F402148

General Info

Members Datasets Scaffolds Average Seq Length
313 190 626 89

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_13248291|Ga0111539_132482911
Length 106
Sequence LTVLKGASIVAPLTAGHKTAMRICSITKARPTKGSVIHRRGLAKKKGGIGQHVTKVVPRTFAPNLRTRRLWVSELNRYVTVKLTARALKTANKNGVFNTLKKAGIV

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
190 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 2.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 1.6
Rhizosphere 88.82
Stem 0
Stem Tuber 0
Unclassified 34.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_13248291 3300009094 Unclassified 524
2 JGI24743J22301_10000661 3300001991 Bacteria 4222
3 JGI24745J21846_1036550 3300002073 Unclassified 602
4 JGI24033J26618_1000171 3300002155 Bacteria 7975
5 rootH2_10006532 3300003320 Bacteria 52667
6 rootL2_10038150 3300003322 Bacteria 1064
7 rootL2_10141114 3300003322 Bacteria 1209
8 rootL2_10288358 3300003322 Bacteria 1646
9 rootH1_10024926 3300003323 Bacteria 30664
10 Ga0055530_10006337 3300003791 Bacteria 5313
11 Ga0065704_10312564 3300005289 Unclassified 866
12 Ga0065707_10991520 3300005295 Unclassified 541
13 Ga0070658_10001007 3300005327 Bacteria 24128
14 Ga0070658_10168844 3300005327 Bacteria 1837
15 Ga0070676_10686179 3300005328 Unclassified 747
16 Ga0070690_100872102 3300005330 Unclassified 702
17 Ga0070666_10691735 3300005335 Unclassified 747
18 Ga0068868_102379622 3300005338 Unclassified 506
19 Ga0070660_100407941 3300005339 Bacteria 1124
20 Ga0070689_100502208 3300005340 Unclassified 1039
21 Ga0070661_100000526 3300005344 Bacteria 29379
22 Ga0070669_100849940 3300005353 Unclassified 778
23 Ga0070671_100435295 3300005355 Unclassified 1124
24 Ga0070671_100660654 3300005355 Bacteria 905
25 Ga0070674_100224469 3300005356 Bacteria 1463
26 Ga0070673_100842048 3300005364 Unclassified 848
27 Ga0070659_100026340 3300005366 Bacteria 4474
28 Ga0070659_100453863 3300005366 Bacteria 1088
29 Ga0070709_10021558 3300005434 Bacteria 3754
30 Ga0070709_10921995 3300005434 Unclassified 692
31 Ga0070714_100090165 3300005435 Bacteria 2685
32 Ga0070713_100108815 3300005436 Bacteria 2414
33 Ga0070713_100237728 3300005436 Bacteria 1658
34 Ga0070713_100947576 3300005436 Bacteria 829
35 Ga0070678_100009076 3300005456 Bacteria 5997
36 Ga0070678_100171273 3300005456 Bacteria 1769
37 Ga0070662_101562648 3300005457 Unclassified 569
38 Ga0070706_100043057 3300005467 Bacteria 4171
39 Ga0070706_100248254 3300005467 Unclassified 1662
40 Ga0070706_101198224 3300005467 Unclassified 698
41 Ga0070698_101015987 3300005471 Unclassified 777
42 Ga0070699_100136185 3300005518 Bacteria 2166
43 Ga0070699_101115565 3300005518 Unclassified 723
44 Ga0070699_101302863 3300005518 Unclassified 666
45 Ga0070697_100009360 3300005536 Bacteria 7654
46 Ga0070697_100063574 3300005536 Bacteria 3013
47 Ga0068853_100269764 3300005539 Bacteria 1567
48 Ga0070672_100162283 3300005543 Bacteria 1855
49 Ga0070665_100207303 3300005548 Bacteria 1961
50 Ga0070665_100931965 3300005548 Bacteria 881
51 Ga0068855_100004252 3300005563 Bacteria 17488
52 Ga0068855_100611574 3300005563 Bacteria 1174
