F402143

General Info

Members Datasets Scaffolds Average Seq Length
313 199 309 240

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001313|Ga0105240_1000131311
Length 286
Sequence MDHNELKSIIINEFPRFFSKCLKNIASQVIILYFDGLNNLLRIKKMEKFTKLSIIVPAYNEAKTIHLILDRVAEVKLLNNIEKELILVNDCSRDATEEVLLAYIKAHPELNMQYYKHEVNMGKGAAIHTGIQKATGDYLIIQDADLEYDPEEFNFLLKPVLRGSADVVFGSRFLGGNSHRILFFWHSIGNKFLTRLSNMLSNLNLTDMETCYKMFKTSIIQNIELKEKRFGFEPEVTAKIARVPNIRIYEVGISYYGRTYEEGKKIGWRDGFRAIYCILKYNLFSK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
4 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
169 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
170 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
171 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
190 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
197 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
198 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.61
Nodule 0
Rhizoplane 0.32
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1012863 3300001904 Bacteria 1354
2 JGI24739J22299_10000783 3300001989 Bacteria 11599
3 JGI25153J46596_10022865 3300003215 Bacteria 2293
4 JGI25153J46596_10023125 3300003215 Bacteria 2272
5 rootH2_10035444 3300003320 Bacteria 12072
6 rootH2_10218750 3300003320 Bacteria 5569
7 rootH1_10125993 3300003323 Bacteria 4204
8 JGI25160J50197_1000942 3300003354 Bacteria 15260
9 Ga0055535_1002199 3300003761 Bacteria 7410
10 Ga0055542_1001463 3300003762 Bacteria 11628
11 Ga0055526_1008965 3300003771 Bacteria 4898
12 Ga0055526_1014523 3300003771 Bacteria 3232
13 Ga0055528_1000317 3300003790 Bacteria 40640
14 Ga0055530_10002416 3300003791 Bacteria 12092
15 Ga0065165_1000225 3300005262 Bacteria 99123
16 Ga0065165_1000572 3300005262 Bacteria 54513
17 Ga0065704_10071523 3300005289 Bacteria 10811
18 Ga0065715_10257149 3300005293 Bacteria 1149
19 Ga0070658_10241109 3300005327 Bacteria 1532
20 Ga0070676_10385962 3300005328 Bacteria 971
21 Ga0070677_10254056 3300005333 Bacteria 874
22 Ga0070666_10194423 3300005335 Bacteria 1426
23 Ga0070680_100003766 3300005336 Bacteria 11335
24 Ga0070682_100008707 3300005337 Bacteria 5724
25 Ga0068868_100073894 3300005338 Bacteria 2722
26 Ga0070689_100005010 3300005340 Bacteria 8998
27 Ga0070691_10011913 3300005341 Bacteria 3980
28 Ga0070675_100034178 3300005354 Bacteria 4125
29 Ga0070675_100034209 3300005354 Bacteria 4123
30 Ga0070674_100111286 3300005356 Bacteria 2011
31 Ga0070673_100045813 3300005364 Bacteria 3394
32 Ga0070673_100279554 3300005364 Bacteria 1464
33 Ga0070673_100649976 3300005364 Bacteria 965
34 Ga0070688_100042445 3300005365 Bacteria 2798
35 Ga0070659_100266105 3300005366 Bacteria 1423
36 Ga0070667_100105364 3300005367 Bacteria 2440
37 Ga0070678_100041238 3300005456 Bacteria 3271
38 Ga0070678_100558110 3300005456 Bacteria 1017
39 Ga0068867_100056628 3300005459 Bacteria 2901
40 Ga0068867_100189388 3300005459 Bacteria 1641
41 Ga0068867_100220275 3300005459 Bacteria 1529
42 Ga0070685_10007106 3300005466 Bacteria 5718
43 Ga0070685_10202244 3300005466 Bacteria 1292
44 Ga0070679_100081253 3300005530 Bacteria 3230
45 Ga0068853_100059019 3300005539 Bacteria 3314
46 Ga0070672_100185156 3300005543 Bacteria 1736
47 Ga0070693_100005903 3300005547 Bacteria 5919
48 Ga0070665_100004489 3300005548 Bacteria 14649
49 Ga0068855_100004564 3300005563 Bacteria 16921
50 Ga0068855_100019922 3300005563 Bacteria 8056
51 Ga0068857_100006415 3300005577 Bacteria 10087
52 Ga0068854_100205662 3300005578 Bacteria 1550
53 Ga0068854_100493176 3300005578 Bacteria 1030
54 Ga0068856_100033809 3300005614 Bacteria 5007
55 Ga0068856_100101246 3300005614 Bacteria 2874
56 Ga0068856_100112704 3300005614 Bacteria 2718
57 Ga0068856_100377961 3300005614 Bacteria 1436
58 Ga0070702_100636665 3300005615 Bacteria 804
59 Ga0068852_100002872 3300005616 Bacteria 11949
60 Ga0068852_100063398 3300005616 Bacteria 3218
61 Ga0068851_10000010 3300005834 Bacteria 202121
62 Ga0068858_100009002 3300005842 Bacteria 9549
63 Ga0068858_100672134 3300005842 Bacteria 1007
64 Ga0068860_100000004 3300005843 Bacteria 506126
65 Ga0068860_100026460 3300005843 Bacteria 5592
66 Ga0068860_100037849 3300005843 Unclassified 4617
67 Ga0068860_100344792 3300005843 Bacteria 1465
68 Ga0075367_10155191 3300006178 Bacteria 1422
69 Ga0075370_10110779 3300006353 Bacteria 1594
70 Ga0068871_100308310 3300006358 Bacteria 1391
71 Ga0105240_10000011 3300009093 Bacteria 523646
72 Ga0105240_10000231 3300009093 Bacteria 110451
73 Ga0105240_10000534 3300009093 Bacteria 70264
