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
115 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
122 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
180 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
181 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
182 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0.32
Rhizoplane 3.5
Rhizosphere 88.85
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10263499 3300025918 Bacteria 1135
2 Ga0065707_10082632 3300005295 Bacteria 13146
3 Ga0070690_100143089 3300005330 Bacteria 1625
4 Ga0068869_100095076 3300005334 Bacteria 2248
5 Ga0068869_100501041 3300005334 Bacteria 1014
6 Ga0070680_100020795 3300005336 Bacteria 5207
7 Ga0070689_100001555 3300005340 Bacteria 14622
8 Ga0070689_100236777 3300005340 Bacteria 1502
9 Ga0070675_100020370 3300005354 Bacteria 5294
10 Ga0070675_100153259 3300005354 Bacteria 1977
11 Ga0070675_100583722 3300005354 Bacteria 1013
12 Ga0070674_100003931 3300005356 Bacteria 8418
13 Ga0070674_100053391 3300005356 Bacteria 2790
14 Ga0070674_100254347 3300005356 Bacteria 1381
15 Ga0070673_100064895 3300005364 Bacteria 2910
16 Ga0070673_100104034 3300005364 Bacteria 2343
17 Ga0070688_100058793 3300005365 Bacteria 2422
18 Ga0070688_100138401 3300005365 Bacteria 1651
19 Ga0070667_100184334 3300005367 Bacteria 1847
20 Ga0070714_100000846 3300005435 Bacteria 21697
21 Ga0070714_100158432 3300005435 Bacteria 2046
22 Ga0070713_100001210 3300005436 Bacteria 16487
23 Ga0070710_10143975 3300005437 Bacteria 1464
24 Ga0070701_10005731 3300005438 Bacteria 5163
25 Ga0070701_10041471 3300005438 Bacteria 2346
26 Ga0070701_10289074 3300005438 Bacteria 1004
27 Ga0070705_100023431 3300005440 Bacteria 3315
28 Ga0070700_100012132 3300005441 Bacteria 4796
29 Ga0070700_100092423 3300005441 Bacteria 1977
30 Ga0070678_100078108 3300005456 Bacteria 2500
31 Ga0070678_100093205 3300005456 Bacteria 2316
32 Ga0070662_100013992 3300005457 Bacteria 5346
33 Ga0070662_100250996 3300005457 Bacteria 1422
34 Ga0068867_100008613 3300005459 Bacteria 7203
35 Ga0068867_100128173 3300005459 Bacteria 1969
36 Ga0068867_100428800 3300005459 Bacteria 1122
37 Ga0070679_100078600 3300005530 Bacteria 3288
38 Ga0070672_100093949 3300005543 Bacteria 2423
39 Ga0070672_100107332 3300005543 Bacteria 2272
40 Ga0070672_100466486 3300005543 Bacteria 1089
41 Ga0070686_100004941 3300005544 Bacteria 7353
42 Ga0070686_100230196 3300005544 Bacteria 1344
43 Ga0070695_100302504 3300005545 Bacteria 1183
44 Ga0070665_100003361 3300005548 Bacteria 17112
45 Ga0070665_100192134 3300005548 Bacteria 2042
46 Ga0070665_100711929 3300005548 Bacteria 1017
47 Ga0070664_100020963 3300005564 Bacteria 5384
48 Ga0068857_100593619 3300005577 Unclassified 1046
49 Ga0068856_100030457 3300005614 Bacteria 5275
50 Ga0068859_100034201 3300005617 Bacteria 5101
51 Ga0068861_100001227 3300005719 Bacteria 15967
52 Ga0068861_100045173 3300005719 Bacteria 3315
53 Ga0068861_100063739 3300005719 Bacteria 2834
54 Ga0068861_100227919 3300005719 Bacteria 1579
