F402128

General Info

Members Datasets Scaffolds Average Seq Length
313 205 626 157

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100772724|Ga0075431_1007727241
Length 184
Sequence MAVSSSKVKRAMVRVGLISDTHGLLRPEAKAFLRGSDYIVHGGDVGDPGILDELAALAPLTAVRGNNDRGPWAERLRETECLQVGEVFVYAIHDLAHLEIEPNAAGIHVVVSGHSHKPLVEKRRGVLYVNPGSSGPRRFKLPIAVGELLIEGRSVSARVVDLWDSARSGESHDFRPTIPVVLRW

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 2511231024 Pseudomonas sp. GM84 Isolate Nodule
198 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
199 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
200 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
201 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
202 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
203 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
204 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
205 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0.64
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0.96
Rhizoplane 0.64
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100772724 3300006847 Unclassified 935
2 LJNas_1001001 3300000546 Bacteria 4475
3 rootL2_10010297 3300003322 Bacteria 8170
4 Ga0065714_10184096 3300005288 Bacteria 952
5 Ga0065704_10070513 3300005289 Bacteria 22024
6 Ga0065707_10081844 3300005295 Bacteria 34337
7 Ga0070690_100629315 3300005330 Bacteria 817
8 Ga0070670_100003874 3300005331 Bacteria 12480
9 Ga0068869_100070732 3300005334 Bacteria 2582
10 Ga0068869_100141436 3300005334 Bacteria 1858
11 Ga0070666_10322689 3300005335 Bacteria 1102
12 Ga0070660_100116743 3300005339 Bacteria 2128
13 Ga0070689_100272290 3300005340 Bacteria 1402
14 Ga0070689_100642610 3300005340 Bacteria 922
15 Ga0070691_10464454 3300005341 Bacteria 725
16 Ga0070692_10220620 3300005345 Unclassified 1121
17 Ga0070668_100971391 3300005347 Unclassified 762
18 Ga0070669_100086624 3300005353 Bacteria 2341
19 Ga0070669_100569432 3300005353 Bacteria 946
20 Ga0070675_100178485 3300005354 Unclassified 1835
21 Ga0070675_100243489 3300005354 Bacteria 1572
22 Ga0070671_100280127 3300005355 Bacteria 1418
23 Ga0070674_101397978 3300005356 Unclassified 626
24 Ga0070673_100215079 3300005364 Bacteria 1661
25 Ga0070673_100535754 3300005364 Unclassified 1062
26 Ga0070667_100218750 3300005367 Unclassified 1695
27 Ga0070667_100741158 3300005367 Bacteria 910
28 Ga0070714_100035217 3300005435 Bacteria 4195
29 Ga0070700_100283394 3300005441 Bacteria 1202
30 Ga0070694_100021469 3300005444 Bacteria 4126
31 Ga0070694_100114872 3300005444 Bacteria 1923
32 Ga0070663_100104663 3300005455 Bacteria 2117
33 Ga0070663_101752425 3300005455 Unclassified 556
34 Ga0070678_100061855 3300005456 Bacteria 2761
35 Ga0070678_100330853 3300005456 Bacteria 1304
36 Ga0070678_100569241 3300005456 Bacteria 1008
37 Ga0070678_100640479 3300005456 Bacteria 952
38 Ga0070678_101545385 3300005456 Bacteria 622
39 Ga0070662_100316960 3300005457 Bacteria 1271
40 Ga0070681_10422512 3300005458 Bacteria 1245
41 Ga0070681_10525402 3300005458 Bacteria 1097
42 Ga0068867_100064090 3300005459 Bacteria 2732