74 Ga0105240_10001313 3300009093 Bacteria 42913
75 Ga0105240_10059266 3300009093 Bacteria 4779
76 Ga0105240_10699154 3300009093 Bacteria 1107
77 Ga0105245_10676428 3300009098 Bacteria 1064
78 Ga0114129_11041356 3300009147 Bacteria 1028
79 Ga0105243_10022763 3300009148 Bacteria 4764
80 Ga0105243_10634934 3300009148 Bacteria 1033
81 Ga0105241_10001644 3300009174 Bacteria 17039
82 Ga0105241_10002845 3300009174 Bacteria 12920
83 Ga0105241_10023909 3300009174 Bacteria 4535
84 Ga0105241_10157159 3300009174 Bacteria 1866
85 Ga0105241_10186834 3300009174 Bacteria 1723
86 Ga0105241_10766004 3300009174 Bacteria 886
87 Ga0105242_10006123 3300009176 Bacteria 9271
88 Ga0105242_10236362 3300009176 Bacteria 1640
89 Ga0105248_10163252 3300009177 Bacteria 2512
90 Ga0105237_10000082 3300009545 Bacteria 127340
91 Ga0105237_10002025 3300009545 Bacteria 25778
92 Ga0105237_10004795 3300009545 Bacteria 15538
93 Ga0105237_10013888 3300009545 Bacteria 8427
94 Ga0105237_10070415 3300009545 Bacteria 3494
95 Ga0105238_10002090 3300009551 Bacteria 20163
96 Ga0105238_10011749 3300009551 Bacteria 8825
97 Ga0105238_10054683 3300009551 Bacteria 4008
98 Ga0105238_10426513 3300009551 Bacteria 1321
99 Ga0105238_10753174 3300009551 Bacteria 988
100 Ga0105249_10121911 3300009553 Bacteria 2479
101 Ga0105249_10247664 3300009553 Bacteria 1765
102 Ga0105239_10000122 3300010375 Bacteria 109167
103 Ga0105239_10002348 3300010375 Bacteria 24115
104 Ga0105239_10025253 3300010375 Bacteria 6542
105 Ga0105239_10051809 3300010375 Bacteria 4499
106 Ga0105239_10158942 3300010375 Bacteria 2524
107 Ga0105239_10398225 3300010375 Bacteria 1558
108 Ga0157373_10149538 3300013100 Bacteria 1643
109 Ga0157371_10047892 3300013102 Bacteria 3039
110 Ga0157371_10387710 3300013102 Bacteria 1021
111 Ga0157370_10026720 3300013104 Bacteria 5696
112 Ga0157370_10152592 3300013104 Bacteria 2149
113 Ga0157370_10213147 3300013104 Bacteria 1790
114 Ga0157370_10265176 3300013104 Unclassified 1587
115 Ga0157369_10016662 3300013105 Bacteria 8263
116 Ga0157369_10019658 3300013105 Bacteria 7559
117 Ga0157374_10000025 3300013296 Bacteria 245131
118 Ga0157374_10124619 3300013296 Bacteria 2489
119 Ga0163162_10001183 3300013306 Bacteria 24333
120 Ga0163162_10003125 3300013306 Bacteria 15813
121 Ga0163162_10031057 3300013306 Bacteria 5297
122 Ga0163162_10274888 3300013306 Bacteria 1816
123 Ga0163162_10600585 3300013306 Bacteria 1227
124 Ga0157372_10000255 3300013307 Bacteria 58805
125 Ga0157372_10019917 3300013307 Bacteria 7232
126 Ga0157372_10299996 3300013307 Bacteria 1869
127 Ga0157372_10993958 3300013307 Bacteria 972
128 Ga0157375_10011642 3300013308 Bacteria 7772
129 Ga0163163_10496595 3300014325 Bacteria 1282
130 Ga0163163_11128607 3300014325 Bacteria 847
131 Ga0157380_10001403 3300014326 Bacteria 15741
132 Ga0157380_10075788 3300014326 Bacteria 2735
133 Ga0157380_10236948 3300014326 Bacteria 1643
134 Ga0157380_10517264 3300014326 Bacteria 1163
135 Ga0157379_10072412 3300014968 Bacteria 3083
136 Ga0157376_10000106 3300014969 Bacteria 60118
137 Ga0157376_10140568 3300014969 Bacteria 2165
138 Ga0209258_100288 3300025242 Bacteria 82681
139 Ga0209646_1000003 3300025246 Bacteria 1160860
140 Ga0209026_1000144 3300025250 Bacteria 112177
141 Ga0209148_1000269 3300025254 Bacteria 81695
142 Ga0209673_1000167 3300025273 Bacteria 135172
143 Ga0209676_1000587 3300025292 Bacteria 54532
144 Ga0209564_1005521 3300025295 Bacteria 7168
145 Ga0209564_1006215 3300025295 Bacteria 6522
146 Ga0209564_1011686 3300025295 Bacteria 3907
147 Ga0209758_1006223 3300025297 Bacteria 8711
148 Ga0209758_1008953 3300025297 Bacteria 6343
149 Ga0207426_1001469 3300025302 Bacteria 19419
150 Ga0209051_1049490 3300025303 Bacteria 1415
151 Ga0209257_1020538 3300025304 Unclassified 2437
152 Ga0207656_10015294 3300025321 Unclassified 2968
153 Ga0207682_10046303 3300025893 Bacteria 1787
154 Ga0207642_10352756 3300025899 Bacteria 868
155 Ga0207680_10277424 3300025903 Bacteria 1164
156 Ga0207647_10010089 3300025904 Bacteria 6681
157 Ga0207647_10017033 3300025904 Bacteria 4947
158 Ga0207645_10090704 3300025907 Bacteria 1965
159 Ga0207705_10027581 3300025909 Bacteria 4051
160 Ga0207705_10378085 3300025909 Bacteria 1094
161 Ga0207705_10499713 3300025909 Bacteria 944
162 Ga0207654_10010740 3300025911 Bacteria 4663
163 Ga0207654_10077518 3300025911 Bacteria 1992
164 Ga0207654_10176907 3300025911 Bacteria 1390
165 Ga0207654_10250537 3300025911 Bacteria 1187
166 Ga0207707_10002007 3300025912 Bacteria 18473