53 Ga0070664_100889301 3300005564 Unclassified 835
54 Ga0068854_101840334 3300005578 Unclassified 556
55 Ga0068856_100001504 3300005614 Bacteria 24417
56 Ga0068856_101809966 3300005614 Unclassified 622
57 Ga0068852_100404399 3300005616 Bacteria 1344
58 Ga0068852_101370844 3300005616 Unclassified 729
59 Ga0068852_101474221 3300005616 Unclassified 703
60 Ga0068859_100261251 3300005617 Bacteria 1823
61 Ga0068861_100381681 3300005719 Bacteria 1245
62 Ga0068861_102336994 3300005719 Unclassified 537
63 Ga0068851_10411389 3300005834 Bacteria 797
64 Ga0068863_100461198 3300005841 Bacteria 1248
65 Ga0068863_101520750 3300005841 Bacteria 678
66 Ga0068863_101772223 3300005841 Unclassified 627
67 Ga0068858_100023332 3300005842 Bacteria 5765
68 Ga0068858_100064155 3300005842 Bacteria 3399
69 Ga0068858_100953870 3300005842 Unclassified 840
70 Ga0068858_102275011 3300005842 Unclassified 536
71 Ga0068860_100107530 3300005843 Bacteria 2666
72 Ga0068862_101293152 3300005844 Unclassified 730
73 Ga0081538_10046534 3300005981 Bacteria 2674
74 Ga0081540_1086550 3300005983 Bacteria 1392
75 Ga0070717_10148893 3300006028 Bacteria 2024
76 Ga0070717_10434409 3300006028 Bacteria 1182
77 Ga0070715_10067589 3300006163 Bacteria 1587
78 Ga0070716_100207643 3300006173 Bacteria 1306
79 Ga0070716_100284810 3300006173 Bacteria 1142
80 Ga0070716_100468448 3300006173 Bacteria 922
81 Ga0070712_100061507 3300006175 Bacteria 2653
82 Ga0070712_100115707 3300006175 Bacteria 2010
83 Ga0075366_10337443 3300006195 Bacteria 924
84 Ga0097621_100502539 3300006237 Unclassified 1098
85 Ga0075370_10022317 3300006353 Unclassified 3475
86 Ga0068871_100218135 3300006358 Bacteria 1652
87 Ga0068871_100320727 3300006358 Unclassified 1364
88 Ga0068871_100787388 3300006358 Bacteria 876
89 Ga0097620_100261261 3300006931 Bacteria 1823
90 Ga0099795_10404735 3300007788 Bacteria 621
91 Ga0105240_10000007 3300009093 Bacteria 619357
92 Ga0105240_10167167 3300009093 Bacteria 2608
93 Ga0111539_11248867 3300009094 Bacteria 862
94 Ga0105241_10580664 3300009174 Bacteria 1010
95 Ga0105241_11598501 3300009174 Unclassified 630
96 Ga0105248_13362587 3300009177 Unclassified 508
97 Ga0105237_10000479 3300009545 Bacteria 56807
98 Ga0105237_10059726 3300009545 Bacteria 3814
99 Ga0105237_10486553 3300009545 Bacteria 1240
100 Ga0105237_10900004 3300009545 Bacteria 892
101 Ga0105237_11262527 3300009545 Bacteria 745
102 Ga0105238_10156350 3300009551 Bacteria 2255
103 Ga0099796_10144769 3300010159 Unclassified 931
104 Ga0099796_10577484 3300010159 Bacteria 506
105 Ga0105239_10153549 3300010375 Bacteria 2570
106 Ga0105239_10472352 3300010375 Bacteria 1424
107 Ga0157370_10433034 3300013104 Bacteria 1209
108 Ga0157370_10768048 3300013104 Bacteria 878
109 Ga0157369_11600877 3300013105 Bacteria 662
110 Ga0157374_11021278 3300013296 Bacteria 846
111 Ga0157378_10754397 3300013297 Unclassified 996
112 Ga0157378_11235359 3300013297 Unclassified 787
113 Ga0157378_12398415 3300013297 Bacteria 579
114 Ga0163162_10210697 3300013306 Bacteria 2073
115 Ga0163162_10354284 3300013306 Bacteria 1600
116 Ga0163162_12582742 3300013306 Bacteria 584
