F402717

General Info

Members Datasets Scaffolds Average Seq Length
314 219 628 120

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10556772|Ga0207663_105567722
Length 146
Sequence MVSASVLGLVCLTETACGAIVHHMVKFQGWQLDRTFAALVDPTRRAILARLAMEESLSIGELARPFTIKLPAVMKHLGVLGAAGLIVRSKKGRTVAVRLASEPMAEAMDWLRRYERFWSASLDRLAAYAEAEEAKAGAAKTRENPT

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
94 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0.64
Rhizoplane 12.1
Rhizosphere 76.75
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10556772 3300025916 Bacteria 897
2 Ga0070670_101419683 3300005331 Bacteria 637
3 Ga0070677_10141720 3300005333 Bacteria 1109
4 Ga0068869_100021995 3300005334 Bacteria 4389
5 Ga0070668_101199567 3300005347 Bacteria 687
6 Ga0070668_101342744 3300005347 Bacteria 651
7 Ga0070671_100019693 3300005355 Bacteria 5495
8 Ga0070714_100064961 3300005435 Bacteria 3143
9 Ga0070713_100154720 3300005436 Bacteria 2043
10 Ga0070713_100239137 3300005436 Bacteria 1653
11 Ga0070713_100380591 3300005436 Bacteria 1315
12 Ga0070713_100984669 3300005436 Bacteria 813
13 Ga0070713_101144285 3300005436 Bacteria 753
14 Ga0070713_101837106 3300005436 Bacteria 588
15 Ga0070713_101855388 3300005436 Bacteria 585
16 Ga0070710_10752210 3300005437 Bacteria 692
17 Ga0070678_100280540 3300005456 Bacteria 1409
18 Ga0070678_100637894 3300005456 Bacteria 954
19 Ga0070681_10058010 3300005458 Bacteria 3851
20 Ga0070699_100084505 3300005518 Bacteria 2770
21 Ga0070679_100060334 3300005530 Bacteria 3780
22 Ga0070697_101664828 3300005536 Bacteria 571
23 Ga0068853_100051039 3300005539 Bacteria 3559
24 Ga0068853_100328062 3300005539 Bacteria 1420
25 Ga0070672_100642433 3300005543 Bacteria 926
26 Ga0070686_100116654 3300005544 Bacteria 1827
27 Ga0070695_100053029 3300005545 Bacteria 2608
28 Ga0070696_100232620 3300005546 Unclassified 1387
29 Ga0070693_101406518 3300005547 Unclassified 542
30 Ga0070704_100025638 3300005549 Bacteria 3884
31 Ga0070664_100854281 3300005564 Unclassified 852
32 Ga0068863_100023527 3300005841 Bacteria 5881
33 Ga0068858_100159401 3300005842 Bacteria 2124
34 Ga0068860_100049255 3300005843 Bacteria 4013
35 Ga0068860_100210665 3300005843 Bacteria 1885
36 Ga0068862_100000023 3300005844 Bacteria 203389
37 Ga0068862_100680803 3300005844 Bacteria 995
38 Ga0081455_10000511 3300005937 Bacteria 50249
39 Ga0081455_10032205 3300005937 Bacteria 4728
40 Ga0081455_10046246 3300005937 Bacteria 3778
41 Ga0081538_10109602 3300005981 Bacteria 1359
42 Ga0081540_1000055 3300005983 Bacteria 122642
43 Ga0081540_1001314 3300005983 Bacteria 21706
44 Ga0081540_1154039 3300005983 Bacteria 902
45 Ga0070717_10028419 3300006028 Bacteria 4476
46 Ga0070717_10589777 3300006028 Bacteria 1008
47 Ga0075364_10908660 3300006051 Unclassified 599
48 Ga0075432_10060621 3300006058 Unclassified 1346
49 Ga0070712_100293104 3300006175 Bacteria 1314
50 Ga0075367_11059083 3300006178 Bacteria 518
51 Ga0075366_10073421 3300006195 Bacteria 2039