167 Ga0207695_10000117 3300025913 Bacteria 237982
168 Ga0207695_10000892 3300025913 Bacteria 54116
169 Ga0207695_10004052 3300025913 Bacteria 20145
170 Ga0207695_10007081 3300025913 Bacteria 14374
171 Ga0207695_10055358 3300025913 Bacteria 4134
172 Ga0207695_10107822 3300025913 Bacteria 2770
173 Ga0207671_10001712 3300025914 Bacteria 24774
174 Ga0207671_10002239 3300025914 Bacteria 20950
175 Ga0207671_10003372 3300025914 Bacteria 15994
176 Ga0207671_10005193 3300025914 Bacteria 12102
177 Ga0207671_10182377 3300025914 Bacteria 1634
178 Ga0207662_10422018 3300025918 Bacteria 908
179 Ga0207657_10482544 3300025919 Bacteria 971
180 Ga0207652_10029941 3300025921 Bacteria 4556
181 Ga0207694_10069343 3300025924 Bacteria 2754
182 Ga0207694_10182974 3300025924 Bacteria 1700
183 Ga0207694_10190962 3300025924 Bacteria 1664
184 Ga0207659_10337443 3300025926 Bacteria 1247
185 Ga0207686_10003216 3300025934 Bacteria 8786
186 Ga0207686_10153004 3300025934 Bacteria 1608
187 Ga0207709_10011211 3300025935 Bacteria 4944
188 Ga0207669_10133587 3300025937 Bacteria 1710
189 Ga0207669_10194827 3300025937 Bacteria 1465
190 Ga0207704_10048883 3300025938 Bacteria 2540
191 Ga0207667_10000133 3300025949 Bacteria 112994
192 Ga0207668_10132993 3300025972 Bacteria 1902
193 Ga0207640_10017247 3300025981 Bacteria 4221
194 Ga0207640_10608558 3300025981 Bacteria 926
195 Ga0207658_10167016 3300025986 Bacteria 1809
196 Ga0207703_10027706 3300026035 Bacteria 4462
197 Ga0207639_10167091 3300026041 Bacteria 1860
198 Ga0207702_10034375 3300026078 Bacteria 4237
199 Ga0207702_10087195 3300026078 Bacteria 2724
200 Ga0207702_10134234 3300026078 Bacteria 2231
201 Ga0207648_10057710 3300026089 Bacteria 3387
202 Ga0207648_10096275 3300026089 Bacteria 2590
203 Ga0207648_10288721 3300026089 Bacteria 1468
204 Ga0207674_10010945 3300026116 Bacteria 10209
205 Ga0207698_10000312 3300026142 Bacteria 29094
206 Ga0207698_10112727 3300026142 Bacteria 2283
207 Ga0207698_10132486 3300026142 Bacteria 2133
208 Ga0268266_10000065 3300028379 Bacteria 246498
209 Ga0268266_10003842 3300028379 Bacteria 14665
210 Ga0268264_10000011 3300028381 Bacteria 580884
211 Ga0268264_10007377 3300028381 Bacteria 9183
212 Ga0268264_10021326 3300028381 Bacteria 5290
213 Ga0268264_10309668 3300028381 Bacteria 1490
214 Ga0307515_10005687 3300028794 Bacteria 25166
215 Ga0265324_10005635 3300029957 Bacteria 5361
216 Ga0265327_10065654 3300031251 Bacteria 1834
217 Ga0307513_10129857 3300031456 Bacteria 2468
218 Ga0307408_100000059 3300031548 Bacteria 134620
219 Ga0307408_100341856 3300031548 Bacteria 1267
220 Ga0307516_10019957 3300031730 Bacteria 6929
221 Ga0307412_10074325 3300031911 Bacteria 2328
222 Ga0307414_10004158 3300032004 Bacteria 7814
223 Ga0307411_10002064 3300032005 Bacteria 8630
224 Ga0307510_10004187 3300033180 Bacteria 16949
225 Ga0373935_0060637 3300035692 Bacteria 2420
226 Ga0373937_0706323 3300036401 Bacteria 955
227 Ga0395901_0231229 3300038443 Bacteria 1930
228 Ga0400483_272307 3300039062 Bacteria 44400
229 Ga0400489_73371 3300039093 Bacteria 1998
230 Ga0439439_0030857 3300041406 Bacteria 1364
231 Ga0439465_0017503 3300041413 Bacteria 2238
232 Ga0451577_0000052 3300042876 Bacteria 291030
233 Ga0451577_0028956 3300042876 Bacteria 5009
234 Ga0466972_0002657 3300044658 Bacteria 8850
235 Ga0466966_0208958 3300044684 Bacteria 1180
236 Ga0453684_0089645 3300044712 Bacteria 3803
237 Ga0453684_0189376 3300044712 Bacteria 2408
238 Ga0453684_0223250 3300044712 Bacteria 2181
239 Ga0466971_0056515 3300044719 Bacteria 1770
240 Ga0466968_0040659 3300044735 Bacteria 1961
241 Ga0466957_0071016 3300044842 Bacteria 2152
242 Ga0466959_0105111 3300045049 Bacteria 2019
243 Ga0466958_0016431 3300045836 Bacteria 4262
244 Ga0495592_0104094 3300046454 Bacteria 2018
245 Ga0495638_0136160 3300046460 Unclassified 1438
246 Ga0495606_0009976 3300046507 Bacteria 7944
247 Ga0495632_0101927 3300046519 Bacteria 1352
248 Ga0495633_0000313 3300046558 Bacteria 55351
249 Ga0495668_0002521 3300046616 Bacteria 14951
250 Ga0495634_0034294 3300046642 Bacteria 3484
251 Ga0495611_0000184 3300046648 Bacteria 44524
252 Ga0495636_0000011 3300047318 Bacteria 87862
253 Ga0495672_0008899 3300047320 Bacteria 7338
254 Ga0495672_0088688 3300047320 Bacteria 1704
255 Ga0495687_000006 3300047443 Bacteria 571936
256 Ga0495684_0242689 3300047471 Unclassified 1313
257 Ga0496115_0309654 3300048918 Bacteria 1293
258 Ga0501034_0348743 3300049571 Bacteria 1409
259 Ga0501046_0186445 3300049580 Bacteria 1549
260 Ga0501047_0005455 3300049581 Bacteria 11968