117 Ga0157372_10413940 3300013307 Bacteria 1571
118 Ga0157375_11724574 3300013308 Unclassified 742
119 Ga0157377_11109254 3300014745 Unclassified 607
120 Ga0157379_11440022 3300014968 Bacteria 669
121 Ga0163161_10762656 3300017792 Bacteria 810
122 Ga0163161_11847602 3300017792 Bacteria 538
123 Ga0213873_10006640 3300021358 Bacteria 2286
124 Ga0213872_10038332 3300021361 Bacteria 2188
125 Ga0213872_10075027 3300021361 Unclassified 1522
126 Ga0213872_10090858 3300021361 Bacteria 1366
127 Ga0213872_10104009 3300021361 Bacteria 1264
128 Ga0213872_10150783 3300021361 Bacteria 1016
129 Ga0213872_10213065 3300021361 Unclassified 824
130 Ga0213876_10000896 3300021384 Bacteria 19899
131 Ga0213876_10004823 3300021384 Bacteria 7483
132 Ga0213876_10142463 3300021384 Bacteria 1275
133 Ga0213876_10182786 3300021384 Bacteria 1115
134 Ga0213871_10025152 3300021441 Bacteria 1514
135 Ga0213871_10074427 3300021441 Unclassified 964
136 Ga0224712_10490844 3300022467 Unclassified 593
137 Ga0207673_1006159 3300025290 Unclassified 1479
138 Ga0207697_10001975 3300025315 Bacteria 10866
139 Ga0207692_10104512 3300025898 Bacteria 1561
140 Ga0207688_10047385 3300025901 Bacteria 2400
141 Ga0207680_10216954 3300025903 Bacteria 1310
142 Ga0207647_10492317 3300025904 Unclassified 684
143 Ga0207685_10422158 3300025905 Unclassified 688
144 Ga0207699_10258075 3300025906 Unclassified 1204
145 Ga0207645_10001061 3300025907 Bacteria 22746
146 Ga0207705_10087443 3300025909 Bacteria 2279
147 Ga0207705_10139248 3300025909 Bacteria 1811
148 Ga0207705_10482925 3300025909 Bacteria 962
149 Ga0207684_10000732 3300025910 Bacteria 38532
150 Ga0207684_10015933 3300025910 Bacteria 6459
151 Ga0207684_10017705 3300025910 Bacteria 6113
152 Ga0207684_10070193 3300025910 Unclassified 2977
153 Ga0207684_11252187 3300025910 Unclassified 612
154 Ga0207684_11730981 3300025910 Unclassified 503
155 Ga0207695_10000099 3300025913 Bacteria 259595
156 Ga0207671_10002064 3300025914 Bacteria 21984
157 Ga0207671_10984079 3300025914 Bacteria 665
158 Ga0207693_10008150 3300025915 Bacteria 8587
159 Ga0207693_10130469 3300025915 Bacteria 1976
160 Ga0207693_10266815 3300025915 Unclassified 1342
161 Ga0207693_10385447 3300025915 Bacteria 1096
162 Ga0207662_10002029 3300025918 Bacteria 10020
163 Ga0207657_10188004 3300025919 Unclassified 1667
164 Ga0207657_10378284 3300025919 Bacteria 1115
165 Ga0207657_10456983 3300025919 Bacteria 1002
166 Ga0207649_10001662 3300025920 Bacteria 12864
167 Ga0207649_10940854 3300025920 Bacteria 678
168 Ga0207646_10000594 3300025922 Bacteria 47141
169 Ga0207646_10024830 3300025922 Bacteria 5485
170 Ga0207646_10043842 3300025922 Unclassified 4015
171 Ga0207646_10051643 3300025922 Bacteria 3678
172 Ga0207646_10124619 3300025922 Bacteria 2316
173 Ga0207646_10196217 3300025922 Bacteria 1823
174 Ga0207646_10669337 3300025922 Unclassified 929
175 Ga0207681_10229704 3300025923 Unclassified 1439
176 Ga0207694_10119198 3300025924 Bacteria 2106
177 Ga0207650_10314963 3300025925 Unclassified 1280
178 Ga0207659_10099633 3300025926 Unclassified 2188
179 Ga0207659_10440200 3300025926 Bacteria 1096