55 Ga0068870_10008397 3300005840 Bacteria 4646
56 Ga0068863_100096621 3300005841 Bacteria 2805
57 Ga0068858_100624614 3300005842 Bacteria 1046
58 Ga0068858_100902189 3300005842 Bacteria 864
59 Ga0068860_100083850 3300005843 Bacteria 3032
60 Ga0068862_100134056 3300005844 Bacteria 2193
61 Ga0068862_100180141 3300005844 Bacteria 1896
62 Ga0068862_100528692 3300005844 Bacteria 1123
63 Ga0068862_100668701 3300005844 Bacteria 1003
64 Ga0070712_100463406 3300006175 Bacteria 1057
65 Ga0097621_100014726 3300006237 Bacteria 5862
66 Ga0097621_100043945 3300006237 Bacteria 3603
67 Ga0097621_100401572 3300006237 Bacteria 1227
68 Ga0068871_100019316 3300006358 Bacteria 5202
69 Ga0068871_100020572 3300006358 Bacteria 5058
70 Ga0068871_100720500 3300006358 Bacteria 915
71 Ga0075428_100003320 3300006844 Bacteria 17606
72 Ga0075428_100035749 3300006844 Bacteria 5475
73 Ga0075428_100058522 3300006844 Bacteria 4219
74 Ga0075430_100008776 3300006846 Bacteria 8530
75 Ga0075430_100011793 3300006846 Bacteria 7439
76 Ga0075430_100096910 3300006846 Bacteria 2465
77 Ga0075431_100028992 3300006847 Bacteria 5693
78 Ga0075431_100039755 3300006847 Bacteria 4846
79 Ga0075431_100055474 3300006847 Bacteria 4087
80 Ga0075429_100031039 3300006880 Bacteria 4644
81 Ga0075429_100056351 3300006880 Bacteria 3420
82 Ga0068865_100012668 3300006881 Bacteria 5313
83 Ga0068865_100399776 3300006881 Bacteria 1125
84 Ga0097620_100034202 3300006931 Bacteria 5101
85 Ga0097620_100617159 3300006931 Bacteria 1177
86 Ga0099826_10199263 3300006948 Bacteria 1097
87 Ga0111539_10061840 3300009094 Bacteria 4435
88 Ga0114129_10291844 3300009147 Bacteria 2176
89 Ga0114129_11043856 3300009147 Bacteria 1026
90 Ga0105242_10068194 3300009176 Bacteria 2942
91 Ga0105248_10073326 3300009177 Bacteria 3847
92 Ga0105249_10078183 3300009553 Bacteria 3070
93 Ga0105249_10181879 3300009553 Bacteria 2046
94 Ga0105249_10914208 3300009553 Bacteria 945
95 Ga0099796_10020724 3300010159 Bacteria 2013
96 Ga0157369_10356656 3300013105 Unclassified 1518
97 Ga0163162_10474492 3300013306 Bacteria 1382
98 Ga0163162_10700505 3300013306 Bacteria 1134
99 Ga0157372_10047001 3300013307 Bacteria 4794
100 Ga0157375_10054559 3300013308 Bacteria 3936
101 Ga0157375_10676051 3300013308 Bacteria 1187
102 Ga0163163_10045077 3300014325 Bacteria 4328
103 Ga0163163_10131552 3300014325 Bacteria 2542
104 Ga0157380_10013272 3300014326 Bacteria 6002
105 Ga0157380_10013888 3300014326 Bacteria 5881
106 Ga0157380_10028190 3300014326 Bacteria 4279
107 Ga0157380_10072142 3300014326 Bacteria 2796
108 Ga0157380_10481939 3300014326 Bacteria 1200
109 Ga0157380_10694025 3300014326 Bacteria 1022
110 Ga0213872_10107103 3300021361 Bacteria 1243
111 Ga0213874_10063504 3300021377 Bacteria 1162
112 Ga0207682_10008037 3300025893 Bacteria 4189
113 Ga0207692_10148054 3300025898 Bacteria 1342
114 Ga0207699_10055317 3300025906 Bacteria 2360
115 Ga0207699_10086118 3300025906 Bacteria 1962
116 Ga0207645_10006575 3300025907 Bacteria 8318
117 Ga0207645_10126463 3300025907 Bacteria 1661
