F402580

General Info

Members Datasets Scaffolds Average Seq Length
314 177 314 189

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100288109|Ga0070699_1002881091
Length 212
Sequence MSRPSSDSGPPREPGRDQAVTAAASTLPGVRYGSVTRHADSRGSFRELWRASTFPTLTLAETGAPAGSTPSFVQANLSTSAPGVLRGLHYHRRQLDYWVVATGRALVALVDVRPAIDGGGPAVVETRELAADEWVVIPTGVAHGFLALEPLELLYLVTNEFDNTDELGFAWDDPAVGVPWPAVPGTPDGKPILSDRDRSNPTLAELVASLRM

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.92
Rhizosphere 89.17
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10101966 3300003320 Bacteria 1574
2 rootH1_10203378 3300003323 Bacteria 1130
3 Ga0070676_10406680 3300005328 Bacteria 948
4 Ga0070683_100003584 3300005329 Bacteria 12636
5 Ga0070687_100489989 3300005343 Bacteria 825
6 Ga0070674_100004030 3300005356 Bacteria 8329
7 Ga0070714_100008408 3300005435 Bacteria 8055
8 Ga0070710_10108205 3300005437 Unclassified 1666
9 Ga0070701_10076271 3300005438 Bacteria 1804
10 Ga0070705_100029913 3300005440 Bacteria 3002
11 Ga0070705_100042221 3300005440 Bacteria 2606
12 Ga0070694_100020387 3300005444 Bacteria 4225
13 Ga0070694_100269185 3300005444 Bacteria 1295
14 Ga0070708_100000353 3300005445 Bacteria 34792
15 Ga0070708_100027166 3300005445 Bacteria 4908
16 Ga0070708_100061925 3300005445 Unclassified 3344
17 Ga0070708_100086446 3300005445 Bacteria 2848
18 Ga0070708_100145679 3300005445 Bacteria 2199
19 Ga0070708_100170755 3300005445 Unclassified 2030
20 Ga0070708_100613951 3300005445 Bacteria 1025
21 Ga0070681_10574790 3300005458 Bacteria 1041
22 Ga0070685_10134453 3300005466 Bacteria 1550
23 Ga0070706_100000142 3300005467 Bacteria 90715
24 Ga0070706_100012459 3300005467 Bacteria 7878
25 Ga0070706_100092395 3300005467 Bacteria 2807
26 Ga0070706_100182842 3300005467 Unclassified 1958
27 Ga0070707_100001758 3300005468 Bacteria 20874
28 Ga0070707_100167416 3300005468 Bacteria 2142
29 Ga0070707_100440490 3300005468 Bacteria 1263
30 Ga0070707_100460499 3300005468 Unclassified 1232
31 Ga0070707_100605464 3300005468 Unclassified 1058
32 Ga0070698_100091618 3300005471 Bacteria 3022
33 Ga0070698_100101752 3300005471 Bacteria 2844
34 Ga0070698_100138555 3300005471 Unclassified 2386
35 Ga0070698_100140164 3300005471 Unclassified 2370
36 Ga0070698_100233921 3300005471 Bacteria 1771
37 Ga0070698_100287506 3300005471 Unclassified 1575
38 Ga0070698_100298472 3300005471 Bacteria 1542
39 Ga0070698_101043955 3300005471 Bacteria 765
40 Ga0070699_100288109 3300005518 Bacteria 1472
41 Ga0070699_100351740 3300005518 Bacteria 1327
42 Ga0070699_100583992 3300005518 Bacteria 1018
43 Ga0070699_100980419 3300005518 Bacteria 775
44 Ga0070697_100023986 3300005536 Bacteria 4854
45 Ga0070697_100038215 3300005536 Bacteria 3878
46 Ga0070672_100668609 3300005543 Bacteria 908
47 Ga0070695_100002968 3300005545 Bacteria 9884
48 Ga0070695_100073024 3300005545 Unclassified 2251
49 Ga0070695_100143890 3300005545 Bacteria 1657
50 Ga0070696_100002993 3300005546 Bacteria 11224
51 Ga0070696_100013263 3300005546 Bacteria 5531
52 Ga0070696_100031482 3300005546 Bacteria 3635
53 Ga0070696_100324606 3300005546 Bacteria 1185
54 Ga0070704_100305836 3300005549 Bacteria 1326
55 Ga0068855_100920699 3300005563 Bacteria 922
56 Ga0070664_100515057 3300005564 Bacteria 1104
57 Ga0068861_100261962 3300005719 Unclassified 1480
58 Ga0068858_100921077 3300005842 Bacteria 855
59 Ga0068860_100030104 3300005843 Bacteria 5221
60 Ga0068860_100182602 3300005843 Bacteria 2028
61 Ga0068862_100958337 3300005844 Unclassified 844
62 Ga0081455_10211136 3300005937 Bacteria 1446
63 Ga0081455_10489772 3300005937 Unclassified 829
64 Ga0081539_10003127 3300005985 Bacteria 21118
65 Ga0070716_100554593 3300006173 Bacteria 857
66 Ga0070716_101261801 3300006173 Bacteria 596
67 Ga0070712_100005542 3300006175 Bacteria 7812
68 Ga0075428_100089069 3300006844 Bacteria 3366
69 Ga0075431_100021392 3300006847 Bacteria 6614
70 Ga0075431_100425241 3300006847 Bacteria 1327
71 Ga0075433_10084724 3300006852 Bacteria 2798
72 Ga0075433_10142888 3300006852 Bacteria 2127
73 Ga0075433_10369500 3300006852 Bacteria 1267
74 Ga0075434_100080157 3300006871 Bacteria 3261
75 Ga0075434_100413402 3300006871 Bacteria 1370
76 Ga0075434_100508999 3300006871 Bacteria 1225
77 Ga0075429_100004698 3300006880 Bacteria 11753
78 Ga0075436_100094870 3300006914 Bacteria 2075
79 Ga0075436_100431961 3300006914 Unclassified 957
80 Ga0075436_100640265 3300006914 Bacteria 785
81 Ga0075435_100126499 3300007076 Unclassified 2136
82 Ga0075435_100524034 3300007076 Unclassified 1025
83 Ga0105245_10141983 3300009098 Bacteria 2263
84 Ga0114129_10001365 3300009147 Bacteria 32813