180 Ga0207659_10636680 3300025926 Unclassified 911
181 Ga0207687_10115160 3300025927 Unclassified 2002
182 Ga0207687_11214495 3300025927 Bacteria 648
183 Ga0207700_10147858 3300025928 Bacteria 1939
184 Ga0207700_10256095 3300025928 Bacteria 1497
185 Ga0207700_10557214 3300025928 Unclassified 1018
186 Ga0207664_10153407 3300025929 Bacteria 1959
187 Ga0207644_11790656 3300025931 Bacteria 514
188 Ga0207690_10110796 3300025932 Unclassified 1977
189 Ga0207690_10326116 3300025932 Bacteria 1208
190 Ga0207706_10000683 3300025933 Bacteria 35576
191 Ga0207686_11182373 3300025934 Unclassified 626
192 Ga0207709_10342978 3300025935 Bacteria 1125
193 Ga0207670_10015302 3300025936 Bacteria 4581
194 Ga0207670_10566328 3300025936 Bacteria 930
195 Ga0207670_10643015 3300025936 Unclassified 874
196 Ga0207669_10877585 3300025937 Bacteria 748
197 Ga0207669_10959045 3300025937 Bacteria 717
198 Ga0207704_10743684 3300025938 Unclassified 815
199 Ga0207665_10364057 3300025939 Bacteria 1094
200 Ga0207665_10520896 3300025939 Unclassified 921
201 Ga0207665_10848527 3300025939 Unclassified 723
202 Ga0207665_10856110 3300025939 Bacteria 720
203 Ga0207691_10128279 3300025940 Bacteria 2242
204 Ga0207691_10459490 3300025940 Bacteria 1083
205 Ga0207689_10230406 3300025942 Unclassified 1531
206 Ga0207667_10010257 3300025949 Bacteria 10967
207 Ga0207667_10421439 3300025949 Bacteria 1358
208 Ga0207668_10063918 3300025972 Unclassified 2598
209 Ga0207668_10224585 3300025972 Bacteria 1510
210 Ga0207640_10989024 3300025981 Unclassified 739
211 Ga0207658_10230344 3300025986 Bacteria 1564
212 Ga0207658_10310115 3300025986 Unclassified 1362
213 Ga0207677_10192974 3300026023 Unclassified 1612
214 Ga0207703_10018129 3300026035 Bacteria 5498
215 Ga0207703_10100802 3300026035 Bacteria 2447
216 Ga0207703_10459347 3300026035 Unclassified 1191
217 Ga0207639_10335358 3300026041 Bacteria 1347
218 Ga0207678_10835311 3300026067 Unclassified 814
219 Ga0207702_10003148 3300026078 Bacteria 15278
220 Ga0207702_10452607 3300026078 Bacteria 1246
221 Ga0207641_10324471 3300026088 Bacteria 1461
222 Ga0207641_11805106 3300026088 Unclassified 613
223 Ga0207676_11751633 3300026095 Bacteria 620
224 Ga0207674_10698175 3300026116 Unclassified 979
225 Ga0207674_11241436 3300026116 Unclassified 715
226 Ga0207675_100501663 3300026118 Bacteria 1208
227 Ga0207683_10039174 3300026121 Bacteria 4134
228 Ga0207683_10456412 3300026121 Unclassified 1178
229 Ga0207698_12176558 3300026142 Unclassified 567
230 Ga0268266_10126134 3300028379 Bacteria 2285
231 Ga0268266_10671017 3300028379 Bacteria 998
232 Ga0268265_10053033 3300028380 Bacteria 3071
233 Ga0268265_10814365 3300028380 Bacteria 911
234 Ga0268265_11186778 3300028380 Unclassified 760
235 Ga0268265_11247084 3300028380 Unclassified 742
236 Ga0268264_10040759 3300028381 Bacteria 3837
237 Ga0268264_10992411 3300028381 Unclassified 846
238 Ga0307414_10144101 3300032004 Bacteria 1869
239 Ga0307414_12219977 3300032004 Unclassified 513
240 Ga0373925_1566104 3300037068 Unclassified 539
241 Ga0395899_0057121 3300037312 Unclassified 2882