261 Ga0501047_0047099 3300049581 Bacteria 4166
262 Ga0501068_0058164 3300049584 Bacteria 2345
263 Ga0501069_0001064 3300049585 Bacteria 13167
264 Ga0501070_0001356 3300049586 Bacteria 21938
265 Ga0501073_0000321 3300049589 Bacteria 32033
266 Ga0501074_0000097 3300049590 Bacteria 42311
267 Ga0501223_016205 3300049663 Bacteria 1473
268 Ga0501233_053636 3300049668 Bacteria 983
269 Ga0501238_027085 3300049671 Bacteria 823
270 Ga0501219_000582 3300049703 Bacteria 5351
271 Ga0501225_0048763 3300049705 Bacteria 1177
272 Ga0501225_0053864 3300049705 Bacteria 1124
273 Ga0501079_0010889 3300049741 Bacteria 6926
274 Ga0501080_0004551 3300049742 Bacteria 12361
275 Ga0501083_0001657 3300049744 Bacteria 15192
276 Ga0501241_001365 3300049758 Bacteria 5007
277 Ga0501241_009503 3300049758 Bacteria 1770
278 Ga0501035_0003314 3300049822 Bacteria 15429
279 Ga0501035_0041596 3300049822 Bacteria 4150
280 Ga0501044_0497094 3300049823 Bacteria 1121
281 Ga0501284_00001 3300050005 Bacteria 261916
282 nmdc:mga0k408_193936_c1 3300050493 Bacteria 1212
283 nmdc:mga06z11_129958_c1 3300050494 Bacteria 1413
284 nmdc:mga07m45_21342_c1 3300050496 Bacteria 3525
285 Ga0500646_0002289 3300053090 Bacteria 4991
286 Ga0500583_0000652 3300053092 Bacteria 10276
287 Ga0500583_0004591 3300053092 Bacteria 4522
288 Ga0500651_0032155 3300053093 Bacteria 3307
289 Ga0500651_0076602 3300053093 Bacteria 2077
290 Ga0500569_002817 3300053109 Bacteria 3472
291 Ga0500655_016928 3300053133 Bacteria 1345
292 Ga0500658_0018214 3300053134 Bacteria 2630
293 Ga0500559_0011289 3300053136 Bacteria 3818
294 Ga0500577_0000524 3300053142 Bacteria 9936
295 Ga0500577_0103754 3300053142 Bacteria 1166
296 Ga0500588_0001359 3300053146 Bacteria 4626
297 Ga0500588_0011320 3300053146 Bacteria 2180
298 Ga0500588_0078977 3300053146 Bacteria 1097
299 Ga0500604_0019033 3300053151 Bacteria 1919
300 Ga0500616_0033948 3300053153 Bacteria 2782
301 Ga0500622_0001945 3300053156 Bacteria 15554
302 Ga0500622_0002080 3300053156 Bacteria 14908
303 Ga0500633_0000885 3300053160 Bacteria 5221
304 Ga0500636_0043986 3300053177 Bacteria 2635
305 Ga0500636_0078470 3300053177 Bacteria 1906
306 Ga0500611_000030 3300053727 Bacteria 87128
307 Ga0500645_058315 3300053730 Bacteria 1119
308 Ga0500661_002379 3300055283 Bacteria 3551
309 Ga0501082_0030537 3300060353 Bacteria 4644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100073894 Ga0068868_1000738942 216
2 3300005843 Ga0068860_100026460 Ga0068860_1000264603 216
3 3300009545 Ga0105237_10013888 Ga0105237_100138886 216
4 3300010375 Ga0105239_10025253 Ga0105239_100252533 216
5 3300025914 Ga0207671_10005193 Ga0207671_100051936 216
6 3300028381 Ga0268264_10021326 Ga0268264_100213263 216
7 3300025914 Ga0207671_10001712 Ga0207671_1000171217 218
8 3300009551 Ga0105238_10426513 Ga0105238_104265131 219
9 3300025924 Ga0207694_10182974 Ga0207694_101829742 221
10 3300005578 Ga0068854_100493176 Ga0068854_1004931761 222
11 3300009093 Ga0105240_10000231 Ga0105240_1000023146 222
12 3300009174 Ga0105241_10023909 Ga0105241_100239095 222
13 3300009545 Ga0105237_10000082 Ga0105237_1000008269 222
14 3300009545 Ga0105237_10002025 Ga0105237_100020253 222
15 3300010375 Ga0105239_10002348 Ga0105239_100023488 222
16 3300025913 Ga0207695_10000117 Ga0207695_1000011755 222
17 3300025914 Ga0207671_10002239 Ga0207671_100022393 222
18 3300025981 Ga0207640_10608558 Ga0207640_106085581 222
19 3300005327 Ga0070658_10241109 Ga0070658_102411093 229
20 3300005328 Ga0070676_10385962 Ga0070676_103859621 229
21 3300005340 Ga0070689_100005010 Ga0070689_1000050103 229
22 3300005354 Ga0070675_100034178 Ga0070675_1000341783 229
23 3300005364 Ga0070673_100279554 Ga0070673_1002795542 229
24 3300005456 Ga0070678_100041238 Ga0070678_1000412382 229
25 3300005459 Ga0068867_100189388 Ga0068867_1001893882 229
26 3300005459 Ga0068867_100220275 Ga0068867_1002202753 229
27 3300005615 Ga0070702_100636665 Ga0070702_1006366651 229
28 3300005616 Ga0068852_100063398 Ga0068852_1000633982 229
29 3300005842 Ga0068858_100009002 Ga0068858_1000090025 229
30 3300005843 Ga0068860_100344792 Ga0068860_1003447923 229
31 3300006178 Ga0075367_10155191 Ga0075367_101551912 229
32 3300006353 Ga0075370_10110779 Ga0075370_101107793 229
33 3300009098 Ga0105245_10676428 Ga0105245_106764282 229
34 3300009147 Ga0114129_11041356 Ga0114129_110413562 229
35 3300009148 Ga0105243_10022763 Ga0105243_100227633 229
36 3300009148 Ga0105243_10634934 Ga0105243_106349342 229
37 3300009174 Ga0105241_10157159 Ga0105241_101571592 229