52 Ga0075366_10531066 3300006195 Bacteria 728
53 Ga0075370_10014490 3300006353 Bacteria 4206
54 Ga0075370_10783769 3300006353 Bacteria 581
55 Ga0075433_10031267 3300006852 Bacteria 4550
56 Ga0075433_11072806 3300006852 Unclassified 701
57 Ga0075434_100039126 3300006871 Bacteria 4699
58 Ga0075436_100005429 3300006914 Bacteria 8770
59 Ga0097620_100037371 3300006931 Bacteria 4873
60 Ga0079104_1019318 3300006946 Bacteria 1907
61 Ga0075435_100054560 3300007076 Bacteria 3226
62 Ga0099795_10392649 3300007788 Bacteria 629
63 Ga0111539_10132265 3300009094 Plasmid 2921
64 Ga0105245_11427071 3300009098 Unclassified 742
65 Ga0105247_10032151 3300009101 Bacteria 3187
66 Ga0105247_10086506 3300009101 Bacteria 1984
67 Ga0105247_10412954 3300009101 Bacteria 965
68 Ga0105247_10729530 3300009101 Bacteria 749
69 Ga0114129_10093071 3300009147 Bacteria 4176
70 Ga0105242_12344033 3300009176 Bacteria 580
71 Ga0105248_10038696 3300009177 Bacteria 5339
72 Ga0105237_11620881 3300009545 Bacteria 654
73 Ga0105237_12105454 3300009545 Unclassified 573
74 Ga0105249_10000004 3300009553 Bacteria 368014
75 Ga0105239_10136183 3300010375 Bacteria 2734
76 Ga0105239_10547447 3300010375 Bacteria 1318
77 Ga0157317_1020430 3300012475 Bacteria 586
78 Ga0157373_10271450 3300013100 Bacteria 1201
79 Ga0157370_10491758 3300013104 Bacteria 1127
80 Ga0157374_10280272 3300013296 Bacteria 1646
81 Ga0163163_10031269 3300014325 Bacteria 5137
82 Ga0163163_10140280 3300014325 Bacteria 2459
83 Ga0163163_11649829 3300014325 Bacteria 702
84 Ga0182008_10115377 3300014497 Bacteria 1332
85 Ga0157379_10435339 3300014968 Bacteria 1209
86 Ga0157376_10982034 3300014969 Bacteria 866
87 Ga0163161_10378870 3300017792 Bacteria 1130
88 Ga0213874_10034464 3300021377 Bacteria 1482
89 Ga0213876_10056529 3300021384 Bacteria 2071
90 Ga0207710_10030873 3300025900 Bacteria 2340
91 Ga0207688_10100488 3300025901 Bacteria 1670
92 Ga0207685_10623562 3300025905 Unclassified 581
93 Ga0207699_10014457 3300025906 Bacteria 4070
94 Ga0207705_10073992 3300025909 Bacteria 2472
95 Ga0207705_10097235 3300025909 Bacteria 2162
96 Ga0207693_10309254 3300025915 Bacteria 1237
97 Ga0207657_10011540 3300025919 Bacteria 8770
98 Ga0207694_10393200 3300025924 Bacteria 1152
99 Ga0207700_10167567 3300025928 Bacteria 1829
100 Ga0207700_10465096 3300025928 Bacteria 1116
101 Ga0207700_11263393 3300025928 Bacteria 658
102 Ga0207700_11329075 3300025928 Bacteria 640
103 Ga0207700_11803096 3300025928 Bacteria 538
104 Ga0207664_10053889 3300025929 Bacteria 3185
105 Ga0207644_11849471 3300025931 Bacteria 505
106 Ga0207670_11524310 3300025936 Bacteria 568
107 Ga0207711_10000464 3300025941 Bacteria 42035
108 Ga0207689_10028392 3300025942 Bacteria 4681
109 Ga0207712_10000008 3300025961 Bacteria 527957
110 Ga0207639_10313484 3300026041 Bacteria 1390
111 Ga0207639_11233116 3300026041 Bacteria 702
112 Ga0207702_11570704 3300026078 Bacteria 651
113 Ga0207641_10005531 3300026088 Bacteria 10780
114 Ga0207641_10087542 3300026088 Bacteria 2718