242 Ga0395900_0074508 3300037418 Unclassified 3489
243 Ga0395900_0234971 3300037418 Bacteria 1842
244 Ga0395900_0324175 3300037418 Bacteria 1520
245 Ga0395898_0031659 3300037466 Bacteria 5283
246 Ga0395898_0616530 3300037466 Bacteria 1028
247 Ga0395898_0967463 3300037466 Bacteria 788
248 Ga0395905_0010612 3300037471 Bacteria 8943
249 Ga0395905_0192852 3300037471 Bacteria 1911
250 Ga0395905_1169362 3300037471 Bacteria 673
251 Ga0436364_0251773 3300037853 Bacteria 1476
252 Ga0436364_0559911 3300037853 Bacteria 663
253 Ga0436364_1042313 3300037853 Unclassified 580
254 Ga0436364_1454052 3300037853 Unclassified 705
255 Ga0436364_1550033 3300037853 Bacteria 552
256 Ga0395901_0016956 3300038443 Bacteria 7423
257 Ga0436365_0709130 3300039437 Bacteria 46894
258 Ga0436365_1470169 3300039437 Bacteria 1214
259 Ga0436365_1522355 3300039437 Unclassified 654
260 Ga0436365_1540867 3300039437 Bacteria 1817
261 Ga0436365_1727431 3300039437 Bacteria 1871
262 Ga0436360_0214935 3300039438 Bacteria 2134
263 Ga0436360_0608503 3300039438 Bacteria 3882
264 Ga0436360_1232571 3300039438 Bacteria 7976
265 Ga0436361_0372220 3300039447 Unclassified 700
266 Ga0436361_0560168 3300039447 Bacteria 2174
267 Ga0436362_0292837 3300039453 Bacteria 759
268 Ga0451787_261832 3300041441 Unclassified 634
269 Ga0451789_0876051 3300041443 Bacteria 561
270 Ga0451839_0478535 3300041496 Unclassified 574
271 Ga0451839_1568543 3300041496 Unclassified 587
272 Ga0453683_0150599 3300044673 Bacteria 1470
273 Ga0466957_0091532 3300044842 Bacteria 1906
274 Ga0451576_0119362 3300045051 Bacteria 2745
275 Ga0466967_2339624 3300045976 Bacteria 530
276 Ga0495617_233170 3300046452 Unclassified 570
277 Ga0495643_0000114 3300046522 Bacteria 131108
278 Ga0496100_0143411 3300048903 Bacteria 1696
279 Ga0496102_1247201 3300048905 Unclassified 663
280 Ga0496115_0015187 3300048918 Bacteria 5837
281 Ga0496124_0669694 3300048927 Unclassified 663
282 Ga0496125_0000327 3300048928 Bacteria 91831
283 Ga0501305_088402 3300049161 Unclassified 564
284 Ga0501307_064070 3300049162 Unclassified 575
285 Ga0501315_103895 3300049531 Unclassified 504
286 Ga0501321_078110 3300049537 Unclassified 524
287 Ga0501323_050274 3300049539 Unclassified 631
288 Ga0501031_0002385 3300049568 Bacteria 11934
289 Ga0501033_0000525 3300049570 Bacteria 35862
290 Ga0501036_0058371 3300049572 Bacteria 3269
291 Ga0501037_0000080 3300049573 Bacteria 87262
292 Ga0501038_0027838 3300049574 Bacteria 5023
293 Ga0501039_0010805 3300049575 Bacteria 6954
294 Ga0501043_0002161 3300049579 Bacteria 16769
295 Ga0501047_0008385 3300049581 Bacteria 9754
296 Ga0501068_1027846 3300049584 Unclassified 544
297 Ga0501069_0431585 3300049585 Bacteria 782
298 Ga0501070_0002389 3300049586 Bacteria 16464
299 Ga0501070_0228451 3300049586 Bacteria 1525
300 Ga0501074_1192865 3300049590 Unclassified 534
301 Ga0501240_126308 3300049673 Unclassified 508
302 Ga0501080_0031998 3300049742 Bacteria 4904
303 Ga0501080_0677387 3300049742 Bacteria 911
304 Ga0501035_0000001 3300049822 Bacteria 1037138
305 Ga0501044_0000567 3300049823 Bacteria 44979
306 Ga0501045_0673674 3300049824 Unclassified 764