38 3300009176 Ga0105242_10006123 Ga0105242_100061235 229
39 3300009176 Ga0105242_10236362 Ga0105242_102363623 229
40 3300009177 Ga0105248_10163252 Ga0105248_101632522 229
41 3300009551 Ga0105238_10054683 Ga0105238_100546832 229
42 3300009551 Ga0105238_10753174 Ga0105238_107531741 229
43 3300013306 Ga0163162_10274888 Ga0163162_102748882 229
44 3300014326 Ga0157380_10236948 Ga0157380_102369482 229
45 3300014326 Ga0157380_10517264 Ga0157380_105172642 229
46 3300014968 Ga0157379_10072412 Ga0157379_100724123 229
47 3300025899 Ga0207642_10352756 Ga0207642_103527562 229
48 3300025907 Ga0207645_10090704 Ga0207645_100907042 229
49 3300025909 Ga0207705_10027581 Ga0207705_100275812 229
50 3300025909 Ga0207705_10378085 Ga0207705_103780852 229
51 3300025909 Ga0207705_10499713 Ga0207705_104997132 229
52 3300025911 Ga0207654_10077518 Ga0207654_100775181 229
53 3300025918 Ga0207662_10422018 Ga0207662_104220182 229
54 3300025924 Ga0207694_10190962 Ga0207694_101909622 229
55 3300025934 Ga0207686_10003216 Ga0207686_100032165 229
56 3300025934 Ga0207686_10153004 Ga0207686_101530042 229
57 3300025935 Ga0207709_10011211 Ga0207709_100112113 229
58 3300025937 Ga0207669_10194827 Ga0207669_101948273 229
59 3300025938 Ga0207704_10048883 Ga0207704_100488833 229
60 3300026035 Ga0207703_10027706 Ga0207703_100277063 229
61 3300026089 Ga0207648_10096275 Ga0207648_100962753 229
62 3300026089 Ga0207648_10288721 Ga0207648_102887213 229
63 3300026142 Ga0207698_10112727 Ga0207698_101127273 229
64 3300028381 Ga0268264_10309668 Ga0268264_103096682 229
65 3300044684 Ga0466966_0208958 Ga0466966_0208958_250_939 229
66 3300044719 Ga0466971_0056515 Ga0466971_0056515_977_1666 229
67 3300044842 Ga0466957_0071016 Ga0466957_0071016_981_1670 229
68 3300045836 Ga0466958_0016431 Ga0466958_0016431_1485_2174 229
69 3300049580 Ga0501046_0186445 Ga0501046_0186445_550_1239 229
70 3300049581 Ga0501047_0005455 Ga0501047_0005455_7746_8435 229
71 3300049584 Ga0501068_0058164 Ga0501068_0058164_112_801 229
72 3300049585 Ga0501069_0001064 Ga0501069_0001064_11148_11837 229
73 3300049586 Ga0501070_0001356 Ga0501070_0001356_4546_5235 229
74 3300049589 Ga0501073_0000321 Ga0501073_0000321_14755_15444 229
75 3300049590 Ga0501074_0000097 Ga0501074_0000097_24902_25591 229
76 3300049741 Ga0501079_0010889 Ga0501079_0010889_5505_6194 229
77 3300049742 Ga0501080_0004551 Ga0501080_0004551_7877_8566 229
78 3300049744 Ga0501083_0001657 Ga0501083_0001657_2365_3054 229
79 3300049822 Ga0501035_0041596 Ga0501035_0041596_1481_2170 229
80 3300049823 Ga0501044_0497094 Ga0501044_0497094_258_947 229
81 3300050494 nmdc:mga06z11_129958_c1 nmdc:mga06z11_129958_c1_365_1054 229
82 3300050496 nmdc:mga07m45_21342_c1 nmdc:mga07m45_21342_c1_2482_3171 229
83 3300053146 Ga0500588_0078977 Ga0500588_0078977_272_1015 229
84 3300053151 Ga0500604_0019033 Ga0500604_0019033_820_1563 229
85 3300060353 Ga0501082_0030537 Ga0501082_0030537_2169_2858 229
86 3300005614 Ga0068856_100377961 Ga0068856_1003779612 231
87 3300048918 Ga0496115_0309654 Ga0496115_0309654_523_1218 231
88 iso_pu_bacteria 2522125168 2522553582 232
89 3300035692 Ga0373935_0060637 Ga0373935_0060637_185_922 233
90 iso_pu_bacteria 2833640130 2833641672 234
91 3300003320 rootH2_10218750 rootH2_102187505 236
92 3300005262 Ga0065165_1000572 Ga0065165_100057245 236
93 3300013102 Ga0157371_10047892 Ga0157371_100478922 236
94 3300013104 Ga0157370_10213147 Ga0157370_102131472 236
95 3300025292 Ga0209676_1000587 Ga0209676_100058746 236
96 3300031548 Ga0307408_100341856 Ga0307408_1003418561 236
97 3300031911 Ga0307412_10074325 Ga0307412_100743252 236
98 3300032004 Ga0307414_10004158 Ga0307414_100041583 236
99 3300047318 Ga0495636_0000011 Ga0495636_0000011_10302_11078 236
100 3300049671 Ga0501238_027085 Ga0501238_027085_51_761 236
101 3300049705 Ga0501225_0048763 Ga0501225_0048763_142_852 236
102 iso_pu_bacteria 2739367866 2740032226 236
103 iso_pu_bacteria 2929239360 2929245737 236
104 3300013296 Ga0157374_10000025 Ga0157374_10000025112 237
105 3300013307 Ga0157372_10993958 Ga0157372_109939581 237
106 3300014969 Ga0157376_10000106 Ga0157376_1000010612 237
107 3300032005 Ga0307411_10002064 Ga0307411_100020645 237
108 3300046454 Ga0495592_0104094 Ga0495592_0104094_285_998 237
109 3300046642 Ga0495634_0034294 Ga0495634_0034294_14_727 237
110 3300047471 Ga0495684_0242689 Ga0495684_0242689_47_760 237
111 3300049581 Ga0501047_0047099 Ga0501047_0047099_2463_3176 237
112 3300049822 Ga0501035_0003314 Ga0501035_0003314_5313_6026 237
113 3300005289 Ga0065704_10071523 Ga0065704_100715235 238