118 Ga0207643_10006691 3300025908 Bacteria 6182
119 Ga0207707_10099667 3300025912 Bacteria 2539
120 Ga0207693_10270101 3300025915 Bacteria 1333
121 Ga0207663_10052553 3300025916 Bacteria 2542
122 Ga0207663_10346544 3300025916 Bacteria 1123
123 Ga0207662_10027748 3300025918 Bacteria 3269
124 Ga0207652_10105434 3300025921 Bacteria 2494
125 Ga0207681_10024081 3300025923 Bacteria 3903
126 Ga0207681_10063722 3300025923 Bacteria 2543
127 Ga0207659_10294326 3300025926 Bacteria 1331
128 Ga0207659_10375188 3300025926 Bacteria 1185
129 Ga0207700_10283300 3300025928 Bacteria 1426
130 Ga0207706_10007180 3300025933 Bacteria 10307
131 Ga0207686_10051065 3300025934 Bacteria 2574
132 Ga0207670_10061972 3300025936 Bacteria 2554
133 Ga0207670_10442879 3300025936 Bacteria 1046
134 Ga0207669_10214215 3300025937 Bacteria 1408
135 Ga0207669_10318045 3300025937 Bacteria 1190
136 Ga0207704_10015494 3300025938 Bacteria 3886
137 Ga0207704_10157443 3300025938 Bacteria 1612
138 Ga0207704_10373179 3300025938 Bacteria 1118
139 Ga0207704_10640930 3300025938 Bacteria 874
140 Ga0207665_10125443 3300025939 Bacteria 1817
141 Ga0207691_10001467 3300025940 Bacteria 23516
142 Ga0207691_10007516 3300025940 Bacteria 10487
143 Ga0207691_10013491 3300025940 Bacteria 7817
144 Ga0207691_10079804 3300025940 Bacteria 2944
145 Ga0207691_10304767 3300025940 Bacteria 1368
146 Ga0207689_10036430 3300025942 Bacteria 4085
147 Ga0207689_10111438 3300025942 Bacteria 2249
148 Ga0207689_10282671 3300025942 Bacteria 1374
149 Ga0207689_10529229 3300025942 Bacteria 989
150 Ga0207661_10246298 3300025944 Unclassified 1587
151 Ga0207651_10108638 3300025960 Bacteria 2077
152 Ga0207712_10202542 3300025961 Bacteria 1575
153 Ga0207668_10060927 3300025972 Bacteria 2651
154 Ga0207640_10555950 3300025981 Bacteria 965
155 Ga0207658_10279771 3300025986 Bacteria 1430
156 Ga0207703_10125275 3300026035 Bacteria 2211
157 Ga0207708_10021145 3300026075 Bacteria 4907
158 Ga0207708_10042108 3300026075 Bacteria 3482
159 Ga0207641_10394559 3300026088 Bacteria 1327
160 Ga0207641_10395680 3300026088 Bacteria 1326
161 Ga0207648_10010183 3300026089 Bacteria 8941
162 Ga0207648_10141547 3300026089 Bacteria 2120
163 Ga0207648_10159153 3300026089 Bacteria 1994
164 Ga0207648_10308874 3300026089 Bacteria 1419
165 Ga0207648_10455233 3300026089 Bacteria 1166
166 Ga0207676_10215800 3300026095 Bacteria 1705
167 Ga0207676_10246914 3300026095 Bacteria 1605
168 Ga0207674_10279284 3300026116 Bacteria 1618
169 Ga0207675_100001198 3300026118 Bacteria 25855
170 Ga0207675_100031593 3300026118 Bacteria 4933
171 Ga0207675_100036537 3300026118 Bacteria 4582
172 Ga0207675_100052288 3300026118 Bacteria 3812
173 Ga0207675_100092642 3300026118 Bacteria 2842
174 Ga0207675_100132204 3300026118 Bacteria 2366
175 Ga0207683_10033353 3300026121 Bacteria 4472
176 Ga0207683_10910126 3300026121 Bacteria 817
177 Ga0209971_1001466 3300027682 Bacteria 5865
178 Ga0209998_10001499 3300027717 Bacteria 5614
179 Ga0207428_10020565 3300027907 Bacteria 5605