307 nmdc:mga03683_49558_c1 3300050489 Bacteria 1749
308 nmdc:mga0k408_384076_c1 3300050493 Bacteria 836
309 nmdc:mga08y16_2031219_c1 3300050511 Unclassified 524
310 nmdc:mga08x19_97424_c1 3300050514 Unclassified 1947
311 Ga0500559_0262675 3300053136 Bacteria 813
312 Ga0500645_015121 3300053730 Bacteria 2449
313 Ga0587077_160694 3300059493 Unclassified 594
314 Ga0111539_13248291
315 JGI24743J22301_10000661
316 JGI24745J21846_1036550
317 JGI24033J26618_1000171
318 rootH2_10006532
319 rootL2_10038150
320 rootL2_10141114
321 rootL2_10288358
322 rootH1_10024926
323 Ga0055530_10006337
324 Ga0065704_10312564
325 Ga0065707_10991520
326 Ga0070658_10001007
327 Ga0070658_10168844
328 Ga0070676_10686179
329 Ga0070690_100872102
330 Ga0070666_10691735
331 Ga0068868_102379622
332 Ga0070660_100407941
333 Ga0070689_100502208
334 Ga0070661_100000526
335 Ga0070669_100849940
336 Ga0070671_100435295
337 Ga0070671_100660654
338 Ga0070674_100224469
339 Ga0070673_100842048
340 Ga0070659_100026340
341 Ga0070659_100453863
342 Ga0070709_10021558
343 Ga0070709_10921995
344 Ga0070714_100090165
345 Ga0070713_100108815
346 Ga0070713_100237728
347 Ga0070713_100947576
348 Ga0070678_100009076
349 Ga0070678_100171273
350 Ga0070662_101562648
351 Ga0070706_100043057
352 Ga0070706_100248254
353 Ga0070706_101198224
354 Ga0070698_101015987
355 Ga0070699_100136185
356 Ga0070699_101115565
357 Ga0070699_101302863
358 Ga0070697_100009360
359 Ga0070697_100063574
360 Ga0068853_100269764
361 Ga0070672_100162283
362 Ga0070665_100207303
363 Ga0070665_100931965
364 Ga0068855_100004252
365 Ga0068855_100611574
366 Ga0070664_100889301
367 Ga0068854_101840334
368 Ga0068856_100001504
369 Ga0068856_101809966
370 Ga0068852_100404399
371 Ga0068852_101370844
372 Ga0068852_101474221
373 Ga0068859_100261251
374 Ga0068861_100381681
375 Ga0068861_102336994
376 Ga0068851_10411389
377 Ga0068863_100461198
378 Ga0068863_101520750
379 Ga0068863_101772223
380 Ga0068858_100023332
381 Ga0068858_100064155
382 Ga0068858_100953870
383 Ga0068858_102275011
384 Ga0068860_100107530
385 Ga0068862_101293152
386 Ga0081538_10046534
387 Ga0081540_1086550
388 Ga0070717_10148893
389 Ga0070717_10434409
390 Ga0070715_10067589
391 Ga0070716_100207643
392 Ga0070716_100284810
393 Ga0070716_100468448
394 Ga0070712_100061507
395 Ga0070712_100115707
396 Ga0075366_10337443
397 Ga0097621_100502539
398 Ga0075370_10022317
399 Ga0068871_100218135
400 Ga0068871_100320727
401 Ga0068871_100787388
402 Ga0097620_100261261
403 Ga0099795_10404735
404 Ga0105240_10000007
405 Ga0105240_10167167
406 Ga0111539_11248867
407 Ga0105241_10580664
408 Ga0105241_11598501
409 Ga0105248_13362587
410 Ga0105237_10000479
411 Ga0105237_10059726
412 Ga0105237_10486553
413 Ga0105237_10900004
414 Ga0105237_11262527
415 Ga0105238_10156350
416 Ga0099796_10144769
417 Ga0099796_10577484
418 Ga0105239_10153549
419 Ga0105239_10472352
420 Ga0157370_10433034
421 Ga0157370_10768048
422 Ga0157369_11600877
423 Ga0157374_11021278
424 Ga0157378_10754397
425 Ga0157378_11235359
426 Ga0157378_12398415
427 Ga0163162_10210697
428 Ga0163162_10354284
429 Ga0163162_12582742