114 3300005466 Ga0070685_10202244 Ga0070685_102022442 238
115 3300005548 Ga0070665_100004489 Ga0070665_10000448911 238
116 3300005834 Ga0068851_10000010 Ga0068851_10000010105 238
117 3300009093 Ga0105240_10000011 Ga0105240_1000001188 238
118 3300009545 Ga0105237_10070415 Ga0105237_100704154 238
119 3300010375 Ga0105239_10000122 Ga0105239_1000012257 238
120 3300010375 Ga0105239_10398225 Ga0105239_103982252 238
121 3300025321 Ga0207656_10015294 Ga0207656_100152942 238
122 3300025904 Ga0207647_10017033 Ga0207647_100170334 238
123 3300025913 Ga0207695_10007081 Ga0207695_100070817 238
124 3300028379 Ga0268266_10003842 Ga0268266_100038425 238
125 3300029957 Ga0265324_10005635 Ga0265324_100056353 238
126 3300031548 Ga0307408_100000059 Ga0307408_100000059111 238
127 3300038443 Ga0395901_0231229 Ga0395901_0231229_322_1062 238
128 3300039062 Ga0400483_272307 Ga0400483_272307_21811_22530 238
129 3300039093 Ga0400489_73371 Ga0400489_73371_1242_1961 238
130 3300042876 Ga0451577_0028956 Ga0451577_0028956_956_1675 238
131 3300044712 Ga0453684_0089645 Ga0453684_0089645_879_1598 238
132 3300044712 Ga0453684_0189376 Ga0453684_0189376_865_1584 238
133 3300044712 Ga0453684_0223250 Ga0453684_0223250_167_886 238
134 3300045049 Ga0466959_0105111 Ga0466959_0105111_1256_1972 238
135 3300049571 Ga0501034_0348743 Ga0501034_0348743_50_766 238
136 3300049663 Ga0501223_016205 Ga0501223_016205_654_1370 238
137 3300049668 Ga0501233_053636 Ga0501233_053636_46_762 238
138 3300049758 Ga0501241_009503 Ga0501241_009503_922_1638 238
139 3300053133 Ga0500655_016928 Ga0500655_016928_78_794 238
140 3300053146 Ga0500588_0011320 Ga0500588_0011320_1109_1825 238
141 3300053177 Ga0500636_0043986 Ga0500636_0043986_1547_2263 238
142 3300053730 Ga0500645_058315 Ga0500645_058315_114_830 238
143 3300001989 JGI24739J22299_10000783 JGI24739J22299_100007833 239
144 3300003215 JGI25153J46596_10022865 JGI25153J46596_100228652 239
145 3300003215 JGI25153J46596_10023125 JGI25153J46596_100231253 239
146 3300003323 rootH1_10125993 rootH1_101259934 239
147 3300003354 JGI25160J50197_1000942 JGI25160J50197_10009429 239
148 3300003771 Ga0055526_1008965 Ga0055526_10089654 239
149 3300003771 Ga0055526_1014523 Ga0055526_10145233 239
150 3300003790 Ga0055528_1000317 Ga0055528_100031713 239
151 3300003791 Ga0055530_10002416 Ga0055530_100024168 239
152 3300005262 Ga0065165_1000225 Ga0065165_100022579 239
153 3300005293 Ga0065715_10257149 Ga0065715_102571491 239
154 3300005333 Ga0070677_10254056 Ga0070677_102540561 239
155 3300005354 Ga0070675_100034209 Ga0070675_1000342093 239
156 3300005356 Ga0070674_100111286 Ga0070674_1001112862 239
157 3300005364 Ga0070673_100045813 Ga0070673_1000458132 239
158 3300005456 Ga0070678_100558110 Ga0070678_1005581101 239
159 3300005459 Ga0068867_100056628 Ga0068867_1000566282 239
160 3300005543 Ga0070672_100185156 Ga0070672_1001851562 239
161 3300009553 Ga0105249_10121911 Ga0105249_101219111 239
162 3300010375 Ga0105239_10158942 Ga0105239_101589422 239
163 3300013102 Ga0157371_10387710 Ga0157371_103877101 239
164 3300013307 Ga0157372_10019917 Ga0157372_100199177 239
165 3300014325 Ga0163163_10496595 Ga0163163_104965952 239
166 3300014326 Ga0157380_10075788 Ga0157380_100757882 239
167 3300025273 Ga0209673_1000167 Ga0209673_100016799 239
168 3300025295 Ga0209564_1005521 Ga0209564_10055212 239
169 3300025295 Ga0209564_1006215 Ga0209564_10062155 239
170 3300025295 Ga0209564_1011686 Ga0209564_10116864 239
171 3300025297 Ga0209758_1006223 Ga0209758_10062233 239
172 3300025297 Ga0209758_1008953 Ga0209758_10089534 239
173 3300025302 Ga0207426_1001469 Ga0207426_100146910 239
174 3300025303 Ga0209051_1049490 Ga0209051_10494903 239
175 3300025304 Ga0209257_1020538 Ga0209257_10205383 239
176 3300025893 Ga0207682_10046303 Ga0207682_100463032 239
177 3300025926 Ga0207659_10337443 Ga0207659_103374432 239
178 3300025937 Ga0207669_10133587 Ga0207669_101335872 239
179 3300025972 Ga0207668_10132993 Ga0207668_101329931 239
180 3300026089 Ga0207648_10057710 Ga0207648_100577102 239
181 3300041406 Ga0439439_0030857 Ga0439439_0030857_492_1280 239
182 3300050493 nmdc:mga0k408_193936_c1 nmdc:mga0k408_193936_c1_411_1136 239
183 3300003320 rootH2_10035444 rootH2_1003544410 240
184 3300003761 Ga0055535_1002199 Ga0055535_10021995 240
185 3300003762 Ga0055542_1001463 Ga0055542_10014634 240
186 3300005335 Ga0070666_10194423 Ga0070666_101944231 240
187 3300005336 Ga0070680_100003766 Ga0070680_1000037664 240
188 3300005337 Ga0070682_100008707 Ga0070682_1000087074 240