85 Ga0114129_10001898 3300009147 Bacteria 28483
86 Ga0114129_10016516 3300009147 Bacteria 10510
87 Ga0114129_10051258 3300009147 Bacteria 5795
88 Ga0114129_10464269 3300009147 Bacteria 1659
89 Ga0114129_11040220 3300009147 Unclassified 1029
90 Ga0114129_11217958 3300009147 Unclassified 937
91 Ga0114129_11702650 3300009147 Bacteria 769
92 Ga0105243_10417480 3300009148 Bacteria 1250
93 Ga0105241_10650469 3300009174 Bacteria 957
94 Ga0105249_10399450 3300009553 Unclassified 1404
95 Ga0105249_10571789 3300009553 Bacteria 1183
96 Ga0105246_10501387 3300011119 Bacteria 1031
97 Ga0163163_10047866 3300014325 Bacteria 4203
98 Ga0163163_10117522 3300014325 Bacteria 2691
99 Ga0163163_10202629 3300014325 Bacteria 2033
100 Ga0163163_10522440 3300014325 Bacteria 1249
101 Ga0157379_10115922 3300014968 Bacteria 2409
102 Ga0207653_10026415 3300025885 Unclassified 1861
103 Ga0207692_10012944 3300025898 Bacteria 3602
104 Ga0207684_10000814 3300025910 Bacteria 36067
105 Ga0207684_10008097 3300025910 Bacteria 9369
106 Ga0207684_10061598 3300025910 Bacteria 3187
107 Ga0207693_10003885 3300025915 Bacteria 12728
108 Ga0207663_10007580 3300025916 Bacteria 5633
109 Ga0207646_10002678 3300025922 Bacteria 20880
110 Ga0207646_10007452 3300025922 Bacteria 11119
111 Ga0207646_10047793 3300025922 Bacteria 3837
112 Ga0207646_10135290 3300025922 Unclassified 2219
113 Ga0207646_10293024 3300025922 Unclassified 1470
114 Ga0207646_10362438 3300025922 Bacteria 1309
115 Ga0207700_10359292 3300025928 Bacteria 1270
116 Ga0207664_10078899 3300025929 Bacteria 2671
117 Ga0207686_10095505 3300025934 Bacteria 1973
118 Ga0207709_10199500 3300025935 Bacteria 1428
119 Ga0207669_10072898 3300025937 Bacteria 2164
120 Ga0207704_10033122 3300025938 Bacteria 2935
121 Ga0207665_10133361 3300025939 Bacteria 1765
122 Ga0207665_11077625 3300025939 Bacteria 640
123 Ga0207712_10400086 3300025961 Unclassified 1154
124 Ga0207703_10061517 3300026035 Unclassified 3074
125 Ga0207708_10014395 3300026075 Bacteria 5919
126 Ga0207675_100088453 3300026118 Bacteria 2909
127 Ga0209998_10001088 3300027717 Bacteria 6793
128 Ga0209974_10002598 3300027876 Bacteria 6562
129 Ga0207428_10242956 3300027907 Unclassified 1345
130 Ga0268265_10303774 3300028380 Bacteria 1438
131 Ga0268265_10330693 3300028380 Unclassified 1384
132 Ga0268264_10233325 3300028381 Bacteria 1700
133 Ga0265326_10005294 3300028558 Bacteria 4069
134 Ga0265319_1001079 3300028563 Bacteria 16950
135 Ga0265319_1007895 3300028563 Bacteria 4726
136 Ga0265334_10047854 3300028573 Bacteria 1648
137 Ga0265318_10011908 3300028577 Bacteria 3721
138 Ga0265318_10016423 3300028577 Bacteria 3059
139 Ga0265322_10010350 3300028654 Bacteria 2704
140 Ga0265322_10015404 3300028654 Bacteria 2210
141 Ga0265336_10005911 3300028666 Bacteria 4465
142 Ga0265336_10018642 3300028666 Unclassified 2247
143 Ga0265338_10007485 3300028800 Bacteria 13531
144 Ga0265324_10001241 3300029957 Bacteria 15072
145 Ga0265324_10004495 3300029957 Bacteria 6273
146 Ga0265332_10205182 3300031238 Bacteria 819
147 Ga0265328_10043139 3300031239 Unclassified 1659
148 Ga0265320_10001148 3300031240 Bacteria 19482
149 Ga0265320_10151627 3300031240 Bacteria 1047
150 Ga0265325_10023608 3300031241 Bacteria 3354
151 Ga0265325_10042267 3300031241 Bacteria 2384
152 Ga0265329_10007865 3300031242 Bacteria 4086
153 Ga0265329_10010559 3300031242 Bacteria 3383
154 Ga0265340_10000349 3300031247 Bacteria 24662
155 Ga0265340_10018007 3300031247 Bacteria 3651
156 Ga0265339_10004153 3300031249 Bacteria 9960
157 Ga0265339_10228581 3300031249 Bacteria 907
158 Ga0265331_10006626 3300031250 Bacteria 6814
159 Ga0265316_10009118 3300031344 Bacteria 9140
160 Ga0265316_10023434 3300031344 Bacteria 5186
161 Ga0265316_10040209 3300031344 Bacteria 3750
162 Ga0265316_10075887 3300031344 Bacteria 2584
163 Ga0307513_10196485 3300031456 Bacteria 1863
164 Ga0307408_100137450 3300031548 Bacteria 1914
165 Ga0265313_10130939 3300031595 Unclassified 1087
166 Ga0265314_10002376 3300031711 Bacteria 19388
167 Ga0265314_10028888 3300031711 Bacteria 4127
168 Ga0265342_10007068 3300031712 Bacteria 8273
169 Ga0265342_10089480 3300031712 Bacteria 1767
170 Ga0307416_100374035 3300032002 Unclassified 1452
171 Ga0307414_10235372 3300032004 Bacteria 1513
172 Ga0307411_10032945 3300032005 Bacteria 3208
173 Ga0373943_0406464 3300035170 Unclassified 787
174 Ga0373935_0452992 3300035692 Unclassified 927
175 Ga0373947_0033722 3300035725 Bacteria 3025
176 Ga0373937_0771585 3300036401 Unclassified 909
177 Ga0395900_0770977 3300037418 Bacteria 891
178 Ga0395898_1225332 3300037466 Bacteria 681