43 Ga0070706_100007038 3300005467 Bacteria 10606
44 Ga0070707_100097490 3300005468 Bacteria 2847
45 Ga0070707_100200579 3300005468 Bacteria 1945
46 Ga0070698_100073257 3300005471 Bacteria 3432
47 Ga0070698_100370026 3300005471 Unclassified 1365
48 Ga0070699_100318345 3300005518 Bacteria 1398
49 Ga0070679_100006165 3300005530 Bacteria 11159
50 Ga0070679_100124722 3300005530 Bacteria 2558
51 Ga0070679_100413011 3300005530 Bacteria 1295
52 Ga0068853_100050320 3300005539 Bacteria 3584
53 Ga0068853_100116517 3300005539 Bacteria 2379
54 Ga0068853_100504972 3300005539 Bacteria 1142
55 Ga0070672_100200737 3300005543 Bacteria 1668
56 Ga0070695_100048554 3300005545 Bacteria 2715
57 Ga0070695_100726870 3300005545 Bacteria 790
58 Ga0070696_100002515 3300005546 Bacteria 12139
59 Ga0070696_100009076 3300005546 Bacteria 6660
60 Ga0070693_100017546 3300005547 Bacteria 3723
61 Ga0070693_100367709 3300005547 Bacteria 988
62 Ga0070665_100119099 3300005548 Bacteria 2642
63 Ga0070665_100197584 3300005548 Bacteria 2012
64 Ga0070665_101041698 3300005548 Bacteria 830
65 Ga0068855_100006299 3300005563 Bacteria 14463
66 Ga0068855_100090427 3300005563 Bacteria 3533
67 Ga0068856_100032869 3300005614 Bacteria 5080
68 Ga0068852_100261052 3300005616 Bacteria 1663
69 Ga0068852_101635052 3300005616 Bacteria 667
70 Ga0068864_100067500 3300005618 Bacteria 3106
71 Ga0068864_100413603 3300005618 Bacteria 1284
72 Ga0068864_101703646 3300005618 Bacteria 635
73 Ga0068866_11112600 3300005718 Unclassified 566
74 Ga0068863_100016599 3300005841 Bacteria 7065
75 Ga0068863_100061915 3300005841 Bacteria 3538
76 Ga0068863_100145970 3300005841 Bacteria 2263
77 Ga0068858_100442303 3300005842 Bacteria 1252
78 Ga0068860_100275643 3300005843 Bacteria 1643
79 Ga0068860_100362007 3300005843 Bacteria 1429
80 Ga0068860_101424822 3300005843 Bacteria 714
81 Ga0075366_10009452 3300006195 Bacteria 5441
82 Ga0097621_100039534 3300006237 Bacteria 3789
83 Ga0097621_100096560 3300006237 Bacteria 2480
84 Ga0097621_100947434 3300006237 Bacteria 803
85 Ga0075370_10009337 3300006353 Bacteria 5089
86 Ga0075370_10426938 3300006353 Bacteria 796
87 Ga0068871_100022596 3300006358 Bacteria 4852
88 Ga0068871_100113762 3300006358 Bacteria 2279
89 Ga0075428_100135957 3300006844 Bacteria 2672
90 Ga0075428_101037365 3300006844 Unclassified 867
91 Ga0075430_100045520 3300006846 Bacteria 3707
92 Ga0075430_100611013 3300006846 Bacteria 899
93 Ga0075431_100011453 3300006847 Bacteria 8937
94 Ga0075431_101499889 3300006847 Unclassified 633
95 Ga0075434_100287834 3300006871 Bacteria 1663
96 Ga0068865_100058160 3300006881 Unclassified 2699
97 Ga0079104_1000841 3300006946 Bacteria 25521
98 Ga0105251_10000831 3300009011 Bacteria 27668
99 Ga0105251_10012214 3300009011 Bacteria 4871
100 Ga0105240_10002445 3300009093 Bacteria 29864
101 Ga0105240_10017418 3300009093 Bacteria 9682
102 Ga0105240_10898072 3300009093 Bacteria 953
103 Ga0105240_11273867 3300009093 Bacteria 776
104 Ga0105245_10338070 3300009098 Bacteria 1488
105 Ga0105243_10294064 3300009148 Bacteria 1469
106 Ga0105241_10240121 3300009174 Bacteria 1531