189 3300005341 Ga0070691_10011913 Ga0070691_100119133 240
190 3300005365 Ga0070688_100042445 Ga0070688_1000424452 240
191 3300005367 Ga0070667_100105364 Ga0070667_1001053642 240
192 3300005466 Ga0070685_10007106 Ga0070685_100071062 240
193 3300005530 Ga0070679_100081253 Ga0070679_1000812533 240
194 3300005547 Ga0070693_100005903 Ga0070693_1000059034 240
195 3300005563 Ga0068855_100019922 Ga0068855_1000199227 240
196 3300005842 Ga0068858_100672134 Ga0068858_1006721342 240
197 3300005843 Ga0068860_100000004 Ga0068860_100000004224 240
198 3300005843 Ga0068860_100037849 Ga0068860_1000378492 240
199 3300006358 Ga0068871_100308310 Ga0068871_1003083102 240
200 3300009093 Ga0105240_10699154 Ga0105240_106991541 240
201 3300009174 Ga0105241_10001644 Ga0105241_100016445 240
202 3300009174 Ga0105241_10766004 Ga0105241_107660041 240
203 3300013104 Ga0157370_10026720 Ga0157370_100267204 240
204 3300013105 Ga0157369_10019658 Ga0157369_100196584 240
205 3300013296 Ga0157374_10124619 Ga0157374_101246191 240
206 3300013306 Ga0163162_10001183 Ga0163162_1000118319 240
207 3300013306 Ga0163162_10003125 Ga0163162_100031259 240
208 3300013306 Ga0163162_10031057 Ga0163162_100310572 240
209 3300013306 Ga0163162_10600585 Ga0163162_106005852 240
210 3300013307 Ga0157372_10299996 Ga0157372_102999962 240
211 3300013308 Ga0157375_10011642 Ga0157375_100116426 240
212 3300014325 Ga0163163_11128607 Ga0163163_111286071 240
213 3300014326 Ga0157380_10001403 Ga0157380_1000140312 240
214 3300014969 Ga0157376_10140568 Ga0157376_101405681 240
215 3300025242 Ga0209258_100288 Ga0209258_10028833 240
216 3300025254 Ga0209148_1000269 Ga0209148_100026932 240
217 3300025903 Ga0207680_10277424 Ga0207680_102774242 240
218 3300025911 Ga0207654_10010740 Ga0207654_100107403 240
219 3300025912 Ga0207707_10002007 Ga0207707_1000200718 240
220 3300025913 Ga0207695_10055358 Ga0207695_100553583 240
221 3300025921 Ga0207652_10029941 Ga0207652_100299414 240
222 3300025986 Ga0207658_10167016 Ga0207658_101670162 240
223 3300028379 Ga0268266_10000065 Ga0268266_100000654 240
224 3300028381 Ga0268264_10000011 Ga0268264_10000011142 240
225 3300028381 Ga0268264_10007377 Ga0268264_100073772 240
226 3300028794 Ga0307515_10005687 Ga0307515_1000568718 240
227 3300031251 Ga0265327_10065654 Ga0265327_100656542 240
228 3300036401 Ga0373937_0706323 Ga0373937_0706323_217_939 240
229 3300042876 Ga0451577_0000052 Ga0451577_0000052_169681_170415 240
230 3300046519 Ga0495632_0101927 Ga0495632_0101927_210_959 240
231 3300046558 Ga0495633_0000313 Ga0495633_0000313_14120_14884 240
232 3300046648 Ga0495611_0000184 Ga0495611_0000184_26750_27472 240
233 3300047320 Ga0495672_0008899 Ga0495672_0008899_4076_4801 240
234 3300047320 Ga0495672_0088688 Ga0495672_0088688_51_776 240
235 3300047443 Ga0495687_000006 Ga0495687_000006_57678_58400 240
236 3300049703 Ga0501219_000582 Ga0501219_000582_573_1295 240
237 3300049705 Ga0501225_0053864 Ga0501225_0053864_310_1032 240
238 3300049758 Ga0501241_001365 Ga0501241_001365_1953_2717 240
239 3300050005 Ga0501284_00001 Ga0501284_00001_22821_23543 240
240 3300053090 Ga0500646_0002289 Ga0500646_0002289_3551_4300 240
241 3300053092 Ga0500583_0000652 Ga0500583_0000652_1314_2036 240
242 3300053092 Ga0500583_0004591 Ga0500583_0004591_82_831 240
243 3300053093 Ga0500651_0032155 Ga0500651_0032155_366_1130 240
244 3300053093 Ga0500651_0076602 Ga0500651_0076602_808_1557 240
245 3300053109 Ga0500569_002817 Ga0500569_002817_374_1123 240
246 3300053134 Ga0500658_0018214 Ga0500658_0018214_1006_1755 240
247 3300053136 Ga0500559_0011289 Ga0500559_0011289_1105_1854 240
248 3300053142 Ga0500577_0000524 Ga0500577_0000524_6091_6840 240
249 3300053142 Ga0500577_0103754 Ga0500577_0103754_366_1088 240
250 3300053146 Ga0500588_0001359 Ga0500588_0001359_2948_3670 240
251 3300053153 Ga0500616_0033948 Ga0500616_0033948_946_1695 240
252 3300053156 Ga0500622_0001945 Ga0500622_0001945_879_1601 240
253 3300053156 Ga0500622_0002080 Ga0500622_0002080_5562_6311 240
254 3300053160 Ga0500633_0000885 Ga0500633_0000885_1916_2665 240
255 3300053177 Ga0500636_0078470 Ga0500636_0078470_923_1672 240
256 3300055283 Ga0500661_002379 Ga0500661_002379_1481_2230 240
257 3300001904 JGI24736J21556_1012863 JGI24736J21556_10128632 241
258 3300005364 Ga0070673_100649976 Ga0070673_1006499762 241
259 3300005366 Ga0070659_100266105 Ga0070659_1002661052 241
260 3300005539 Ga0068853_100059019 Ga0068853_1000590193 241
261 3300005563 Ga0068855_100004564 Ga0068855_1000045642 241