180 Ga0268266_10155729 3300028379 Bacteria 2063
181 Ga0268265_10030503 3300028380 Bacteria 3884
182 Ga0268265_10182976 3300028380 Bacteria 1802
183 Ga0268264_10056802 3300028381 Bacteria 3272
184 Ga0268264_10443385 3300028381 Bacteria 1256
185 Ga0307515_10319046 3300028794 Bacteria 1222
186 Ga0307513_10003859 3300031456 Bacteria 20171
187 Ga0307513_10034965 3300031456 Bacteria 5629
188 Ga0307513_10083068 3300031456 Bacteria 3295
189 Ga0307509_10051687 3300031507 Bacteria 4392
190 Ga0307509_10129359 3300031507 Bacteria 2484
191 Ga0316579_10025261 3300031691 Unclassified 2681
192 Ga0307413_10006637 3300031824 Bacteria 5307
193 Ga0307413_10025214 3300031824 Bacteria 3256
194 Ga0307410_10123680 3300031852 Bacteria 1890
195 Ga0307410_10166539 3300031852 Bacteria 1657
196 Ga0307406_10035377 3300031901 Bacteria 3071
197 Ga0307406_10332441 3300031901 Bacteria 1180
198 Ga0307407_10002965 3300031903 Bacteria 6809
199 Ga0307407_10090067 3300031903 Bacteria 1878
200 Ga0307407_10332725 3300031903 Bacteria 1070
201 Ga0307412_10436423 3300031911 Bacteria 1075
202 Ga0307412_10481707 3300031911 Bacteria 1029
203 Ga0307409_100017804 3300031995 Bacteria 4749
204 Ga0307409_100062980 3300031995 Bacteria 2906
205 Ga0307416_100233103 3300032002 Bacteria 1777
206 Ga0307411_10001567 3300032005 Bacteria 9475
207 Ga0307411_10068939 3300032005 Bacteria 2386
208 Ga0307415_100125158 3300032126 Bacteria 1936
209 Ga0307415_100312810 3300032126 Bacteria 1306
210 Ga0307415_100431990 3300032126 Bacteria 1133
211 Ga0373955_0051347 3300035172 Bacteria 2246
212 Ga0400485_07696 3300038735 Bacteria 5905
213 Ga0400486_22154 3300038742 Bacteria 15285
214 Ga0400483_016886 3300039062 Bacteria 50633
215 Ga0400483_201758 3300039062 Unclassified 1225
216 Ga0400483_225439 3300039062 Bacteria 48121
217 Ga0400483_251413 3300039062 Bacteria 6976
218 Ga0400487_52634 3300039110 Bacteria 3094
219 Ga0436361_1133989 3300039447 Bacteria 3440
220 Ga0436363_0725099 3300039450 Bacteria 5008
221 Ga0451791_0668686 3300041451 Bacteria 1559
222 Ga0451791_1461780 3300041451 Bacteria 2203
223 Ga0451797_0633591 3300041453 Bacteria 1453
224 Ga0451797_1164500 3300041453 Bacteria 1106
225 Ga0451798_0379712 3300041458 Bacteria 2345
226 Ga0451807_1239698 3300041486 Bacteria 6357
227 Ga0451807_1519397 3300041486 Bacteria 1621
228 Ga0439444_0026995 3300042437 Bacteria 1054
229 Ga0451577_0018451 3300042876 Bacteria 6427
230 Ga0466965_0044301 3300044683 Bacteria 2199
231 Ga0453684_0000071 3300044712 Bacteria 448904
232 Ga0466957_0581650 3300044842 Bacteria 783
233 Ga0451576_0000262 3300045051 Bacteria 128472
234 Ga0451576_0000444 3300045051 Bacteria 94213
235 Ga0451576_0140629 3300045051 Bacteria 2517
236 Ga0495590_0001976 3300046457 Bacteria 8641
237 Ga0495638_0000932 3300046460 Bacteria 29683
238 Ga0495638_0018223 3300046460 Bacteria 4665
239 Ga0495638_0018462 3300046460 Bacteria 4632
240 Ga0495638_0110887 3300046460 Bacteria 1630
241 Ga0495616_0001211 3300046513 Bacteria 18181
242 Ga0495616_0054815 3300046513 Unclassified 1976