107 Ga0105242_10593938 3300009176 Bacteria 1068
108 Ga0105242_10906333 3300009176 Bacteria 882
109 Ga0105248_10046399 3300009177 Bacteria 4869
110 Ga0105237_10407032 3300009545 Bacteria 1365
111 Ga0105238_10008285 3300009551 Bacteria 10396
112 Ga0105238_10342069 3300009551 Bacteria 1484
113 Ga0105238_11679279 3300009551 Bacteria 666
114 Ga0105249_10768668 3300009553 Bacteria 1026
115 Ga0157370_10038040 3300013104 Bacteria 4658
116 Ga0157369_10407577 3300013105 Bacteria 1410
117 Ga0157374_10142118 3300013296 Bacteria 2330
118 Ga0157374_10236029 3300013296 Bacteria 1797
119 Ga0157374_10332885 3300013296 Bacteria 1506
120 Ga0157378_10091693 3300013297 Bacteria 2763
121 Ga0157378_10310690 3300013297 Bacteria 1529
122 Ga0163162_10019006 3300013306 Bacteria 6739
123 Ga0163162_10019910 3300013306 Bacteria 6590
124 Ga0163162_10117958 3300013306 Bacteria 2755
125 Ga0163162_10680100 3300013306 Bacteria 1152
126 Ga0163162_10825412 3300013306 Bacteria 1043
127 Ga0157372_10009385 3300013307 Bacteria 10409
128 Ga0157372_10026456 3300013307 Bacteria 6313
129 Ga0157375_10527324 3300013308 Bacteria 1344
130 Ga0157379_10030579 3300014968 Bacteria 4794
131 Ga0157379_10243228 3300014968 Bacteria 1632
132 Ga0157379_10312013 3300014968 Bacteria 1435
133 Ga0157376_10156944 3300014969 Bacteria 2058
134 Ga0163161_10023667 3300017792 Bacteria 4334
135 Ga0207656_10218504 3300025321 Bacteria 926
136 Ga0207713_1000848 3300025735 Bacteria 28075
137 Ga0207713_1113984 3300025735 Bacteria 915
138 Ga0207684_10007207 3300025910 Bacteria 10048
139 Ga0207654_10222565 3300025911 Bacteria 1253
140 Ga0207707_10995153 3300025912 Bacteria 688
141 Ga0207695_10044064 3300025913 Bacteria 4749
142 Ga0207695_10333619 3300025913 Bacteria 1405
143 Ga0207671_10294925 3300025914 Bacteria 1281
144 Ga0207657_10022371 3300025919 Bacteria 5917
145 Ga0207657_10753310 3300025919 Unclassified 754
146 Ga0207652_10088298 3300025921 Bacteria 2720
147 Ga0207652_10137676 3300025921 Bacteria 2181
148 Ga0207652_10138695 3300025921 Bacteria 2173
149 Ga0207646_10173771 3300025922 Bacteria 1945
150 Ga0207646_10352726 3300025922 Bacteria 1329
151 Ga0207681_10326157 3300025923 Bacteria 1222
152 Ga0207681_10460547 3300025923 Bacteria 1036
153 Ga0207694_10151463 3300025924 Bacteria 1869
154 Ga0207659_10084973 3300025926 Bacteria 2350
155 Ga0207659_10123671 3300025926 Bacteria 1986
156 Ga0207644_10110483 3300025931 Bacteria 2078
157 Ga0207706_10303718 3300025933 Bacteria 1390
158 Ga0207706_10425702 3300025933 Unclassified 1150
159 Ga0207686_10034798 3300025934 Bacteria 3018
160 Ga0207709_10398842 3300025935 Bacteria 1051
161 Ga0207670_10426746 3300025936 Bacteria 1065
162 Ga0207704_10045190 3300025938 Bacteria 2615
163 Ga0207691_10020197 3300025940 Bacteria 6300
164 Ga0207691_10175211 3300025940 Bacteria 1876
165 Ga0207711_10098837 3300025941 Bacteria 2579
166 Ga0207689_10002696 3300025942 Bacteria 16423
167 Ga0207689_10232999 3300025942 Unclassified 1522
168 Ga0207667_10049270 3300025949 Bacteria 4450
169 Ga0207667_10156341 3300025949 Bacteria 2346