262 3300005577 Ga0068857_100006415 Ga0068857_1000064153 241
263 3300005578 Ga0068854_100205662 Ga0068854_1002056622 241
264 3300005614 Ga0068856_100033809 Ga0068856_1000338094 241
265 3300005614 Ga0068856_100101246 Ga0068856_1001012462 241
266 3300005614 Ga0068856_100112704 Ga0068856_1001127042 241
267 3300005616 Ga0068852_100002872 Ga0068852_1000028728 241
268 3300009093 Ga0105240_10000534 Ga0105240_1000053432 241
269 3300009093 Ga0105240_10001313 Ga0105240_1000131311 241
270 3300009093 Ga0105240_10059266 Ga0105240_100592662 241
271 3300009174 Ga0105241_10002845 Ga0105241_100028452 241
272 3300009174 Ga0105241_10186834 Ga0105241_101868342 241
273 3300009545 Ga0105237_10004795 Ga0105237_100047952 241
274 3300009551 Ga0105238_10002090 Ga0105238_100020903 241
275 3300009551 Ga0105238_10011749 Ga0105238_100117492 241
276 3300009553 Ga0105249_10247664 Ga0105249_102476641 241
277 3300010375 Ga0105239_10051809 Ga0105239_100518094 241
278 3300013100 Ga0157373_10149538 Ga0157373_101495382 241
279 3300013104 Ga0157370_10152592 Ga0157370_101525922 241
280 3300013104 Ga0157370_10265176 Ga0157370_102651762 241
281 3300013105 Ga0157369_10016662 Ga0157369_100166625 241
282 3300013307 Ga0157372_10000255 Ga0157372_100002553 241
283 3300025246 Ga0209646_1000003 Ga0209646_1000003444 241
284 3300025250 Ga0209026_1000144 Ga0209026_100014433 241
285 3300025904 Ga0207647_10010089 Ga0207647_100100894 241
286 3300025911 Ga0207654_10176907 Ga0207654_101769072 241
287 3300025911 Ga0207654_10250537 Ga0207654_102505372 241
288 3300025913 Ga0207695_10000892 Ga0207695_1000089210 241
289 3300025913 Ga0207695_10004052 Ga0207695_1000405214 241
290 3300025913 Ga0207695_10107822 Ga0207695_101078222 241
291 3300025914 Ga0207671_10003372 Ga0207671_1000337213 241
292 3300025914 Ga0207671_10182377 Ga0207671_101823772 241
293 3300025919 Ga0207657_10482544 Ga0207657_104825441 241
294 3300025924 Ga0207694_10069343 Ga0207694_100693432 241
295 3300025949 Ga0207667_10000133 Ga0207667_1000013359 241
296 3300025981 Ga0207640_10017247 Ga0207640_100172472 241
297 3300026041 Ga0207639_10167091 Ga0207639_101670912 241
298 3300026078 Ga0207702_10034375 Ga0207702_100343754 241
299 3300026078 Ga0207702_10087195 Ga0207702_100871952 241
300 3300026078 Ga0207702_10134234 Ga0207702_101342342 241
301 3300026116 Ga0207674_10010945 Ga0207674_100109456 241
302 3300026142 Ga0207698_10000312 Ga0207698_100003123 241
303 3300026142 Ga0207698_10132486 Ga0207698_101324862 241
304 3300031456 Ga0307513_10129857 Ga0307513_101298572 241
305 3300031730 Ga0307516_10019957 Ga0307516_100199574 241
306 3300033180 Ga0307510_10004187 Ga0307510_1000418714 241
307 3300041413 Ga0439465_0017503 Ga0439465_0017503_247_978 241
308 3300044658 Ga0466972_0002657 Ga0466972_0002657_5819_6544 241
309 3300044735 Ga0466968_0040659 Ga0466968_0040659_85_810 241
310 3300046460 Ga0495638_0136160 Ga0495638_0136160_407_1138 241
311 3300046507 Ga0495606_0009976 Ga0495606_0009976_4509_5246 241
312 3300046616 Ga0495668_0002521 Ga0495668_0002521_7451_8194 241
313 3300053727 Ga0500611_000030 Ga0500611_000030_38832_39563 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

53

224

0.92

PF10111

Glyco_tranf_2_2

Glycosyltransferase like family 2

53

164

0.85

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

50

221

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8223 7 236
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8125 5 236
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7892 1 238
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7889 1 240
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7887 1 231
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.877 5 240 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8724 9 236 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8552 1 237 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8536 7 233 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8507 9 236 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1H7RSR5-F1-model_v4 Glycosyltransferase involved in cell wall bisynthesis 0.9886 1 241 GO:0016757
AF-A0A1H7RSR5-F1-model_v4 Glycosyltransferase involved in cell wall bisynthesis 0.9845 1 241 GO:0016757
AF-A0A0G1PV40-F1-model_v4 Glycosyl transferase family 2 0.9732 72 239 GO:0016757
AF-A0A2E8B4R0-F1-model_v4 Glycosyl transferase 0.9716 5 240 GO:0016757
AF-A0A2V9W6E7-F1-model_v4 Glycosyl transferase 0.9652 95 241 GO:0016757

Feature Viewer

pLDDT pTM Quality
88 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map