179 Ga0395901_0409309 3300038443 Unclassified 1393
180 Ga0439461_0018001 3300041410 Bacteria 1379
181 Ga0451853_0439426 3300041512 Bacteria 1036
182 Ga0451853_3382729 3300041512 Bacteria 974
183 Ga0439434_0123155 3300042435 Unclassified 847
184 Ga0466961_0145756 3300044693 Bacteria 1481
185 Ga0466963_0637062 3300044694 Bacteria 752
186 Ga0466957_0225827 3300044842 Bacteria 1238
187 Ga0466967_0567088 3300045976 Bacteria 1118
188 Ga0495603_0080142 3300046455 Bacteria 1913
189 Ga0495629_0003451 3300046459 Bacteria 11950
190 Ga0495653_0397284 3300046463 Bacteria 877
191 Ga0495580_0372757 3300046472 Unclassified 965
192 Ga0495582_0000026 3300046473 Bacteria 81238
193 Ga0495639_0007239 3300046475 Bacteria 4763
194 Ga0495594_0153412 3300046499 Unclassified 1308
195 Ga0495665_0003794 3300046531 Bacteria 8179
196 Ga0495656_0341083 3300046615 Bacteria 775
197 Ga0495634_0413940 3300046642 Unclassified 799
198 Ga0495613_0001827 3300046689 Bacteria 16172
199 Ga0495581_0002514 3300047315 Bacteria 10405
200 Ga0495674_0040851 3300047319 Bacteria 4146
201 Ga0495674_0702642 3300047319 Unclassified 793
202 Ga0495676_0072093 3300047321 Bacteria 2653
203 Ga0496100_0235677 3300048903 Bacteria 1348
204 Ga0496102_0006133 3300048905 Bacteria 10242
205 Ga0496102_0064849 3300048905 Bacteria 3347
206 Ga0496102_0319812 3300048905 Unclassified 1462
207 Ga0496104_0036172 3300048907 Bacteria 4614
208 Ga0496104_0094221 3300048907 Bacteria 2864
209 Ga0496104_0094776 3300048907 Bacteria 2855
210 Ga0496105_0064856 3300048908 Bacteria 3014
211 Ga0496106_0006685 3300048909 Bacteria 8537
212 Ga0496107_0095485 3300048910 Bacteria 2175
213 Ga0496108_0003289 3300048911 Bacteria 12983
214 Ga0496108_0015894 3300048911 Bacteria 6135
215 Ga0496108_0108555 3300048911 Unclassified 2371
216 Ga0496109_0037733 3300048912 Unclassified 4366
217 Ga0496109_0083898 3300048912 Bacteria 2938
218 Ga0496110_0044709 3300048913 Unclassified 3868
219 Ga0496111_0030476 3300048914 Bacteria 3836
220 Ga0496111_0058445 3300048914 Bacteria 2792
221 Ga0496112_0134344 3300048915 Bacteria 2444
222 Ga0496112_0291407 3300048915 Bacteria 1578
223 Ga0496112_0561703 3300048915 Bacteria 1075
224 Ga0496113_0077975 3300048916 Bacteria 2534
225 Ga0496114_0000830 3300048917 Bacteria 23184
226 Ga0496114_0031945 3300048917 Bacteria 4331
227 Ga0496114_0041489 3300048917 Bacteria 3814
228 Ga0496114_0079692 3300048917 Bacteria 2765
229 Ga0496114_0841638 3300048917 Unclassified 797
230 Ga0496115_0049342 3300048918 Bacteria 3369
231 Ga0496124_0054753 3300048927 Bacteria 3375
232 Ga0501031_0038356 3300049568 Bacteria 3127
233 Ga0501031_0274985 3300049568 Bacteria 1093
234 Ga0501036_0031727 3300049572 Bacteria 4464
235 Ga0501036_0539928 3300049572 Bacteria 969
236 Ga0501037_0047981 3300049573 Bacteria 3130
237 Ga0501038_0203558 3300049574 Bacteria 1587
238 Ga0501039_0046216 3300049575 Bacteria 3363
239 Ga0501039_0558247 3300049575 Bacteria 898
240 Ga0501040_0030431 3300049576 Bacteria 3646
241 Ga0501040_0037472 3300049576 Bacteria 3294
242 Ga0501040_0584600 3300049576 Bacteria 806
243 Ga0501041_0026325 3300049577 Bacteria 3498
244 Ga0501042_0240749 3300049578 Bacteria 1305
245 Ga0501043_0269540 3300049579 Bacteria 1307
246 Ga0501046_0116479 3300049580 Bacteria 2036
247 Ga0501046_0178619 3300049580 Unclassified 1588
248 Ga0501048_0132787 3300049582 Unclassified 1759
249 Ga0501067_0001704 3300049583 Bacteria 12095
250 Ga0501067_0061087 3300049583 Bacteria 2086
251 Ga0501068_0090032 3300049584 Bacteria 1892
252 Ga0501071_0016053 3300049587 Bacteria 5145
253 Ga0501071_0054986 3300049587 Bacteria 2873
254 Ga0501071_0552419 3300049587 Bacteria 884
255 Ga0501072_0059264 3300049588 Bacteria 3018
256 Ga0501072_0321712 3300049588 Bacteria 1229
257 Ga0501073_0036988 3300049589 Bacteria 3467
258 Ga0501074_0060901 3300049590 Bacteria 2719
259 Ga0501074_0140510 3300049590 Bacteria 1727
260 Ga0501074_0214881 3300049590 Unclassified 1370
261 Ga0501075_0019494 3300049591 Bacteria 4921
262 Ga0501075_0083239 3300049591 Bacteria 2423
263 Ga0501076_0076067 3300049592 Bacteria 2692
264 Ga0501076_0121290 3300049592 Bacteria 2117
265 Ga0501076_0137032 3300049592 Unclassified 1987
266 Ga0501076_0146131 3300049592 Unclassified 1922
267 Ga0501076_0478063 3300049592 Bacteria 1026
268 Ga0501076_0787564 3300049592 Bacteria 784
269 Ga0501077_0259329 3300049593 Bacteria 1106
270 Ga0501077_0309931 3300049593 Bacteria 1006
271 Ga0501079_0038667 3300049741 Bacteria 3680
272 Ga0501079_0057720 3300049741 Bacteria 2994
273 Ga0501079_0270557 3300049741 Bacteria 1328
274 Ga0501079_0288942 3300049741 Bacteria 1282