243 Ga0495616_0192256 3300046513 Bacteria 901
244 Ga0495632_0167225 3300046519 Bacteria 1011
245 Ga0495621_0113401 3300046539 Bacteria 1042
246 Ga0495668_0120519 3300046616 Bacteria 1435
247 Ga0495634_0402566 3300046642 Bacteria 813
248 Ga0495625_0003435 3300046660 Bacteria 15797
249 Ga0495625_0038812 3300046660 Bacteria 3482
250 Ga0495625_0183375 3300046660 Bacteria 1390
251 Ga0495635_0349821 3300046663 Bacteria 986
252 Ga0495659_0019271 3300046664 Bacteria 2283
253 Ga0495649_0046813 3300046694 Bacteria 2354
254 Ga0495672_0010774 3300047320 Bacteria 6489
255 Ga0495672_0301375 3300047320 Bacteria 759
256 Ga0495686_0127880 3300047472 Bacteria 1509
257 Ga0496101_0224355 3300048904 Bacteria 1459
258 Ga0496107_0209832 3300048910 Bacteria 1448
259 Ga0496109_0307397 3300048912 Bacteria 1496
260 Ga0496112_0464584 3300048915 Unclassified 1203
261 Ga0496121_0028102 3300048924 Bacteria 5244
262 Ga0501036_0365410 3300049572 Bacteria 1205
263 Ga0501036_0420593 3300049572 Bacteria 1114
264 Ga0501040_0238405 3300049576 Bacteria 1296
265 Ga0501040_0322577 3300049576 Bacteria 1105
266 Ga0501040_0489439 3300049576 Bacteria 886
267 Ga0501042_0295336 3300049578 Bacteria 1170
268 Ga0501042_0413104 3300049578 Bacteria 978
269 Ga0501043_0211044 3300049579 Bacteria 1505
270 Ga0501046_0021656 3300049580 Bacteria 5303
271 Ga0501046_0380639 3300049580 Bacteria 1021
272 Ga0501048_0045823 3300049582 Bacteria 3122
273 Ga0501048_0370884 3300049582 Bacteria 1022
274 Ga0501068_0004113 3300049584 Bacteria 7888
275 Ga0501068_0094065 3300049584 Bacteria 1852
276 Ga0501068_0381968 3300049584 Bacteria 907
277 Ga0501069_0166315 3300049585 Bacteria 1271
278 Ga0501070_0025445 3300049586 Bacteria 4964
279 Ga0501070_0249009 3300049586 Bacteria 1454
280 Ga0501071_0140872 3300049587 Bacteria 1796
281 Ga0501071_0151099 3300049587 Bacteria 1732
282 Ga0501071_0679548 3300049587 Bacteria 792
283 Ga0501072_0056714 3300049588 Bacteria 3086
284 Ga0501073_0002144 3300049589 Bacteria 14758
285 Ga0501074_0007415 3300049590 Bacteria 7935
286 Ga0501075_0174738 3300049591 Bacteria 1639
287 Ga0501077_0001020 3300049593 Bacteria 16910
288 Ga0501079_0005396 3300049741 Bacteria 9523
289 Ga0501080_0013052 3300049742 Bacteria 7628
290 Ga0501080_0060483 3300049742 Bacteria 3526
291 Ga0501081_0175088 3300049743 Bacteria 1550
292 Ga0501081_0217275 3300049743 Bacteria 1389
293 Ga0501083_0142241 3300049744 Bacteria 1571
294 nmdc:mga05p37_616012_c1 3300050507 Bacteria 1222
295 nmdc:mga09592_29998_c1 3300050508 Bacteria 4525
296 nmdc:mga09592_90794_c1 3300050508 Bacteria 2610
297 nmdc:mga0qj67_10274_c1 3300050509 Bacteria 6992
298 nmdc:mga0qj67_6592_c1 3300050509 Bacteria 8530
299 nmdc:mga06r32_48490_c1 3300050510 Bacteria 4060
300 nmdc:mga06r32_52494_c1 3300050510 Bacteria 3905
301 nmdc:mga08y16_16294_c1 3300050511 Bacteria 7816
302 nmdc:mga0rr50_96951_c1 3300050513 Bacteria 2308
303 Ga0500583_0092571 3300053092 Bacteria 1473
304 Ga0500642_0032891 3300053130 Bacteria 2180