115 Ga0207641_11290483 3300026088 Bacteria 730
116 Ga0207676_10362543 3300026095 Bacteria 1343
117 Ga0207674_10247875 3300026116 Bacteria 1728
118 Ga0207683_10007219 3300026121 Bacteria 9527
119 Ga0207683_10588023 3300026121 Bacteria 1030
120 Ga0209281_1025417 3300027111 Bacteria 1103
121 Ga0207428_10297080 3300027907 Bacteria 1196
122 Ga0265355_1003285 3300028036 Bacteria 1183
123 Ga0268266_10010648 3300028379 Bacteria 8012
124 Ga0268265_10000035 3300028380 Bacteria 207267
125 Ga0268265_10855062 3300028380 Bacteria 890
126 Ga0268264_10001085 3300028381 Bacteria 26931
127 Ga0265338_10838830 3300028800 Bacteria 628
128 Ga0307511_10063091 3300030521 Bacteria 2804
129 Ga0307512_10399652 3300030522 Bacteria 578
130 Ga0265770_1000046 3300030878 Bacteria 12559
131 Ga0265771_1000966 3300031010 Bacteria 1250
132 Ga0265760_10000051 3300031090 Bacteria 33527
133 Ga0307513_10223061 3300031456 Bacteria 1704
134 Ga0307513_10518873 3300031456 Bacteria 907
135 Ga0373928_0084343 3300035084 Bacteria 806
136 Ga0373934_0172939 3300035086 Bacteria 887
137 Ga0373949_0304024 3300035090 Bacteria 507
138 Ga0373936_0004799 3300035113 Bacteria 5104
139 Ga0373936_0085925 3300035113 Bacteria 1314
140 Ga0373936_0186874 3300035113 Bacteria 911
141 Ga0373941_0492295 3300035115 Bacteria 520
142 Ga0373945_0050572 3300035116 Bacteria 1528
143 Ga0373956_0370318 3300035119 Bacteria 683
144 Ga0373957_0336892 3300035120 Bacteria 643
145 Ga0373962_0199001 3300035242 Bacteria 677
146 Ga0373931_0600879 3300035691 Bacteria 719
147 Ga0373935_0160629 3300035692 Bacteria 1531
148 Ga0373935_0420116 3300035692 Unclassified 962
149 Ga0373927_0051999 3300035695 Bacteria 2650
150 Ga0373933_0722442 3300035724 Bacteria 655
151 Ga0373947_0236098 3300035725 Bacteria 1205
152 Ga0373947_0274806 3300035725 Unclassified 1119
153 Ga0373937_0051892 3300036401 Bacteria 3759
154 Ga0373937_1266050 3300036401 Bacteria 686
155 Ga0373925_0025932 3300037068 Bacteria 4286
156 Ga0373925_0104310 3300037068 Bacteria 2183
157 Ga0373925_0353819 3300037068 Bacteria 1193
158 Ga0395899_0634083 3300037312 Bacteria 677
159 Ga0395898_0136896 3300037466 Bacteria 2345
160 Ga0395905_0927345 3300037471 Bacteria 774
161 Ga0436364_1106061 3300037853 Bacteria 2783
162 Ga0436364_1314768 3300037853 Bacteria 3352
163 Ga0395901_0393157 3300038443 Bacteria 1425
164 Ga0237819_03832 3300038705 Bacteria 2579
165 Ga0436365_0184254 3300039437 Bacteria 5294
166 Ga0436365_0416862 3300039437 Unclassified 1433
167 Ga0436360_0795458 3300039438 Bacteria 1114
168 Ga0436361_0761082 3300039447 Bacteria 1200
169 Ga0436363_0998443 3300039450 Bacteria 2877
170 Ga0466963_1155993 3300044694 Bacteria 544
171 Ga0466967_1432024 3300045976 Bacteria 688
172 Ga0495592_0101351 3300046454 Bacteria 2052
173 Ga0495641_0380360 3300046461 Bacteria 640
174 Ga0495651_0047414 3300046462 Bacteria 3322
175 Ga0495653_0909056 3300046463 Bacteria 524
176 Ga0495580_0399948 3300046472 Unclassified 926
177 Ga0495582_0313930 3300046473 Bacteria 902