275 Ga0501080_0423222 3300049742 Bacteria 1196
276 Ga0501081_0042945 3300049743 Bacteria 3099
277 Ga0501083_0063560 3300049744 Bacteria 2462
278 Ga0501083_0670712 3300049744 Bacteria 674
279 Ga0501035_0080481 3300049822 Bacteria 2876
280 Ga0501035_0242086 3300049822 Bacteria 1534
281 Ga0501045_0067963 3300049824 Bacteria 2617
282 Ga0501045_0081965 3300049824 Bacteria 2379
283 Ga0501045_0091669 3300049824 Bacteria 2246
284 Ga0501045_0269341 3300049824 Bacteria 1268
285 nmdc:mga05p37_13_c1 3300050507 Bacteria 139062
286 nmdc:mga05p37_53172_c1 3300050507 Bacteria 4981
287 nmdc:mga05p37_69698_c1 3300050507 Bacteria 4325
288 nmdc:mga05p37_835161_c1 3300050507 Bacteria 1003
289 nmdc:mga09592_4322_c1 3300050508 Bacteria 11476
290 nmdc:mga06r32_17845_c1 3300050510 Bacteria 6485
291 nmdc:mga06r32_483612_c1 3300050510 Bacteria 1216
292 nmdc:mga08y16_683572_c1 3300050511 Bacteria 1028
293 nmdc:mga0n895_513718_c1 3300050512 Bacteria 1206
294 nmdc:mga0n895_80322_c1 3300050512 Bacteria 3249
295 nmdc:mga0rr50_283646_c1 3300050513 Unclassified 1382
296 nmdc:mga08x19_837875_c1 3300050514 Bacteria 653
297 nmdc:mga0a205_302750_c1 3300050515 Bacteria 1471
298 nmdc:mga0a205_503734_c1 3300050515 Bacteria 1067
299 nmdc:mga0a205_719703_c1 3300050515 Unclassified 848
300 Ga0495601_0635012 3300053077 Bacteria 684
301 Ga0495612_0000229 3300053078 Bacteria 23739
302 Ga0501084_0095025 3300054114 Bacteria 2503
303 Ga0501084_0107691 3300054114 Bacteria 2341
304 Ga0501084_0155067 3300054114 Bacteria 1931
305 Ga0501084_0280686 3300054114 Bacteria 1406
306 Ga0501082_0194004 3300060353 Bacteria 1766
307 Ga0501082_0222593 3300060353 Bacteria 1642
308 Ga0501082_0222898 3300060353 Bacteria 1641
309 Ga0501082_0224766 3300060353 Bacteria 1633
310 Ga0501082_0449481 3300060353 Bacteria 1126
311 Ga0501082_0534271 3300060353 Bacteria 1025
312 Ga0530510_0002650 3300061734 Bacteria 12302
313 Ga0530510_0232314 3300061734 Unclassified 1372
314 Ga0530510_0340140 3300061734 Bacteria 1126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0225827 Ga0466957_0225827_13_465 141
2 3300046642 Ga0495634_0413940 Ga0495634_0413940_143_658 163
3 3300044694 Ga0466963_0637062 Ga0466963_0637062_40_564 164
4 3300049593 Ga0501077_0309931 Ga0501077_0309931_85_675 167
5 3300048927 Ga0496124_0054753 Ga0496124_0054753_122_685 168
6 3300005435 Ga0070714_100008408 Ga0070714_1000084088 169
7 3300005466 Ga0070685_10134453 Ga0070685_101344531 169
8 3300006173 Ga0070716_101261801 Ga0070716_1012618011 169
9 3300006175 Ga0070712_100005542 Ga0070712_1000055423 169
10 3300006914 Ga0075436_100640265 Ga0075436_1006402651 169
11 3300025898 Ga0207692_10012944 Ga0207692_100129446 169
12 3300025915 Ga0207693_10003885 Ga0207693_100038859 169
13 3300025916 Ga0207663_10007580 Ga0207663_100075807 169
14 3300025928 Ga0207700_10359292 Ga0207700_103592922 169
15 3300025929 Ga0207664_10078899 Ga0207664_100788992 169
16 3300025939 Ga0207665_11077625 Ga0207665_110776251 169
17 3300035692 Ga0373935_0452992 Ga0373935_0452992_267_818 169
18 3300035725 Ga0373947_0033722 Ga0373947_0033722_334_885 169
19 3300045976 Ga0466967_0567088 Ga0466967_0567088_23_544 169
20 3300046459 Ga0495629_0003451 Ga0495629_0003451_1639_2190 169
21 3300046463 Ga0495653_0397284 Ga0495653_0397284_100_621 169
22 3300046472 Ga0495580_0372757 Ga0495580_0372757_121_672 169
23 3300046473 Ga0495582_0000026 Ga0495582_0000026_26294_26845 169
24 3300046475 Ga0495639_0007239 Ga0495639_0007239_3779_4330 169
25 3300046499 Ga0495594_0153412 Ga0495594_0153412_228_779 169
26 3300046531 Ga0495665_0003794 Ga0495665_0003794_1482_2033 169
27 3300046689 Ga0495613_0001827 Ga0495613_0001827_493_1044 169
28 3300047315 Ga0495581_0002514 Ga0495581_0002514_5423_5974 169
29 3300047319 Ga0495674_0040851 Ga0495674_0040851_3338_3859 169
30 3300047319 Ga0495674_0702642 Ga0495674_0702642_118_669 169
31 3300047321 Ga0495676_0072093 Ga0495676_0072093_485_1036 169
32 3300048905 Ga0496102_0064849 Ga0496102_0064849_659_1180 169
33 3300048917 Ga0496114_0041489 Ga0496114_0041489_710_1231 169
34 3300048918 Ga0496115_0049342 Ga0496115_0049342_2685_3236 169
35 3300050514 nmdc:mga08x19_837875_c1 nmdc:mga08x19_837875_c1_85_636 169
36 3300053077 Ga0495601_0635012 Ga0495601_0635012_101_622 169
37 3300005468 Ga0070707_100605464 Ga0070707_1006054641 170
38 3300005471 Ga0070698_100138555 Ga0070698_1001385553 170
39 3300046455 Ga0495603_0080142 Ga0495603_0080142_1304_1858 172
40 3300005438 Ga0070701_10076271 Ga0070701_100762712 173
41 3300011119 Ga0105246_10501387 Ga0105246_105013872 173
42 3300014325 Ga0163163_10522440 Ga0163163_105224402 173