305 Ga0500658_0041594 3300053134 Bacteria 1844
306 Ga0500589_042480 3300053147 Bacteria 2120
307 Ga0500622_0004286 3300053156 Bacteria 9048
308 Ga0501084_0002257 3300054114 Bacteria 15480
309 Ga0501084_0089197 3300054114 Bacteria 2588
310 Ga0501084_0123035 3300054114 Bacteria 2182
311 Ga0530510_0023594 3300061734 Bacteria 4385
312 2894776920 2894772417 Bacteria 5305674
313 2929201134 2929199973 Bacteria 7260745
314 8055909895 8055909800 Bacteria 7278581
315 Ga0207662_10263499
316 Ga0065707_10082632
317 Ga0070690_100143089
318 Ga0068869_100095076
319 Ga0068869_100501041
320 Ga0070680_100020795
321 Ga0070689_100001555
322 Ga0070689_100236777
323 Ga0070675_100020370
324 Ga0070675_100153259
325 Ga0070675_100583722
326 Ga0070674_100003931
327 Ga0070674_100053391
328 Ga0070674_100254347
329 Ga0070673_100064895
330 Ga0070673_100104034
331 Ga0070688_100058793
332 Ga0070688_100138401
333 Ga0070667_100184334
334 Ga0070714_100000846
335 Ga0070714_100158432
336 Ga0070713_100001210
337 Ga0070710_10143975
338 Ga0070701_10005731
339 Ga0070701_10041471
340 Ga0070701_10289074
341 Ga0070705_100023431
342 Ga0070700_100012132
343 Ga0070700_100092423
344 Ga0070678_100078108
345 Ga0070678_100093205
346 Ga0070662_100013992
347 Ga0070662_100250996
348 Ga0068867_100008613
349 Ga0068867_100128173
350 Ga0068867_100428800
351 Ga0070679_100078600
352 Ga0070672_100093949
353 Ga0070672_100107332
354 Ga0070672_100466486
355 Ga0070686_100004941
356 Ga0070686_100230196
357 Ga0070695_100302504
358 Ga0070665_100003361
359 Ga0070665_100192134
360 Ga0070665_100711929
361 Ga0070664_100020963
362 Ga0068857_100593619
363 Ga0068856_100030457
364 Ga0068859_100034201
365 Ga0068861_100001227
366 Ga0068861_100045173
367 Ga0068861_100063739
368 Ga0068861_100227919
369 Ga0068870_10008397
370 Ga0068863_100096621
371 Ga0068858_100624614
372 Ga0068858_100902189
373 Ga0068860_100083850
374 Ga0068862_100134056
375 Ga0068862_100180141
376 Ga0068862_100528692
377 Ga0068862_100668701
378 Ga0070712_100463406
379 Ga0097621_100014726
380 Ga0097621_100043945
381 Ga0097621_100401572
382 Ga0068871_100019316
383 Ga0068871_100020572
384 Ga0068871_100720500
385 Ga0075428_100003320
386 Ga0075428_100035749
387 Ga0075428_100058522
388 Ga0075430_100008776
389 Ga0075430_100011793
390 Ga0075430_100096910
391 Ga0075431_100028992
392 Ga0075431_100039755
393 Ga0075431_100055474
394 Ga0075429_100031039
395 Ga0075429_100056351
396 Ga0068865_100012668
397 Ga0068865_100399776
398 Ga0097620_100034202
399 Ga0097620_100617159
400 Ga0099826_10199263
401 Ga0111539_10061840
402 Ga0114129_10291844
403 Ga0114129_11043856
404 Ga0105242_10068194
405 Ga0105248_10073326
406 Ga0105249_10078183
407 Ga0105249_10181879
408 Ga0105249_10914208
409 Ga0099796_10020724
410 Ga0157369_10356656
411 Ga0163162_10474492
412 Ga0163162_10700505
413 Ga0157372_10047001
414 Ga0157375_10054559
415 Ga0157375_10676051
416 Ga0163163_10045077
417 Ga0163163_10131552
418 Ga0157380_10013272
419 Ga0157380_10013888
420 Ga0157380_10028190
421 Ga0157380_10072142
422 Ga0157380_10481939