170 Ga0207651_10284922 3300025960 Bacteria 1367
171 Ga0207651_10303786 3300025960 Unclassified 1328
172 Ga0207712_10807661 3300025961 Bacteria 825
173 Ga0207668_10183568 3300025972 Unclassified 1652
174 Ga0207658_10185118 3300025986 Bacteria 1727
175 Ga0207658_10665864 3300025986 Bacteria 939
176 Ga0207703_10005488 3300026035 Bacteria 10194
177 Ga0207639_10282524 3300026041 Bacteria 1460
178 Ga0207639_10962044 3300026041 Bacteria 799
179 Ga0207678_10044174 3300026067 Bacteria 3855
180 Ga0207708_10326366 3300026075 Bacteria 1254
181 Ga0207702_10423332 3300026078 Unclassified 1288
182 Ga0207641_10032290 3300026088 Unclassified 4346
183 Ga0207641_10110005 3300026088 Bacteria 2441
184 Ga0207641_10113411 3300026088 Bacteria 2407
185 Ga0207648_10003591 3300026089 Bacteria 16220
186 Ga0207648_10718808 3300026089 Bacteria 926
187 Ga0207676_10041891 3300026095 Bacteria 3519
188 Ga0207676_11107857 3300026095 Bacteria 783
189 Ga0207683_10003507 3300026121 Bacteria 13682
190 Ga0207683_10033867 3300026121 Bacteria 4438
191 Ga0207683_10177024 3300026121 Unclassified 1933
192 Ga0207683_10523342 3300026121 Bacteria 1096
193 Ga0207698_10434032 3300026142 Bacteria 1264
194 Ga0207698_10817870 3300026142 Bacteria 935
195 Ga0209281_1000485 3300027111 Bacteria 55132
196 Ga0268266_10188324 3300028379 Bacteria 1883
197 Ga0268265_10033497 3300028380 Bacteria 3736
198 Ga0268264_10140534 3300028381 Bacteria 2153
199 Ga0268264_10263938 3300028381 Bacteria 1606
200 Ga0307515_10007649 3300028794 Bacteria 21312
201 Ga0316178_1081348 3300030735 Bacteria 13815
202 Ga0316182_1197348 3300030745 Unclassified 1157
203 Ga0265770_1001726 3300030878 Bacteria 2991
204 Ga0265760_10001092 3300031090 Bacteria 7880
205 Ga0265328_10263738 3300031239 Bacteria 661
206 Ga0307408_100000247 3300031548 Bacteria 56153
207 Ga0307408_100001096 3300031548 Bacteria 20679
208 Ga0307408_100030675 3300031548 Bacteria 3736
209 Ga0307516_10014785 3300031730 Bacteria 8242
210 Ga0307405_10031427 3300031731 Bacteria 3126
211 Ga0307405_10440511 3300031731 Bacteria 1030
212 Ga0307405_10564786 3300031731 Bacteria 923
213 Ga0307405_11262083 3300031731 Bacteria 641
214 Ga0307410_10041771 3300031852 Bacteria 3026
215 Ga0307406_10082856 3300031901 Bacteria 2138
216 Ga0307412_10115971 3300031911 Bacteria 1920
217 Ga0307412_10183017 3300031911 Bacteria 1578
218 Ga0307412_10213845 3300031911 Bacteria 1473
219 Ga0307412_10538968 3300031911 Bacteria 978
220 Ga0307409_100020599 3300031995 Bacteria 4499
221 Ga0307409_100474781 3300031995 Bacteria 1212
222 Ga0307416_100054264 3300032002 Bacteria 3221
223 Ga0307414_10003528 3300032004 Bacteria 8366
224 Ga0307411_10017082 3300032005 Bacteria 4123
225 Ga0307415_100035568 3300032126 Bacteria 3254
226 Ga0373937_0229300 3300036401 Bacteria 1749
227 Ga0316584_0133089 3300036712 Bacteria 1857
228 Ga0395900_0071007 3300037418 Bacteria 3579
229 Ga0395900_0672086 3300037418 Bacteria 971
230 Ga0395898_0027351 3300037466 Bacteria 5727
231 Ga0395905_0017634 3300037471 Bacteria 6776
232 Ga0395901_0042768 3300038443 Bacteria 4699
233 Ga0395901_0090821 3300038443 Bacteria 3197