43 3300041512 Ga0451853_3382729 Ga0451853_3382729_377_916 173
44 3300049568 Ga0501031_0038356 Ga0501031_0038356_357_902 173
45 3300049574 Ga0501038_0203558 Ga0501038_0203558_389_934 173
46 3300049575 Ga0501039_0046216 Ga0501039_0046216_1764_2309 173
47 3300049576 Ga0501040_0030431 Ga0501040_0030431_973_1518 173
48 3300049577 Ga0501041_0026325 Ga0501041_0026325_354_899 173
49 3300049578 Ga0501042_0240749 Ga0501042_0240749_469_1014 173
50 3300049579 Ga0501043_0269540 Ga0501043_0269540_284_829 173
51 3300049580 Ga0501046_0178619 Ga0501046_0178619_283_828 173
52 3300049582 Ga0501048_0132787 Ga0501048_0132787_749_1294 173
53 3300049587 Ga0501071_0016053 Ga0501071_0016053_550_1095 173
54 3300049588 Ga0501072_0059264 Ga0501072_0059264_2036_2581 173
55 3300049590 Ga0501074_0060901 Ga0501074_0060901_953_1498 173
56 3300049591 Ga0501075_0019494 Ga0501075_0019494_2106_2651 173
57 3300049592 Ga0501076_0146131 Ga0501076_0146131_437_982 173
58 3300049593 Ga0501077_0259329 Ga0501077_0259329_270_815 173
59 3300049741 Ga0501079_0057720 Ga0501079_0057720_2036_2581 173
60 3300049743 Ga0501081_0042945 Ga0501081_0042945_2170_2715 173
61 3300049822 Ga0501035_0080481 Ga0501035_0080481_547_1092 173
62 3300049824 Ga0501045_0067963 Ga0501045_0067963_1792_2337 173
63 3300054114 Ga0501084_0280686 Ga0501084_0280686_391_936 173
64 3300060353 Ga0501082_0224766 Ga0501082_0224766_563_1108 173
65 3300031456 Ga0307513_10196485 Ga0307513_101964853 174
66 3300049572 Ga0501036_0031727 Ga0501036_0031727_563_1117 174
67 3300049573 Ga0501037_0047981 Ga0501037_0047981_1511_2065 174
68 3300049575 Ga0501039_0558247 Ga0501039_0558247_160_714 174
69 3300049576 Ga0501040_0037472 Ga0501040_0037472_1307_1861 174
70 3300049580 Ga0501046_0116479 Ga0501046_0116479_359_913 174
71 3300049587 Ga0501071_0552419 Ga0501071_0552419_113_667 174
72 3300049590 Ga0501074_0140510 Ga0501074_0140510_908_1462 174
73 3300049591 Ga0501075_0083239 Ga0501075_0083239_81_635 174
74 3300049592 Ga0501076_0787564 Ga0501076_0787564_68_622 174
75 3300049741 Ga0501079_0038667 Ga0501079_0038667_1960_2514 174
76 3300049744 Ga0501083_0063560 Ga0501083_0063560_1630_2184 174
77 3300049822 Ga0501035_0242086 Ga0501035_0242086_124_678 174
78 3300049824 Ga0501045_0091669 Ga0501045_0091669_1256_1810 174
79 3300054114 Ga0501084_0107691 Ga0501084_0107691_1337_1891 174
80 3300060353 Ga0501082_0194004 Ga0501082_0194004_1045_1599 174
81 3300061734 Ga0530510_0340140 Ga0530510_0340140_162_716 174
82 3300049741 Ga0501079_0288942 Ga0501079_0288942_433_963 175
83 3300005468 Ga0070707_100167416 Ga0070707_1001674163 177
84 3300005329 Ga0070683_100003584 Ga0070683_1000035842 178
85 3300006871 Ga0075434_100508999 Ga0075434_1005089992 178
86 3300028558 Ga0265326_10005294 Ga0265326_100052943 178
87 3300028563 Ga0265319_1007895 Ga0265319_10078955 178
88 3300028573 Ga0265334_10047854 Ga0265334_100478542 178
89 3300028577 Ga0265318_10011908 Ga0265318_100119083 178
90 3300029957 Ga0265324_10004495 Ga0265324_100044955 178
91 3300031241 Ga0265325_10042267 Ga0265325_100422672 178
92 3300031247 Ga0265340_10018007 Ga0265340_100180073 178
93 3300031344 Ga0265316_10040209 Ga0265316_100402093 178
94 3300031711 Ga0265314_10028888 Ga0265314_100288883 178
95 3300031712 Ga0265342_10089480 Ga0265342_100894802 178
96 3300032005 Ga0307411_10032945 Ga0307411_100329452 178
97 3300044693 Ga0466961_0145756 Ga0466961_0145756_114_734 178
98 3300050515 nmdc:mga0a205_503734_c1 nmdc:mga0a205_503734_c1_194_745 178
99 3300005543 Ga0070672_100668609 Ga0070672_1006686092 179
100 3300005719 Ga0068861_100261962 Ga0068861_1002619622 179
101 3300005844 Ga0068862_100958337 Ga0068862_1009583372 179
102 3300005937 Ga0081455_10489772 Ga0081455_104897721 179
103 3300009147 Ga0114129_10051258 Ga0114129_100512583 179
104 3300009147 Ga0114129_11217958 Ga0114129_112179582 179
105 3300009553 Ga0105249_10399450 Ga0105249_103994502 179
106 3300025961 Ga0207712_10400086 Ga0207712_104000861 179
107 3300026075 Ga0207708_10014395 Ga0207708_100143952 179
108 3300026118 Ga0207675_100088453 Ga0207675_1000884534 179
109 3300027717 Ga0209998_10001088 Ga0209998_100010886 179
110 3300027876 Ga0209974_10002598 Ga0209974_100025982 179
111 3300027907 Ga0207428_10242956 Ga0207428_102429562 179
112 3300028380 Ga0268265_10330693 Ga0268265_103306932 179
113 3300032004 Ga0307414_10235372 Ga0307414_102353722 179
114 3300049589 Ga0501073_0036988 Ga0501073_0036988_2851_3393 179
115 3300049592 Ga0501076_0137032 Ga0501076_0137032_1434_1976 179
116 3300050511 nmdc:mga08y16_683572_c1 nmdc:mga08y16_683572_c1_115_657 179
117 3300005328 Ga0070676_10406680 Ga0070676_104066801 180