178 Ga0495639_0059337 3300046475 Bacteria 1751
179 Ga0495606_0242218 3300046507 Bacteria 1005
180 Ga0495618_0235773 3300046514 Bacteria 1151
181 Ga0495618_0348543 3300046514 Bacteria 913
182 Ga0495628_0178576 3300046516 Bacteria 1607
183 Ga0495630_0442519 3300046517 Bacteria 996
184 Ga0495630_1066493 3300046517 Bacteria 613
185 Ga0495652_0050309 3300046529 Bacteria 3563
186 Ga0495586_0355755 3300046535 Bacteria 841
187 Ga0495587_0360018 3300046536 Bacteria 810
188 Ga0495645_0298721 3300046543 Bacteria 1053
189 Ga0495645_0362609 3300046543 Bacteria 931
190 Ga0495645_0665671 3300046543 Bacteria 635
191 Ga0495668_0040759 3300046616 Bacteria 2589
192 Ga0495611_0012110 3300046648 Bacteria 3665
193 Ga0495611_0264082 3300046648 Bacteria 797
194 Ga0495625_0315158 3300046660 Unclassified 997
195 Ga0495625_0544953 3300046660 Bacteria 703
196 Ga0495625_0554231 3300046660 Bacteria 696
197 Ga0495635_0321706 3300046663 Bacteria 1035
198 Ga0495657_0799799 3300046675 Unclassified 539
199 Ga0495599_0278658 3300046678 Bacteria 1013
200 Ga0495658_0239112 3300046683 Bacteria 1140
201 Ga0495658_0562629 3300046683 Bacteria 730
202 Ga0495669_0024950 3300046684 Bacteria 2605
203 Ga0495613_0231663 3300046689 Unclassified 1294
204 Ga0495613_0236029 3300046689 Bacteria 1280
205 Ga0495624_0121086 3300046690 Bacteria 1607
206 Ga0495670_0654800 3300046691 Bacteria 572
207 Ga0495671_0214217 3300046692 Bacteria 933
208 Ga0495589_0316151 3300046794 Unclassified 722
209 Ga0495600_0424584 3300046809 Bacteria 825
210 Ga0495660_0122934 3300046810 Bacteria 1311
211 Ga0495604_0110716 3300047317 Bacteria 2003
212 Ga0495674_0076220 3300047319 Bacteria 2885
213 Ga0495674_1424486 3300047319 Unclassified 515
214 Ga0495680_0084072 3300047322 Bacteria 2399
215 Ga0495677_0244675 3300047445 Bacteria 701
216 Ga0495684_0018205 3300047471 Bacteria 5414
217 Ga0495684_0301273 3300047471 Bacteria 1151
218 Ga0495593_0538372 3300047673 Bacteria 586
219 Ga0495602_0348306 3300048088 Bacteria 1070
220 Ga0495602_0568979 3300048088 Bacteria 783
221 Ga0496100_1112808 3300048903 Bacteria 622
222 Ga0496102_0033701 3300048905 Bacteria 4604
223 Ga0496102_0057652 3300048905 Bacteria 3547
224 Ga0496102_0728625 3300048905 Bacteria 914
225 Ga0496103_0208211 3300048906 Unclassified 1258
226 Ga0496103_0495300 3300048906 Bacteria 782
227 Ga0496104_0001628 3300048907 Bacteria 19392
228 Ga0496104_0299496 3300048907 Bacteria 1520
229 Ga0496105_0051399 3300048908 Bacteria 3405
230 Ga0496105_1395866 3300048908 Bacteria 507
231 Ga0496106_0036920 3300048909 Bacteria 3654
232 Ga0496106_0150907 3300048909 Bacteria 1833
233 Ga0496107_0111071 3300048910 Bacteria 2015
234 Ga0496107_0203847 3300048910 Bacteria 1470
235 Ga0496108_1228675 3300048911 Bacteria 633
236 Ga0496109_0119144 3300048912 Bacteria 2458
237 Ga0496109_0214171 3300048912 Bacteria 1812
238 Ga0496109_0424333 3300048912 Bacteria 1256
239 Ga0496109_0507589 3300048912 Bacteria 1138
240 Ga0496109_0920719 3300048912 Bacteria 812
241 Ga0496111_0296501 3300048914 Bacteria 1199