234 Ga0395901_0569285 3300038443 Bacteria 1146
235 Ga0400483_071908 3300039062 Bacteria 11244
236 Ga0451802_0707868 3300041460 Unclassified 633
237 Ga0451849_1095774 3300041505 Bacteria 650
238 Ga0451853_2047447 3300041512 Bacteria 1052
239 Ga0439432_000435 3300042006 Bacteria 15539
240 Ga0439432_001659 3300042006 Bacteria 8336
241 Ga0439452_000024 3300042010 Bacteria 230396
242 Ga0439452_000047 3300042010 Bacteria 127643
243 Ga0466965_0149997 3300044683 Bacteria 1218
244 Ga0451576_0833246 3300045051 Bacteria 968
245 Ga0495590_0011044 3300046457 Bacteria 3384
246 Ga0495629_0590837 3300046459 Bacteria 743
247 Ga0495582_0008976 3300046473 Bacteria 5516
248 Ga0495607_0003807 3300046501 Bacteria 11388
249 Ga0495632_0008420 3300046519 Bacteria 6331
250 Ga0495665_0177082 3300046531 Bacteria 1109
251 Ga0495621_0419622 3300046539 Bacteria 569
252 Ga0495657_0032701 3300046675 Bacteria 3628
253 Ga0495658_0003662 3300046683 Bacteria 7604
254 Ga0495581_0593978 3300047315 Bacteria 641
255 Ga0495674_1034687 3300047319 Bacteria 628
256 Ga0496114_0739567 3300048917 Bacteria 860
257 Ga0496117_0000559 3300048920 Bacteria 61171
258 Ga0496118_0480921 3300048921 Bacteria 622
259 Ga0496119_0000695 3300048922 Bacteria 45051
260 Ga0496120_0000105 3300048923 Bacteria 140297
261 Ga0496122_0000081 3300048925 Bacteria 211119
262 Ga0496123_0000101 3300048926 Bacteria 169939
263 Ga0496124_0000277 3300048927 Bacteria 98300
264 Ga0501298_071070 3300049521 Bacteria 751
265 Ga0501033_0344969 3300049570 Bacteria 1044
266 Ga0501039_0134887 3300049575 Bacteria 1938
267 Ga0501040_0137054 3300049576 Bacteria 1723
268 Ga0501040_0301799 3300049576 Unclassified 1145
269 Ga0501041_0313830 3300049577 Bacteria 989
270 Ga0501041_0373167 3300049577 Bacteria 902
271 Ga0501042_0094203 3300049578 Bacteria 2151
272 Ga0501046_0444521 3300049580 Bacteria 933
273 Ga0501048_0058717 3300049582 Bacteria 2727
274 Ga0501070_0969093 3300049586 Bacteria 661
275 Ga0501072_0347326 3300049588 Bacteria 1178
276 Ga0501074_0149498 3300049590 Bacteria 1670
277 Ga0501074_0498042 3300049590 Unclassified 863
278 Ga0501074_0691089 3300049590 Unclassified 720
279 Ga0501075_0050779 3300049591 Bacteria 3118
280 Ga0501076_0471273 3300049592 Bacteria 1034
281 Ga0501077_0003165 3300049593 Bacteria 9906
282 Ga0501079_0131640 3300049741 Bacteria 1946
283 Ga0501079_1162723 3300049741 Bacteria 608
284 Ga0501081_0132867 3300049743 Bacteria 1779
285 Ga0501081_0233160 3300049743 Bacteria 1341
286 Ga0501269_003264 3300049766 Bacteria 1964
287 Ga0501045_0200906 3300049824 Bacteria 1485
288 Ga0501045_0444683 3300049824 Unclassified 964
289 nmdc:mga0k408_41990_c1 3300050493 Bacteria 2634
290 nmdc:mga0k408_6301_c1 3300050493 Bacteria 6330
291 nmdc:mga07m45_82064_c1 3300050496 Bacteria 1841
292 nmdc:mga0qj67_441281_c1 3300050509 Bacteria 1049
293 nmdc:mga0qj67_475656_c1 3300050509 Bacteria 1005
294 nmdc:mga06r32_285687_c1 3300050510 Bacteria 1636
295 nmdc:mga06r32_96797_c1 3300050510 Bacteria 2891
296 nmdc:mga0n895_853503_c1 3300050512 Bacteria 898
297 Ga0500651_0571967 3300053093 Bacteria 616