118 3300005437 Ga0070710_10108205 Ga0070710_101082051 181
119 3300005471 Ga0070698_101043955 Ga0070698_1010439551 181
120 3300006844 Ga0075428_100089069 Ga0075428_1000890693 181
121 3300006847 Ga0075431_100425241 Ga0075431_1004252412 181
122 3300009147 Ga0114129_10001365 Ga0114129_1000136532 181
123 3300041512 Ga0451853_0439426 Ga0451853_0439426_23_589 181
124 3300048903 Ga0496100_0235677 Ga0496100_0235677_67_633 181
125 3300048907 Ga0496104_0094776 Ga0496104_0094776_1071_1637 181
126 3300048911 Ga0496108_0015894 Ga0496108_0015894_3272_3838 181
127 3300048912 Ga0496109_0037733 Ga0496109_0037733_785_1351 181
128 3300048913 Ga0496110_0044709 Ga0496110_0044709_1105_1671 181
129 3300048914 Ga0496111_0058445 Ga0496111_0058445_1201_1767 181
130 3300048917 Ga0496114_0000830 Ga0496114_0000830_20243_20809 181
131 3300050507 nmdc:mga05p37_13_c1 nmdc:mga05p37_13_c1_2421_2990 181
132 3300050510 nmdc:mga06r32_483612_c1 nmdc:mga06r32_483612_c1_504_1073 181
133 3300005471 Ga0070698_100091618 Ga0070698_1000916182 182
134 3300014325 Ga0163163_10117522 Ga0163163_101175222 182
135 3300014325 Ga0163163_10202629 Ga0163163_102026292 182
136 3300026035 Ga0207703_10061517 Ga0207703_100615172 182
137 3300036401 Ga0373937_0771585 Ga0373937_0771585_119_685 182
138 3300048905 Ga0496102_0319812 Ga0496102_0319812_327_893 182
139 3300048907 Ga0496104_0036172 Ga0496104_0036172_2540_3106 182
140 3300048911 Ga0496108_0108555 Ga0496108_0108555_856_1422 182
141 3300048914 Ga0496111_0030476 Ga0496111_0030476_1230_1796 182
142 3300048915 Ga0496112_0291407 Ga0496112_0291407_521_1081 182
143 3300048915 Ga0496112_0561703 Ga0496112_0561703_343_909 182
144 3300048917 Ga0496114_0031945 Ga0496114_0031945_1413_1979 182
145 3300049576 Ga0501040_0584600 Ga0501040_0584600_190_741 182
146 3300049592 Ga0501076_0076067 Ga0501076_0076067_1695_2246 182
147 3300049744 Ga0501083_0670712 Ga0501083_0670712_23_574 182
148 3300054114 Ga0501084_0095025 Ga0501084_0095025_1665_2216 182
149 3300060353 Ga0501082_0222898 Ga0501082_0222898_731_1282 182
150 3300005471 Ga0070698_100298472 Ga0070698_1002984722 183
151 3300031238 Ga0265332_10205182 Ga0265332_102051821 184
152 3300031242 Ga0265329_10010559 Ga0265329_100105592 184
153 3300031344 Ga0265316_10023434 Ga0265316_100234343 184
154 3300031712 Ga0265342_10007068 Ga0265342_100070685 184
155 3300005536 Ga0070697_100038215 Ga0070697_1000382153 185
156 3300028654 Ga0265322_10015404 Ga0265322_100154042 185
157 3300028666 Ga0265336_10005911 Ga0265336_100059113 185
158 3300031344 Ga0265316_10075887 Ga0265316_100758873 185
159 3300032002 Ga0307416_100374035 Ga0307416_1003740352 185
160 3300005343 Ga0070687_100489989 Ga0070687_1004899892 187
161 3300005440 Ga0070705_100029913 Ga0070705_1000299132 187
162 3300005440 Ga0070705_100042221 Ga0070705_1000422213 187
163 3300005444 Ga0070694_100020387 Ga0070694_1000203873 187
164 3300005444 Ga0070694_100269185 Ga0070694_1002691851 187
165 3300005445 Ga0070708_100000353 Ga0070708_10000035325 187
166 3300005445 Ga0070708_100061925 Ga0070708_1000619252 187
167 3300005445 Ga0070708_100145679 Ga0070708_1001456792 187
168 3300005445 Ga0070708_100170755 Ga0070708_1001707552 187
169 3300005458 Ga0070681_10574790 Ga0070681_105747902 187
170 3300005467 Ga0070706_100000142 Ga0070706_10000014250 187
171 3300005467 Ga0070706_100012459 Ga0070706_1000124593 187
172 3300005468 Ga0070707_100001758 Ga0070707_1000017585 187
173 3300005468 Ga0070707_100440490 Ga0070707_1004404902 187
174 3300005471 Ga0070698_100101752 Ga0070698_1001017522 187
175 3300005471 Ga0070698_100233921 Ga0070698_1002339212 187
176 3300005536 Ga0070697_100023986 Ga0070697_1000239862 187
177 3300005545 Ga0070695_100002968 Ga0070695_1000029684 187
178 3300005545 Ga0070695_100073024 Ga0070695_1000730242 187
179 3300005545 Ga0070695_100143890 Ga0070695_1001438901 187
180 3300005546 Ga0070696_100002993 Ga0070696_1000029934 187
181 3300005546 Ga0070696_100013263 Ga0070696_1000132634 187
182 3300005549 Ga0070704_100305836 Ga0070704_1003058362 187
183 3300005563 Ga0068855_100920699 Ga0068855_1009206991 187
184 3300005843 Ga0068860_100030104 Ga0068860_1000301042 187
185 3300005843 Ga0068860_100182602 Ga0068860_1001826022 187
186 3300006173 Ga0070716_100554593 Ga0070716_1005545931 187
187 3300006852 Ga0075433_10084724 Ga0075433_100847243 187
188 3300009147 Ga0114129_11702650 Ga0114129_117026501 187
189 3300009174 Ga0105241_10650469 Ga0105241_106504691 187
190 3300009553 Ga0105249_10571789 Ga0105249_105717892 187
191 3300025885 Ga0207653_10026415 Ga0207653_100264152 187
192 3300025910 Ga0207684_10000814 Ga0207684_1000081414 187