242 Ga0496111_0484452 3300048914 Bacteria 911
243 Ga0496111_0623172 3300048914 Bacteria 789
244 Ga0496111_0651758 3300048914 Unclassified 768
245 Ga0496112_0174752 3300048915 Bacteria 2113
246 Ga0496112_0363577 3300048915 Bacteria 1389
247 Ga0496112_0505506 3300048915 Bacteria 1144
248 Ga0496112_0515675 3300048915 Bacteria 1130
249 Ga0496113_0179930 3300048916 Bacteria 1676
250 Ga0496113_0452418 3300048916 Unclassified 1032
251 Ga0496114_0225577 3300048917 Bacteria 1645
252 Ga0496114_0262603 3300048917 Bacteria 1520
253 Ga0496114_0552935 3300048917 Bacteria 1017
254 Ga0496114_1173904 3300048917 Bacteria 653
255 Ga0496115_0075021 3300048918 Bacteria 2747
256 Ga0496115_0140047 3300048918 Bacteria 1996
257 Ga0496115_0189227 3300048918 Bacteria 1700
258 Ga0496115_0269772 3300048918 Bacteria 1398
259 Ga0496116_0006523 3300048919 Bacteria 10571
260 Ga0496117_0000024 3300048920 Bacteria 418750
261 Ga0496118_0000014 3300048921 Bacteria 561628
262 Ga0496119_0015750 3300048922 Bacteria 5797
263 Ga0496119_0073810 3300048922 Bacteria 1988
264 Ga0496120_0025887 3300048923 Bacteria 3634
265 Ga0496120_0030534 3300048923 Bacteria 3273
266 Ga0496121_0139171 3300048924 Bacteria 1803
267 Ga0496124_0090523 3300048927 Bacteria 2495
268 Ga0496125_0032911 3300048928 Bacteria 4597
269 Ga0496126_0220194 3300048929 Bacteria 1594
270 Ga0501032_0442625 3300049569 Bacteria 833
271 Ga0501033_0024723 3300049570 Bacteria 4529
272 Ga0501034_0281599 3300049571 Bacteria 1602
273 Ga0501038_0680636 3300049574 Bacteria 772
274 Ga0501039_0052038 3300049575 Bacteria 3169
275 Ga0501039_0509489 3300049575 Bacteria 945
276 Ga0501039_1377936 3300049575 Bacteria 543
277 Ga0501046_0821031 3300049580 Bacteria 651
278 Ga0501047_0002937 3300049581 Bacteria 16179
279 Ga0501067_0501643 3300049583 Unclassified 679
280 Ga0501073_0124325 3300049589 Bacteria 1788
281 Ga0501076_0186881 3300049592 Bacteria 1690
282 Ga0501077_0186168 3300049593 Bacteria 1319
283 Ga0501227_014716 3300049665 Bacteria 1740
284 Ga0501249_000847 3300049679 Bacteria 6783
285 Ga0501079_0318931 3300049741 Bacteria 1217
286 Ga0501079_0342417 3300049741 Unclassified 1171
287 Ga0501080_0634279 3300049742 Bacteria 946
288 Ga0501081_0076368 3300049743 Bacteria 2340
289 Ga0501083_0023028 3300049744 Bacteria 4323
290 Ga0501035_0540564 3300049822 Bacteria 955
291 Ga0501044_0016901 3300049823 Bacteria 7826
292 nmdc:mga0k408_17501_c1 3300050493 Bacteria 3993
293 nmdc:mga0k408_481653_c1 3300050493 Bacteria 736
294 nmdc:mga08y16_98197_c1 3300050511 Unclassified 3050
295 nmdc:mga0n895_21366_c1 3300050512 Bacteria 6051
296 nmdc:mga0n895_599078_c1 3300050512 Bacteria 1104
297 nmdc:mga0rr50_1447581_c1 3300050513 Bacteria 581
298 nmdc:mga0rr50_170705_c1 3300050513 Unclassified 1772
299 nmdc:mga08x19_10236_c1 3300050514 Bacteria 5626
300 nmdc:mga0a205_35454_c1 3300050515 Bacteria 4791
301 Ga0495601_0282498 3300053077 Bacteria 1082
302 Ga0495601_0335529 3300053077 Bacteria 984
303 Ga0495601_0744130 3300053077 Unclassified 624