430 Ga0157372_10413940
431 Ga0157375_11724574
432 Ga0157377_11109254
433 Ga0157379_11440022
434 Ga0163161_10762656
435 Ga0163161_11847602
436 Ga0213873_10006640
437 Ga0213872_10038332
438 Ga0213872_10075027
439 Ga0213872_10090858
440 Ga0213872_10104009
441 Ga0213872_10150783
442 Ga0213872_10213065
443 Ga0213876_10000896
444 Ga0213876_10004823
445 Ga0213876_10142463
446 Ga0213876_10182786
447 Ga0213871_10025152
448 Ga0213871_10074427
449 Ga0224712_10490844
450 Ga0207673_1006159
451 Ga0207697_10001975
452 Ga0207692_10104512
453 Ga0207688_10047385
454 Ga0207680_10216954
455 Ga0207647_10492317
456 Ga0207685_10422158
457 Ga0207699_10258075
458 Ga0207645_10001061
459 Ga0207705_10087443
460 Ga0207705_10139248
461 Ga0207705_10482925
462 Ga0207684_10000732
463 Ga0207684_10015933
464 Ga0207684_10017705
465 Ga0207684_10070193
466 Ga0207684_11252187
467 Ga0207684_11730981
468 Ga0207695_10000099
469 Ga0207671_10002064
470 Ga0207671_10984079
471 Ga0207693_10008150
472 Ga0207693_10130469
473 Ga0207693_10266815
474 Ga0207693_10385447
475 Ga0207662_10002029
476 Ga0207657_10188004
477 Ga0207657_10378284
478 Ga0207657_10456983
479 Ga0207649_10001662
480 Ga0207649_10940854
481 Ga0207646_10000594
482 Ga0207646_10024830
483 Ga0207646_10043842
484 Ga0207646_10051643
485 Ga0207646_10124619
486 Ga0207646_10196217
487 Ga0207646_10669337
488 Ga0207681_10229704
489 Ga0207694_10119198
490 Ga0207650_10314963
491 Ga0207659_10099633
492 Ga0207659_10440200
493 Ga0207659_10636680
494 Ga0207687_10115160
495 Ga0207687_11214495
496 Ga0207700_10147858
497 Ga0207700_10256095
498 Ga0207700_10557214
499 Ga0207664_10153407
500 Ga0207644_11790656
501 Ga0207690_10110796
502 Ga0207690_10326116
503 Ga0207706_10000683
504 Ga0207686_11182373
505 Ga0207709_10342978
506 Ga0207670_10015302
507 Ga0207670_10566328
508 Ga0207670_10643015
509 Ga0207669_10877585
510 Ga0207669_10959045
511 Ga0207704_10743684
512 Ga0207665_10364057
513 Ga0207665_10520896
514 Ga0207665_10848527
515 Ga0207665_10856110
516 Ga0207691_10128279
517 Ga0207691_10459490
518 Ga0207689_10230406
519 Ga0207667_10010257
520 Ga0207667_10421439
521 Ga0207668_10063918
522 Ga0207668_10224585
523 Ga0207640_10989024
524 Ga0207658_10230344
525 Ga0207658_10310115
526 Ga0207677_10192974
527 Ga0207703_10018129
528 Ga0207703_10100802
529 Ga0207703_10459347
530 Ga0207639_10335358
531 Ga0207678_10835311
532 Ga0207702_10003148
533 Ga0207702_10452607
534 Ga0207641_10324471
535 Ga0207641_11805106
536 Ga0207676_11751633
537 Ga0207674_10698175
538 Ga0207674_11241436
539 Ga0207675_100501663
540 Ga0207683_10039174
541 Ga0207683_10456412
542 Ga0207698_12176558
543 Ga0268266_10126134
544 Ga0268266_10671017
545 Ga0268265_10053033
546 Ga0268265_10814365
547 Ga0268265_11186778
548 Ga0268265_11247084
549 Ga0268264_10040759
550 Ga0268264_10992411
551 Ga0307414_10144101
552 Ga0307414_12219977
553 Ga0373925_1566104
554 Ga0395899_0057121
555 Ga0395900_0074508
556 Ga0395900_0234971
557 Ga0395900_0324175
558 Ga0395898_0031659
559 Ga0395898_0616530
560 Ga0395898_0967463
561 Ga0395905_0010612
562 Ga0395905_0192852
563 Ga0395905_1169362
564 Ga0436364_0251773