193 3300025910 Ga0207684_10008097 Ga0207684_100080973 187
194 3300025922 Ga0207646_10002678 Ga0207646_1000267813 187
195 3300025922 Ga0207646_10007452 Ga0207646_100074529 187
196 3300025922 Ga0207646_10047793 Ga0207646_100477933 187
197 3300025922 Ga0207646_10135290 Ga0207646_101352902 187
198 3300025922 Ga0207646_10293024 Ga0207646_102930241 187
199 3300025934 Ga0207686_10095505 Ga0207686_100955052 187
200 3300025939 Ga0207665_10133361 Ga0207665_101333612 187
201 3300028380 Ga0268265_10303774 Ga0268265_103037742 187
202 3300028381 Ga0268264_10233325 Ga0268264_102333252 187
203 3300048905 Ga0496102_0006133 Ga0496102_0006133_824_1414 187
204 3300048909 Ga0496106_0006685 Ga0496106_0006685_7576_8166 187
205 3300048910 Ga0496107_0095485 Ga0496107_0095485_11_601 187
206 3300053078 Ga0495612_0000229 Ga0495612_0000229_10839_11429 187
207 3300060353 Ga0501082_0449481 Ga0501082_0449481_305_886 187
208 3300005445 Ga0070708_100027166 Ga0070708_1000271666 188
209 3300005467 Ga0070706_100092395 Ga0070706_1000923953 188
210 3300005518 Ga0070699_100980419 Ga0070699_1009804191 188
211 3300005937 Ga0081455_10211136 Ga0081455_102111362 188
212 3300006847 Ga0075431_100021392 Ga0075431_1000213923 188
213 3300006852 Ga0075433_10142888 Ga0075433_101428882 188
214 3300006852 Ga0075433_10369500 Ga0075433_103695002 188
215 3300006871 Ga0075434_100080157 Ga0075434_1000801572 188
216 3300006880 Ga0075429_100004698 Ga0075429_1000046988 188
217 3300006914 Ga0075436_100094870 Ga0075436_1000948702 188
218 3300007076 Ga0075435_100126499 Ga0075435_1001264992 188
219 3300009098 Ga0105245_10141983 Ga0105245_101419833 188
220 3300009147 Ga0114129_10001898 Ga0114129_1000189823 188
221 3300009147 Ga0114129_11040220 Ga0114129_110402202 188
222 3300025910 Ga0207684_10061598 Ga0207684_100615983 188
223 3300025922 Ga0207646_10362438 Ga0207646_103624382 188
224 3300028563 Ga0265319_1001079 Ga0265319_10010792 188
225 3300028577 Ga0265318_10016423 Ga0265318_100164234 188
226 3300028654 Ga0265322_10010350 Ga0265322_100103502 188
227 3300028666 Ga0265336_10018642 Ga0265336_100186422 188
228 3300028800 Ga0265338_10007485 Ga0265338_1000748513 188
229 3300029957 Ga0265324_10001241 Ga0265324_1000124113 188
230 3300031239 Ga0265328_10043139 Ga0265328_100431392 188
231 3300031240 Ga0265320_10001148 Ga0265320_100011489 188
232 3300031240 Ga0265320_10151627 Ga0265320_101516271 188
233 3300031241 Ga0265325_10023608 Ga0265325_100236082 188
234 3300031242 Ga0265329_10007865 Ga0265329_100078654 188
235 3300031247 Ga0265340_10000349 Ga0265340_1000034912 188
236 3300031249 Ga0265339_10004153 Ga0265339_100041538 188
237 3300031249 Ga0265339_10228581 Ga0265339_102285811 188
238 3300031250 Ga0265331_10006626 Ga0265331_100066262 188
239 3300031344 Ga0265316_10009118 Ga0265316_1000911810 188
240 3300031595 Ga0265313_10130939 Ga0265313_101309392 188
241 3300031711 Ga0265314_10002376 Ga0265314_1000237614 188
242 3300038443 Ga0395901_0409309 Ga0395901_0409309_739_1308 188
243 3300041410 Ga0439461_0018001 Ga0439461_0018001_177_767 188
244 3300048907 Ga0496104_0094221 Ga0496104_0094221_990_1583 188
245 3300048908 Ga0496105_0064856 Ga0496105_0064856_921_1514 188
246 3300048911 Ga0496108_0003289 Ga0496108_0003289_9839_10432 188
247 3300048912 Ga0496109_0083898 Ga0496109_0083898_2182_2775 188
248 3300048915 Ga0496112_0134344 Ga0496112_0134344_258_851 188
249 3300048916 Ga0496113_0077975 Ga0496113_0077975_137_730 188
250 3300048917 Ga0496114_0841638 Ga0496114_0841638_50_643 188
251 3300049592 Ga0501076_0121290 Ga0501076_0121290_720_1289 188
252 3300050507 nmdc:mga05p37_53172_c1 nmdc:mga05p37_53172_c1_1293_1862 188
253 3300050508 nmdc:mga09592_4322_c1 nmdc:mga09592_4322_c1_1765_2334 188
254 3300050510 nmdc:mga06r32_17845_c1 nmdc:mga06r32_17845_c1_4309_4878 188
255 3300050512 nmdc:mga0n895_513718_c1 nmdc:mga0n895_513718_c1_457_1026 188
256 3300050515 nmdc:mga0a205_302750_c1 nmdc:mga0a205_302750_c1_389_958 188
257 3300050515 nmdc:mga0a205_719703_c1 nmdc:mga0a205_719703_c1_116_685 188
258 3300005445 Ga0070708_100613951 Ga0070708_1006139512 189
259 3300005564 Ga0070664_100515057 Ga0070664_1005150572 189
260 3300005842 Ga0068858_100921077 Ga0068858_1009210772 189
261 3300005985 Ga0081539_10003127 Ga0081539_1000312712 189
262 3300009147 Ga0114129_10016516 Ga0114129_100165164 189
263 3300014325 Ga0163163_10047866 Ga0163163_100478662 189
264 3300014968 Ga0157379_10115922 Ga0157379_101159223 189
265 3300035170 Ga0373943_0406464 Ga0373943_0406464_75_671 189
266 3300042435 Ga0439434_0123155 Ga0439434_0123155_181_777 189