298 Ga0500619_000132 3300053154 Bacteria 19303
299 Ga0501084_0206434 3300054114 Bacteria 1658
300 Ga0501082_0007859 3300060353 Bacteria 9202
301 Ga0501082_0076756 3300060353 Bacteria 2880
302 Ga0530510_0102839 3300061734 Bacteria 2089
303 Ga0530510_0788589 3300061734 Unclassified 725
304 2511375037 2511231024 Bacteria 5835885
305 2587729967 2585428057 Bacteria 6737412
306 2842832884 2842832357 Bacteria 5959113
307 2904434702 2904434214 Bacteria 6230908
308 2929193458 2929189879 Bacteria 5930554
309 2998142654 2998139840 Bacteria 6073514
310 2998142922 2998139840 Bacteria 6073514
311 3007861740 3007861166 Bacteria 6045338
312 8056168271 8056166840 Bacteria 5820959
313 8056173940 8056172158 Bacteria 6133900
314 Ga0075431_100772724
315 LJNas_1001001
316 rootL2_10010297
317 Ga0065714_10184096
318 Ga0065704_10070513
319 Ga0065707_10081844
320 Ga0070690_100629315
321 Ga0070670_100003874
322 Ga0068869_100070732
323 Ga0068869_100141436
324 Ga0070666_10322689
325 Ga0070660_100116743
326 Ga0070689_100272290
327 Ga0070689_100642610
328 Ga0070691_10464454
329 Ga0070692_10220620
330 Ga0070668_100971391
331 Ga0070669_100086624
332 Ga0070669_100569432
333 Ga0070675_100178485
334 Ga0070675_100243489
335 Ga0070671_100280127
336 Ga0070674_101397978
337 Ga0070673_100215079
338 Ga0070673_100535754
339 Ga0070667_100218750
340 Ga0070667_100741158
341 Ga0070714_100035217
342 Ga0070700_100283394
343 Ga0070694_100021469
344 Ga0070694_100114872
345 Ga0070663_100104663
346 Ga0070663_101752425
347 Ga0070678_100061855
348 Ga0070678_100330853
349 Ga0070678_100569241
350 Ga0070678_100640479
351 Ga0070678_101545385
352 Ga0070662_100316960
353 Ga0070681_10422512
354 Ga0070681_10525402
355 Ga0068867_100064090
356 Ga0070706_100007038
357 Ga0070707_100097490
358 Ga0070707_100200579
359 Ga0070698_100073257
360 Ga0070698_100370026
361 Ga0070699_100318345
362 Ga0070679_100006165
363 Ga0070679_100124722
364 Ga0070679_100413011
365 Ga0068853_100050320
366 Ga0068853_100116517
367 Ga0068853_100504972
368 Ga0070672_100200737
369 Ga0070695_100048554
370 Ga0070695_100726870
371 Ga0070696_100002515
372 Ga0070696_100009076
373 Ga0070693_100017546
374 Ga0070693_100367709
375 Ga0070665_100119099
376 Ga0070665_100197584
377 Ga0070665_101041698
378 Ga0068855_100006299
379 Ga0068855_100090427
380 Ga0068856_100032869
381 Ga0068852_100261052
382 Ga0068852_101635052
383 Ga0068864_100067500
384 Ga0068864_100413603
385 Ga0068864_101703646
386 Ga0068866_11112600
387 Ga0068863_100016599
388 Ga0068863_100061915
389 Ga0068863_100145970
390 Ga0068858_100442303
391 Ga0068860_100275643
392 Ga0068860_100362007
393 Ga0068860_101424822
394 Ga0075366_10009452
395 Ga0097621_100039534
396 Ga0097621_100096560
397 Ga0097621_100947434
398 Ga0075370_10009337
399 Ga0075370_10426938
400 Ga0068871_100022596
401 Ga0068871_100113762
402 Ga0075428_100135957
403 Ga0075428_101037365
404 Ga0075430_100045520
405 Ga0075430_100611013
406 Ga0075431_100011453
407 Ga0075431_101499889
408 Ga0075434_100287834
409 Ga0068865_100058160
410 Ga0079104_1000841
411 Ga0105251_10000831
412 Ga0105251_10012214