423 Ga0157380_10694025
424 Ga0213872_10107103
425 Ga0213874_10063504
426 Ga0207682_10008037
427 Ga0207692_10148054
428 Ga0207699_10055317
429 Ga0207699_10086118
430 Ga0207645_10006575
431 Ga0207645_10126463
432 Ga0207643_10006691
433 Ga0207707_10099667
434 Ga0207693_10270101
435 Ga0207663_10052553
436 Ga0207663_10346544
437 Ga0207662_10027748
438 Ga0207652_10105434
439 Ga0207681_10024081
440 Ga0207681_10063722
441 Ga0207659_10294326
442 Ga0207659_10375188
443 Ga0207700_10283300
444 Ga0207706_10007180
445 Ga0207686_10051065
446 Ga0207670_10061972
447 Ga0207670_10442879
448 Ga0207669_10214215
449 Ga0207669_10318045
450 Ga0207704_10015494
451 Ga0207704_10157443
452 Ga0207704_10373179
453 Ga0207704_10640930
454 Ga0207665_10125443
455 Ga0207691_10001467
456 Ga0207691_10007516
457 Ga0207691_10013491
458 Ga0207691_10079804
459 Ga0207691_10304767
460 Ga0207689_10036430
461 Ga0207689_10111438
462 Ga0207689_10282671
463 Ga0207689_10529229
464 Ga0207661_10246298
465 Ga0207651_10108638
466 Ga0207712_10202542
467 Ga0207668_10060927
468 Ga0207640_10555950
469 Ga0207658_10279771
470 Ga0207703_10125275
471 Ga0207708_10021145
472 Ga0207708_10042108
473 Ga0207641_10394559
474 Ga0207641_10395680
475 Ga0207648_10010183
476 Ga0207648_10141547
477 Ga0207648_10159153
478 Ga0207648_10308874
479 Ga0207648_10455233
480 Ga0207676_10215800
481 Ga0207676_10246914
482 Ga0207674_10279284
483 Ga0207675_100001198
484 Ga0207675_100031593
485 Ga0207675_100036537
486 Ga0207675_100052288
487 Ga0207675_100092642
488 Ga0207675_100132204
489 Ga0207683_10033353
490 Ga0207683_10910126
491 Ga0209971_1001466
492 Ga0209998_10001499
493 Ga0207428_10020565
494 Ga0268266_10155729
495 Ga0268265_10030503
496 Ga0268265_10182976
497 Ga0268264_10056802
498 Ga0268264_10443385
499 Ga0307515_10319046
500 Ga0307513_10003859
501 Ga0307513_10034965
502 Ga0307513_10083068
503 Ga0307509_10051687
504 Ga0307509_10129359
505 Ga0316579_10025261
506 Ga0307413_10006637
507 Ga0307413_10025214
508 Ga0307410_10123680
509 Ga0307410_10166539
510 Ga0307406_10035377
511 Ga0307406_10332441
512 Ga0307407_10002965
513 Ga0307407_10090067
514 Ga0307407_10332725
515 Ga0307412_10436423
516 Ga0307412_10481707
517 Ga0307409_100017804
518 Ga0307409_100062980
519 Ga0307416_100233103
520 Ga0307411_10001567
521 Ga0307411_10068939
522 Ga0307415_100125158
523 Ga0307415_100312810
524 Ga0307415_100431990
525 Ga0373955_0051347
526 Ga0400485_07696
527 Ga0400486_22154
528 Ga0400483_016886
529 Ga0400483_201758
530 Ga0400483_225439
531 Ga0400483_251413
532 Ga0400487_52634
533 Ga0436361_1133989
534 Ga0436363_0725099
535 Ga0451791_0668686
536 Ga0451791_1461780
537 Ga0451797_0633591
538 Ga0451797_1164500
539 Ga0451798_0379712
540 Ga0451807_1239698
541 Ga0451807_1519397
542 Ga0439444_0026995
543 Ga0451577_0018451
544 Ga0466965_0044301
545 Ga0453684_0000071
546 Ga0466957_0581650
547 Ga0451576_0000262
548 Ga0451576_0000444
549 Ga0451576_0140629
550 Ga0495590_0001976
551 Ga0495638_0000932
552 Ga0495638_0018223
553 Ga0495638_0018462
554 Ga0495638_0110887