267 3300046615 Ga0495656_0341083 Ga0495656_0341083_176_757 189
268 3300049568 Ga0501031_0274985 Ga0501031_0274985_53_634 189
269 3300049587 Ga0501071_0054986 Ga0501071_0054986_1800_2381 189
270 3300049588 Ga0501072_0321712 Ga0501072_0321712_152_733 189
271 3300049590 Ga0501074_0214881 Ga0501074_0214881_100_681 189
272 3300049592 Ga0501076_0478063 Ga0501076_0478063_151_732 189
273 3300049741 Ga0501079_0270557 Ga0501079_0270557_197_778 189
274 3300049742 Ga0501080_0423222 Ga0501080_0423222_408_989 189
275 3300049824 Ga0501045_0081965 Ga0501045_0081965_801_1382 189
276 3300050507 nmdc:mga05p37_69698_c1 nmdc:mga05p37_69698_c1_106_687 189
277 3300054114 Ga0501084_0155067 Ga0501084_0155067_594_1175 189
278 3300060353 Ga0501082_0222593 Ga0501082_0222593_677_1258 189
279 3300060353 Ga0501082_0534271 Ga0501082_0534271_78_659 189
280 3300061734 Ga0530510_0002650 Ga0530510_0002650_9434_10015 189
281 3300005471 Ga0070698_100287506 Ga0070698_1002875062 190
282 3300005518 Ga0070699_100583992 Ga0070699_1005839922 190
283 3300006871 Ga0075434_100413402 Ga0075434_1004134022 190
284 3300009147 Ga0114129_10464269 Ga0114129_104642692 190
285 3300031548 Ga0307408_100137450 Ga0307408_1001374502 190
286 3300037418 Ga0395900_0770977 Ga0395900_0770977_42_629 190
287 3300037466 Ga0395898_1225332 Ga0395898_1225332_49_651 190
288 3300049583 Ga0501067_0061087 Ga0501067_0061087_65_649 190
289 3300050507 nmdc:mga05p37_835161_c1 nmdc:mga05p37_835161_c1_163_756 190
290 3300061734 Ga0530510_0232314 Ga0530510_0232314_517_1101 190
291 3300005356 Ga0070674_100004030 Ga0070674_1000040303 191
292 3300005445 Ga0070708_100086446 Ga0070708_1000864462 191
293 3300005518 Ga0070699_100288109 Ga0070699_1002881091 191
294 3300006914 Ga0075436_100431961 Ga0075436_1004319612 191
295 3300007076 Ga0075435_100524034 Ga0075435_1005240342 191
296 3300009148 Ga0105243_10417480 Ga0105243_104174802 191
297 3300025935 Ga0207709_10199500 Ga0207709_101995002 191
298 3300025937 Ga0207669_10072898 Ga0207669_100728983 191
299 3300025938 Ga0207704_10033122 Ga0207704_100331222 191
300 3300048917 Ga0496114_0079692 Ga0496114_0079692_1908_2507 191
301 3300050512 nmdc:mga0n895_80322_c1 nmdc:mga0n895_80322_c1_2218_2805 191
302 3300050513 nmdc:mga0rr50_283646_c1 nmdc:mga0rr50_283646_c1_721_1308 191
303 3300005467 Ga0070706_100182842 Ga0070706_1001828422 192
304 3300005468 Ga0070707_100460499 Ga0070707_1004604991 192
305 3300005471 Ga0070698_100140164 Ga0070698_1001401642 192
306 3300005518 Ga0070699_100351740 Ga0070699_1003517401 192
307 3300005546 Ga0070696_100031482 Ga0070696_1000314822 192
308 3300005546 Ga0070696_100324606 Ga0070696_1003246062 192
309 3300049572 Ga0501036_0539928 Ga0501036_0539928_143_763 193
310 3300049583 Ga0501067_0001704 Ga0501067_0001704_10943_11539 193
311 3300049584 Ga0501068_0090032 Ga0501068_0090032_1021_1617 193
312 3300049824 Ga0501045_0269341 Ga0501045_0269341_455_1075 193
313 3300003320 rootH2_10101966 rootH2_101019662 194
314 3300003323 rootH1_10203378 rootH1_102033782 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

24

205

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9336 55 138
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9323 55 138
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.9318 55 138
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9309 55 138
1uij-assembly2.cif.gz_D crystal structure of soybean beta-conglycinin beta homotrimer (i122m/k124w) 0.9209 55 139
ID Description Score Start End Superfamily
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9027 55 139 2.60.120.10
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9019 55 139 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8994 55 138 2.60.120.10
af_Q9FLT3_18_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8923 55 139 2.60.120.10
af_I1L9C7_24_223_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8893 55 139 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536GHR4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9905 7 189 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A535J2Z9-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.9854 7 190 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A522PR87-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.965 8 189 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F8S2H5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9641 20 193 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A524J1C4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9596 8 194 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
94.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map