413 Ga0105240_10002445
414 Ga0105240_10017418
415 Ga0105240_10898072
416 Ga0105240_11273867
417 Ga0105245_10338070
418 Ga0105243_10294064
419 Ga0105241_10240121
420 Ga0105242_10593938
421 Ga0105242_10906333
422 Ga0105248_10046399
423 Ga0105237_10407032
424 Ga0105238_10008285
425 Ga0105238_10342069
426 Ga0105238_11679279
427 Ga0105249_10768668
428 Ga0157370_10038040
429 Ga0157369_10407577
430 Ga0157374_10142118
431 Ga0157374_10236029
432 Ga0157374_10332885
433 Ga0157378_10091693
434 Ga0157378_10310690
435 Ga0163162_10019006
436 Ga0163162_10019910
437 Ga0163162_10117958
438 Ga0163162_10680100
439 Ga0163162_10825412
440 Ga0157372_10009385
441 Ga0157372_10026456
442 Ga0157375_10527324
443 Ga0157379_10030579
444 Ga0157379_10243228
445 Ga0157379_10312013
446 Ga0157376_10156944
447 Ga0163161_10023667
448 Ga0207656_10218504
449 Ga0207713_1000848
450 Ga0207713_1113984
451 Ga0207684_10007207
452 Ga0207654_10222565
453 Ga0207707_10995153
454 Ga0207695_10044064
455 Ga0207695_10333619
456 Ga0207671_10294925
457 Ga0207657_10022371
458 Ga0207657_10753310
459 Ga0207652_10088298
460 Ga0207652_10137676
461 Ga0207652_10138695
462 Ga0207646_10173771
463 Ga0207646_10352726
464 Ga0207681_10326157
465 Ga0207681_10460547
466 Ga0207694_10151463
467 Ga0207659_10084973
468 Ga0207659_10123671
469 Ga0207644_10110483
470 Ga0207706_10303718
471 Ga0207706_10425702
472 Ga0207686_10034798
473 Ga0207709_10398842
474 Ga0207670_10426746
475 Ga0207704_10045190
476 Ga0207691_10020197
477 Ga0207691_10175211
478 Ga0207711_10098837
479 Ga0207689_10002696
480 Ga0207689_10232999
481 Ga0207667_10049270
482 Ga0207667_10156341
483 Ga0207651_10284922
484 Ga0207651_10303786
485 Ga0207712_10807661
486 Ga0207668_10183568
487 Ga0207658_10185118
488 Ga0207658_10665864
489 Ga0207703_10005488
490 Ga0207639_10282524
491 Ga0207639_10962044
492 Ga0207678_10044174
493 Ga0207708_10326366
494 Ga0207702_10423332
495 Ga0207641_10032290
496 Ga0207641_10110005
497 Ga0207641_10113411
498 Ga0207648_10003591
499 Ga0207648_10718808
500 Ga0207676_10041891
501 Ga0207676_11107857
502 Ga0207683_10003507
503 Ga0207683_10033867
504 Ga0207683_10177024
505 Ga0207683_10523342
506 Ga0207698_10434032
507 Ga0207698_10817870
508 Ga0209281_1000485
509 Ga0268266_10188324
510 Ga0268265_10033497
511 Ga0268264_10140534
512 Ga0268264_10263938
513 Ga0307515_10007649
514 Ga0316178_1081348
515 Ga0316182_1197348
516 Ga0265770_1001726
517 Ga0265760_10001092
518 Ga0265328_10263738
519 Ga0307408_100000247
520 Ga0307408_100001096
521 Ga0307408_100030675
522 Ga0307516_10014785
523 Ga0307405_10031427
524 Ga0307405_10440511
525 Ga0307405_10564786
526 Ga0307405_11262083
527 Ga0307410_10041771
528 Ga0307406_10082856
529 Ga0307412_10115971
530 Ga0307412_10183017
531 Ga0307412_10213845
532 Ga0307412_10538968
533 Ga0307409_100020599
534 Ga0307409_100474781
535 Ga0307416_100054264
536 Ga0307414_10003528
537 Ga0307411_10017082
538 Ga0307415_100035568
539 Ga0373937_0229300
540 Ga0316584_0133089
541 Ga0395900_0071007
542 Ga0395900_0672086
543 Ga0395898_0027351
544 Ga0395905_0017634
545 Ga0395901_0042768