565 Ga0436364_0559911
566 Ga0436364_1042313
567 Ga0436364_1454052
568 Ga0436364_1550033
569 Ga0395901_0016956
570 Ga0436365_0709130
571 Ga0436365_1470169
572 Ga0436365_1522355
573 Ga0436365_1540867
574 Ga0436365_1727431
575 Ga0436360_0214935
576 Ga0436360_0608503
577 Ga0436360_1232571
578 Ga0436361_0372220
579 Ga0436361_0560168
580 Ga0436362_0292837
581 Ga0451787_261832
582 Ga0451789_0876051
583 Ga0451839_0478535
584 Ga0451839_1568543
585 Ga0453683_0150599
586 Ga0466957_0091532
587 Ga0451576_0119362
588 Ga0466967_2339624
589 Ga0495617_233170
590 Ga0495643_0000114
591 Ga0496100_0143411
592 Ga0496102_1247201
593 Ga0496115_0015187
594 Ga0496124_0669694
595 Ga0496125_0000327
596 Ga0501305_088402
597 Ga0501307_064070
598 Ga0501315_103895
599 Ga0501321_078110
600 Ga0501323_050274
601 Ga0501031_0002385
602 Ga0501033_0000525
603 Ga0501036_0058371
604 Ga0501037_0000080
605 Ga0501038_0027838
606 Ga0501039_0010805
607 Ga0501043_0002161
608 Ga0501047_0008385
609 Ga0501068_1027846
610 Ga0501069_0431585
611 Ga0501070_0002389
612 Ga0501070_0228451
613 Ga0501074_1192865
614 Ga0501240_126308
615 Ga0501080_0031998
616 Ga0501080_0677387
617 Ga0501035_0000001
618 Ga0501044_0000567
619 Ga0501045_0673674
620 nmdc:mga03683_49558_c1
621 nmdc:mga0k408_384076_c1
622 nmdc:mga08y16_2031219_c1
623 nmdc:mga08x19_97424_c1
624 Ga0500559_0262675
625 Ga0500645_015121
626 Ga0587077_160694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00830

Ribosomal_L28

Ribosomal L28 family

22

94

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_X cryo-em captures early ribosome assembly in action 0.8983 3 86
8c8y-assembly1.cif.gz_X cryo-em captures early ribosome assembly in action 0.8898 3 83
7zta-assembly1.cif.gz_L281 structure of an escherichia coli 70s ribosome stalled by tetracenomycin x during translation of an maaapqk(c) peptide 0.8734 3 83
7jil-assembly1.cif.gz_X 70s ribosome flavobacterium johnsoniae 0.8689 3 85
5mmm-assembly1.cif.gz_Y structure of the 70s chloroplast ribosome 0.8567 3 85
ID Description Score Start End Superfamily
af_A0A1D6KUQ7_65_141_2.30.170.40 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.8418 3 85 2.30.170.40
af_P9WHA9_2_78_2.30.170.40 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.8354 3 85 2.30.170.40
5h1sY00 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.8203 3 85 2.30.170.40
4tovX00 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.8168 3 83 2.30.170.40
5mlcY00 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.7829 3 84 2.30.170.40
ID Description Score Start End GO Terms
AF-A0A2V5L8W0-F1-model_v4 50S ribosomal protein L28 0.9977 40 87 GO:0003735
GO:0005840
GO:1990904
AF-A0A2V5L8W0-F1-model_v4 50S ribosomal protein L28 0.9775 40 87 GO:0003735
GO:0005840
GO:1990904
AF-A0A2V5WBA7-F1-model_v4 50S ribosomal protein L28 0.9695 42 87 GO:0003735
GO:0005840
GO:1990904
AF-A0A4Q3WZ34-F1-model_v4 Large ribosomal subunit protein bL28 0.8976 1 85 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-Q1QT92-F1-model_v4 Large ribosomal subunit protein bL28 (50S ribosomal protein L28) 0.8804 1 85 GO:0003735
GO:0006412
GO:0022625

Map