304 Ga0495612_0309166 3300053078 Unclassified 710
305 Ga0495655_0011592 3300053083 Bacteria 1775
306 Ga0495655_0129212 3300053083 Bacteria 777
307 Ga0495619_0446015 3300053085 Bacteria 892
308 Ga0495619_0668216 3300053085 Bacteria 708
309 Ga0500643_133684 3300053087 Bacteria 667
310 Ga0500601_049715 3300053737 Unclassified 520
311 Ga0501084_0052138 3300054114 Bacteria 3424
312 Ga0501082_0090848 3300060353 Bacteria 2637
313 Ga0501082_0269991 3300060353 Bacteria 1480
314 Ga0530510_0350410 3300061734 Bacteria 1109
315 Ga0207663_10556772
316 Ga0070670_101419683
317 Ga0070677_10141720
318 Ga0068869_100021995
319 Ga0070668_101199567
320 Ga0070668_101342744
321 Ga0070671_100019693
322 Ga0070714_100064961
323 Ga0070713_100154720
324 Ga0070713_100239137
325 Ga0070713_100380591
326 Ga0070713_100984669
327 Ga0070713_101144285
328 Ga0070713_101837106
329 Ga0070713_101855388
330 Ga0070710_10752210
331 Ga0070678_100280540
332 Ga0070678_100637894
333 Ga0070681_10058010
334 Ga0070699_100084505
335 Ga0070679_100060334
336 Ga0070697_101664828
337 Ga0068853_100051039
338 Ga0068853_100328062
339 Ga0070672_100642433
340 Ga0070686_100116654
341 Ga0070695_100053029
342 Ga0070696_100232620
343 Ga0070693_101406518
344 Ga0070704_100025638
345 Ga0070664_100854281
346 Ga0068863_100023527
347 Ga0068858_100159401
348 Ga0068860_100049255
349 Ga0068860_100210665
350 Ga0068862_100000023
351 Ga0068862_100680803
352 Ga0081455_10000511
353 Ga0081455_10032205
354 Ga0081455_10046246
355 Ga0081538_10109602
356 Ga0081540_1000055
357 Ga0081540_1001314
358 Ga0081540_1154039
359 Ga0070717_10028419
360 Ga0070717_10589777
361 Ga0075364_10908660
362 Ga0075432_10060621
363 Ga0070712_100293104
364 Ga0075367_11059083
365 Ga0075366_10073421
366 Ga0075366_10531066
367 Ga0075370_10014490
368 Ga0075370_10783769
369 Ga0075433_10031267
370 Ga0075433_11072806
371 Ga0075434_100039126
372 Ga0075436_100005429
373 Ga0097620_100037371
374 Ga0079104_1019318
375 Ga0075435_100054560
376 Ga0099795_10392649
377 Ga0111539_10132265
378 Ga0105245_11427071
379 Ga0105247_10032151
380 Ga0105247_10086506
381 Ga0105247_10412954
382 Ga0105247_10729530
383 Ga0114129_10093071
384 Ga0105242_12344033
385 Ga0105248_10038696
386 Ga0105237_11620881
387 Ga0105237_12105454
388 Ga0105249_10000004
389 Ga0105239_10136183
390 Ga0105239_10547447
391 Ga0157317_1020430
392 Ga0157373_10271450
393 Ga0157370_10491758
394 Ga0157374_10280272
395 Ga0163163_10031269
396 Ga0163163_10140280
397 Ga0163163_11649829
398 Ga0182008_10115377
399 Ga0157379_10435339
400 Ga0157376_10982034
401 Ga0163161_10378870
402 Ga0213874_10034464
403 Ga0213876_10056529
404 Ga0207710_10030873
405 Ga0207688_10100488
406 Ga0207685_10623562
407 Ga0207699_10014457
408 Ga0207705_10073992
409 Ga0207705_10097235
410 Ga0207693_10309254
411 Ga0207657_10011540
412 Ga0207694_10393200
413 Ga0207700_10167567
414 Ga0207700_10465096
415 Ga0207700_11263393
416 Ga0207700_11329075
417 Ga0207700_11803096
418 Ga0207664_10053889
419 Ga0207644_11849471