546 Ga0395901_0090821
547 Ga0395901_0569285
548 Ga0400483_071908
549 Ga0451802_0707868
550 Ga0451849_1095774
551 Ga0451853_2047447
552 Ga0439432_000435
553 Ga0439432_001659
554 Ga0439452_000024
555 Ga0439452_000047
556 Ga0466965_0149997
557 Ga0451576_0833246
558 Ga0495590_0011044
559 Ga0495629_0590837
560 Ga0495582_0008976
561 Ga0495607_0003807
562 Ga0495632_0008420
563 Ga0495665_0177082
564 Ga0495621_0419622
565 Ga0495657_0032701
566 Ga0495658_0003662
567 Ga0495581_0593978
568 Ga0495674_1034687
569 Ga0496114_0739567
570 Ga0496117_0000559
571 Ga0496118_0480921
572 Ga0496119_0000695
573 Ga0496120_0000105
574 Ga0496122_0000081
575 Ga0496123_0000101
576 Ga0496124_0000277
577 Ga0501298_071070
578 Ga0501033_0344969
579 Ga0501039_0134887
580 Ga0501040_0137054
581 Ga0501040_0301799
582 Ga0501041_0313830
583 Ga0501041_0373167
584 Ga0501042_0094203
585 Ga0501046_0444521
586 Ga0501048_0058717
587 Ga0501070_0969093
588 Ga0501072_0347326
589 Ga0501074_0149498
590 Ga0501074_0498042
591 Ga0501074_0691089
592 Ga0501075_0050779
593 Ga0501076_0471273
594 Ga0501077_0003165
595 Ga0501079_0131640
596 Ga0501079_1162723
597 Ga0501081_0132867
598 Ga0501081_0233160
599 Ga0501269_003264
600 Ga0501045_0200906
601 Ga0501045_0444683
602 nmdc:mga0k408_41990_c1
603 nmdc:mga0k408_6301_c1
604 nmdc:mga07m45_82064_c1
605 nmdc:mga0qj67_441281_c1
606 nmdc:mga0qj67_475656_c1
607 nmdc:mga06r32_285687_c1
608 nmdc:mga06r32_96797_c1
609 nmdc:mga0n895_853503_c1
610 Ga0500651_0571967
611 Ga0500619_000132
612 Ga0501084_0206434
613 Ga0501082_0007859
614 Ga0501082_0076756
615 Ga0530510_0102839
616 Ga0530510_0788589
617 2511375037
618 2587729967
619 2842832884
620 2904434702
621 2929193458
622 2998142654
623 2998142922
624 3007861740
625 8056168271
626 8056173940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

13

152

0.88

PF00149

Metallophos

Calcineurin-like phosphoesterase

13

100

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8281 1 148
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8036 1 148
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.7961 1 149
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.7931 1 149
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.7865 1 149
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8648 1 148 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8396 1 149 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8381 1 148 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8281 1 148 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8193 1 149 3.60.21.10
ID Description Score Start End GO Terms
AF-E8WZF2-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9873 1 152 GO:0016787
GO:0046872
AF-A0A2V7E4R1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9859 2 151 GO:0016787
GO:0046872
AF-A0A831Y7A1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9858 1 152 GO:0016787
GO:0046872
AF-H0S9A3-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9853 1 152 GO:0016787
GO:0046872
AF-A0A530HE49-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9845 1 118 GO:0016787
GO:0046872

Map