555 Ga0495616_0001211
556 Ga0495616_0054815
557 Ga0495616_0192256
558 Ga0495632_0167225
559 Ga0495621_0113401
560 Ga0495668_0120519
561 Ga0495634_0402566
562 Ga0495625_0003435
563 Ga0495625_0038812
564 Ga0495625_0183375
565 Ga0495635_0349821
566 Ga0495659_0019271
567 Ga0495649_0046813
568 Ga0495672_0010774
569 Ga0495672_0301375
570 Ga0495686_0127880
571 Ga0496101_0224355
572 Ga0496107_0209832
573 Ga0496109_0307397
574 Ga0496112_0464584
575 Ga0496121_0028102
576 Ga0501036_0365410
577 Ga0501036_0420593
578 Ga0501040_0238405
579 Ga0501040_0322577
580 Ga0501040_0489439
581 Ga0501042_0295336
582 Ga0501042_0413104
583 Ga0501043_0211044
584 Ga0501046_0021656
585 Ga0501046_0380639
586 Ga0501048_0045823
587 Ga0501048_0370884
588 Ga0501068_0004113
589 Ga0501068_0094065
590 Ga0501068_0381968
591 Ga0501069_0166315
592 Ga0501070_0025445
593 Ga0501070_0249009
594 Ga0501071_0140872
595 Ga0501071_0151099
596 Ga0501071_0679548
597 Ga0501072_0056714
598 Ga0501073_0002144
599 Ga0501074_0007415
600 Ga0501075_0174738
601 Ga0501077_0001020
602 Ga0501079_0005396
603 Ga0501080_0013052
604 Ga0501080_0060483
605 Ga0501081_0175088
606 Ga0501081_0217275
607 Ga0501083_0142241
608 nmdc:mga05p37_616012_c1
609 nmdc:mga09592_29998_c1
610 nmdc:mga09592_90794_c1
611 nmdc:mga0qj67_10274_c1
612 nmdc:mga0qj67_6592_c1
613 nmdc:mga06r32_48490_c1
614 nmdc:mga06r32_52494_c1
615 nmdc:mga08y16_16294_c1
616 nmdc:mga0rr50_96951_c1
617 Ga0500583_0092571
618 Ga0500642_0032891
619 Ga0500658_0041594
620 Ga0500589_042480
621 Ga0500622_0004286
622 Ga0501084_0002257
623 Ga0501084_0089197
624 Ga0501084_0123035
625 Ga0530510_0023594
626 2894776920
627 2929201134
628 8055909895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

24

225

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9133 7 214
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8986 8 219
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8081 7 214
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.803 8 219
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7975 8 185
ID Description Score Start End Superfamily
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9506 1 222 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9424 1 222 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9179 7 224 1.10.3720.10
3d31C00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9133 7 214 1.10.3720.10
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9038 12 221 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4S3LV60-F1-model_v4 Molybdate ABC transporter permease subunit 0.9758 1 153 GO:0005886
GO:0055085
AF-A0A3D2B680-F1-model_v4 Molybdate ABC transporter permease 0.9668 1 156 GO:0005886
GO:0055085
AF-A0A712CN02-F1-model_v4 Molybdenum transport system permease 0.9661 1 171 GO:0005886
GO:0015098
AF-A0A528EAM7-F1-model_v4 Molybdate ABC transporter permease subunit 0.9648 2 169 GO:0005886
GO:0055085
AF-A0A2N5ZSU1-F1-model_v4 Molybdate ABC transporter permease subunit 0.9633 1 162 GO:0005886
GO:0055085

Map