420 Ga0207670_11524310
421 Ga0207711_10000464
422 Ga0207689_10028392
423 Ga0207712_10000008
424 Ga0207639_10313484
425 Ga0207639_11233116
426 Ga0207702_11570704
427 Ga0207641_10005531
428 Ga0207641_10087542
429 Ga0207641_11290483
430 Ga0207676_10362543
431 Ga0207674_10247875
432 Ga0207683_10007219
433 Ga0207683_10588023
434 Ga0209281_1025417
435 Ga0207428_10297080
436 Ga0265355_1003285
437 Ga0268266_10010648
438 Ga0268265_10000035
439 Ga0268265_10855062
440 Ga0268264_10001085
441 Ga0265338_10838830
442 Ga0307511_10063091
443 Ga0307512_10399652
444 Ga0265770_1000046
445 Ga0265771_1000966
446 Ga0265760_10000051
447 Ga0307513_10223061
448 Ga0307513_10518873
449 Ga0373928_0084343
450 Ga0373934_0172939
451 Ga0373949_0304024
452 Ga0373936_0004799
453 Ga0373936_0085925
454 Ga0373936_0186874
455 Ga0373941_0492295
456 Ga0373945_0050572
457 Ga0373956_0370318
458 Ga0373957_0336892
459 Ga0373962_0199001
460 Ga0373931_0600879
461 Ga0373935_0160629
462 Ga0373935_0420116
463 Ga0373927_0051999
464 Ga0373933_0722442
465 Ga0373947_0236098
466 Ga0373947_0274806
467 Ga0373937_0051892
468 Ga0373937_1266050
469 Ga0373925_0025932
470 Ga0373925_0104310
471 Ga0373925_0353819
472 Ga0395899_0634083
473 Ga0395898_0136896
474 Ga0395905_0927345
475 Ga0436364_1106061
476 Ga0436364_1314768
477 Ga0395901_0393157
478 Ga0237819_03832
479 Ga0436365_0184254
480 Ga0436365_0416862
481 Ga0436360_0795458
482 Ga0436361_0761082
483 Ga0436363_0998443
484 Ga0466963_1155993
485 Ga0466967_1432024
486 Ga0495592_0101351
487 Ga0495641_0380360
488 Ga0495651_0047414
489 Ga0495653_0909056
490 Ga0495580_0399948
491 Ga0495582_0313930
492 Ga0495639_0059337
493 Ga0495606_0242218
494 Ga0495618_0235773
495 Ga0495618_0348543
496 Ga0495628_0178576
497 Ga0495630_0442519
498 Ga0495630_1066493
499 Ga0495652_0050309
500 Ga0495586_0355755
501 Ga0495587_0360018
502 Ga0495645_0298721
503 Ga0495645_0362609
504 Ga0495645_0665671
505 Ga0495668_0040759
506 Ga0495611_0012110
507 Ga0495611_0264082
508 Ga0495625_0315158
509 Ga0495625_0544953
510 Ga0495625_0554231
511 Ga0495635_0321706
512 Ga0495657_0799799
513 Ga0495599_0278658
514 Ga0495658_0239112
515 Ga0495658_0562629
516 Ga0495669_0024950
517 Ga0495613_0231663
518 Ga0495613_0236029
519 Ga0495624_0121086
520 Ga0495670_0654800
521 Ga0495671_0214217
522 Ga0495589_0316151
523 Ga0495600_0424584
524 Ga0495660_0122934
525 Ga0495604_0110716
526 Ga0495674_0076220
527 Ga0495674_1424486
528 Ga0495680_0084072
529 Ga0495677_0244675
530 Ga0495684_0018205
531 Ga0495684_0301273
532 Ga0495593_0538372
533 Ga0495602_0348306
534 Ga0495602_0568979
535 Ga0496100_1112808
536 Ga0496102_0033701
537 Ga0496102_0057652
538 Ga0496102_0728625
539 Ga0496103_0208211
540 Ga0496103_0495300
541 Ga0496104_0001628
542 Ga0496104_0299496
543 Ga0496105_0051399
544 Ga0496105_1395866
545 Ga0496106_0036920
546 Ga0496106_0150907
547 Ga0496107_0111071
548 Ga0496107_0203847
549 Ga0496108_1228675
550 Ga0496109_0119144
551 Ga0496109_0214171
552 Ga0496109_0424333
553 Ga0496109_0507589
554 Ga0496109_0920719
555 Ga0496111_0296501
556 Ga0496111_0484452
557 Ga0496111_0623172
558 Ga0496111_0651758
559 Ga0496112_0174752
560 Ga0496112_0363577
561 Ga0496112_0505506
562 Ga0496112_0515675
563 Ga0496113_0179930
564 Ga0496113_0452418
565 Ga0496114_0225577
566 Ga0496114_0262603
567 Ga0496114_0552935
568 Ga0496114_1173904
569 Ga0496115_0075021
570 Ga0496115_0140047
571 Ga0496115_0189227
572 Ga0496115_0269772
573 Ga0496116_0006523
574 Ga0496117_0000024
575 Ga0496118_0000014
576 Ga0496119_0015750
577 Ga0496119_0073810
578 Ga0496120_0025887
579 Ga0496120_0030534
580 Ga0496121_0139171
581 Ga0496124_0090523
582 Ga0496125_0032911
583 Ga0496126_0220194
584 Ga0501032_0442625
585 Ga0501033_0024723
586 Ga0501034_0281599
587 Ga0501038_0680636
588 Ga0501039_0052038
589 Ga0501039_0509489
590 Ga0501039_1377936
591 Ga0501046_0821031
592 Ga0501047_0002937
593 Ga0501067_0501643
594 Ga0501073_0124325
595 Ga0501076_0186881
596 Ga0501077_0186168
597 Ga0501227_014716
598 Ga0501249_000847
599 Ga0501079_0318931
600 Ga0501079_0342417
601 Ga0501080_0634279
602 Ga0501081_0076368
603 Ga0501083_0023028
604 Ga0501035_0540564
605 Ga0501044_0016901
606 nmdc:mga0k408_17501_c1
607 nmdc:mga0k408_481653_c1
608 nmdc:mga08y16_98197_c1
609 nmdc:mga0n895_21366_c1
610 nmdc:mga0n895_599078_c1
611 nmdc:mga0rr50_1447581_c1
612 nmdc:mga0rr50_170705_c1
613 nmdc:mga08x19_10236_c1
614 nmdc:mga0a205_35454_c1
615 Ga0495601_0282498
616 Ga0495601_0335529
617 Ga0495601_0744130
618 Ga0495612_0309166
619 Ga0495655_0011592
620 Ga0495655_0129212
621 Ga0495619_0446015
622 Ga0495619_0668216
623 Ga0500643_133684
624 Ga0500601_049715
625 Ga0501084_0052138
626 Ga0501082_0090848
627 Ga0501082_0269991
628 Ga0530510_0350410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

39

89

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

41

87

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9473 7 95
2zkz-assembly3.cif.gz_D-2 crystal structure of the transcriptional repressor pagr of bacillus anthracis 0.9405 9 56
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9396 4 95
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9285 5 87
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9079 7 95
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.968 19 75 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9505 17 74 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9487 5 87 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9473 7 95 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9449 19 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C2FGD0-F1-model_v4 Transcriptional regulator 0.9838 3 87 GO:0003700
AF-F1TFY7-F1-model_v4 Regulatory protein ArsR 0.9811 9 90 GO:0003700
AF-A0A2E6QBT4-F1-model_v4 HTH arsR-type domain-containing protein 0.9786 1 90 GO:0003700
AF-A0A1F6CME0-F1-model_v4 HTH arsR-type domain-containing protein 0.9777 7 91
AF-A0A1G0CJ68-F1-model_v4 HTH arsR-type domain-containing protein 0.9758 6 88 GO:0003700
GO:0005737

Map