F402075

General Info

Members Datasets Scaffolds Average Seq Length
313 212 311 155

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100658441|Ga0070708_1006584411
Length 170
Sequence MAPLGGVARSARGARLKLLVVAVGQRQPAWAQTAYAEFEKRFPPEMRLELHAVKAEARGQKTAEQLMAAEAVRLQAALPRGVRRVVLDERGTRVTTLQLAERMKAWLRDGRDVALLIGGPDGLDASLKASADETLRLSELTLPHAFVRVLLAEALYRAWTVMVNHPYHRE

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
122 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
123 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
124 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
201 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
205 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.02
Nodule 0
Rhizoplane 0.96
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10155599 3300005295 Bacteria 1612
2 Ga0070658_10059752 3300005327 Bacteria 3104
3 Ga0070670_100314586 3300005331 Bacteria 1371
4 Ga0068869_101227450 3300005334 Bacteria 660
5 Ga0070680_100072402 3300005336 Bacteria 2832
6 Ga0070675_100041039 3300005354 Bacteria 3779
7 Ga0070671_100262820 3300005355 Bacteria 1467
8 Ga0070674_100045092 3300005356 Bacteria 3012
9 Ga0070673_100030813 3300005364 Bacteria 4020
10 Ga0070673_100108545 3300005364 Bacteria 2298
11 Ga0070667_100003920 3300005367 Bacteria 12640
12 Ga0070667_100319465 3300005367 Bacteria 1401
13 Ga0070667_100373748 3300005367 Bacteria 1294
14 Ga0070705_101322414 3300005440 Unclassified 598
15 Ga0070708_100658441 3300005445 Bacteria 987
16 Ga0070708_100678399 3300005445 Unclassified 970
17 Ga0070706_100368787 3300005467 Bacteria 1338
18 Ga0070707_100910816 3300005468 Bacteria 844
19 Ga0070672_100164732 3300005543 Bacteria 1841
20 Ga0070665_100189697 3300005548 Bacteria 2056
21 Ga0068857_100026921 3300005577 Bacteria 5070
22 Ga0068859_100229609 3300005617 Bacteria 1944
23 Ga0068866_10714164 3300005718 Bacteria 689
24 Ga0068860_100767027 3300005843 Bacteria 977
25 Ga0075365_10073265 3300006038 Bacteria 2308
26 Ga0075368_10127688 3300006042 Bacteria 1055
27 Ga0075363_100056049 3300006048 Bacteria 2112
28 Ga0075362_10001495 3300006177 Bacteria 7510
29 Ga0075362_10031528 3300006177 Bacteria 2294
30 Ga0075362_10160703 3300006177 Bacteria 1081
31 Ga0075367_10049587 3300006178 Bacteria 2475
32 Ga0075367_10052681 3300006178 Bacteria 2409
33 Ga0075369_10302053 3300006186 Bacteria 747
34 Ga0075366_10075227 3300006195 Bacteria 2014
35 Ga0075366_10109974 3300006195 Bacteria 1657
36 Ga0075366_10300207 3300006195 Bacteria 982
37 Ga0075366_10734305 3300006195 Bacteria 613
38 Ga0097621_100867706 3300006237 Bacteria 839
39 Ga0075370_10002205 3300006353 Bacteria 8947
40 Ga0075370_10004451 3300006353 Bacteria 6807
41 Ga0075370_10005758 3300006353 Bacteria 6191
42 Ga0075370_10027587 3300006353 Bacteria 3152
43 Ga0075429_100003851 3300006880 Bacteria 12815
44 Ga0075429_100873346 3300006880 Bacteria 787
45 Ga0097620_100229620 3300006931 Bacteria 1944
46 Ga0105240_10744642 3300009093 Bacteria 1066
47 Ga0105245_10298678 3300009098 Bacteria 1579
48 Ga0105243_10018034 3300009148 Bacteria 5340
49 Ga0105243_10674079 3300009148 Bacteria 1005
50 Ga0105243_11703841 3300009148 Bacteria 659
51 Ga0105242_11652480 3300009176 Bacteria 676
52 Ga0105248_11927581 3300009177 Bacteria 671
53 Ga0157347_1037866 3300012502 Bacteria 628
54 Ga0157374_10443140 3300013296 Bacteria 1299
55 Ga0157374_11105557 3300013296 Bacteria 813
56 Ga0157378_10875154 3300013297 Bacteria 928
57 Ga0157378_11775162 3300013297 Bacteria 665
58 Ga0157375_10032348 3300013308 Bacteria 4960
59 Ga0182008_10000185 3300014497 Bacteria 49229
60 Ga0157377_10150895 3300014745 Bacteria 1437
61 Ga0157379_10037055 3300014968 Bacteria 4348
62 Ga0157379_10252436 3300014968 Bacteria 1601
63 Ga0213872_10001418 3300021361 Bacteria 15732
64 Ga0213872_10271422 3300021361 Bacteria 710
65 Ga0213874_10004222 3300021377 Bacteria 3253
66 Ga0209759_1025515 3300025256 Bacteria 1256
67 Ga0209051_1003649 3300025303 Bacteria 9969
68 Ga0207645_10001387 3300025907 Bacteria 19872
69 Ga0207645_10279860 3300025907 Bacteria 1108
70 Ga0207650_10025660 3300025925 Bacteria 4199
71 Ga0207650_10062539 3300025925 Bacteria 2782
72 Ga0207687_10823884 3300025927 Bacteria 792
73 Ga0207644_10029027 3300025931 Bacteria 3835
74 Ga0207690_10266604 3300025932 Bacteria 1329
75 Ga0207709_10013405 3300025935 Bacteria 4523
76 Ga0207709_10014499 3300025935 Bacteria 4354
77 Ga0207669_10234210 3300025937 Bacteria 1357
78 Ga0207704_10176009 3300025938 Bacteria 1541
79 Ga0207691_10099224 3300025940 Bacteria 2600
80 Ga0207691_10105151 3300025940 Bacteria 2515
81 Ga0207691_10228937 3300025940 Bacteria 1610
82 Ga0207689_10046217 3300025942 Bacteria 3599
83 Ga0207689_10803166 3300025942 Bacteria 794
84 Ga0207658_10002081 3300025986 Bacteria 14887
85 Ga0207658_10260818 3300025986 Bacteria 1477
86 Ga0207641_10951564 3300026088 Bacteria 854
87 Ga0207648_11160020 3300026089 Bacteria 725
88 Ga0207675_100587098 3300026118 Bacteria 1116
89 Ga0207683_10508785 3300026121 Bacteria 1112
90 Ga0209968_1006847 3300027526 Bacteria 1720
91 Ga0209983_1038168 3300027665 Bacteria 1035
92 Ga0209971_1037708 3300027682 Bacteria 1164
93 Ga0209966_1000013 3300027695 Bacteria 83121
94 Ga0209998_10032580 3300027717 Bacteria 1159
95 Ga0209813_10142485 3300027866 Bacteria 852
96 Ga0268266_10012641 3300028379 Bacteria 7295
97 Ga0268266_10046491 3300028379 Bacteria 3716
98 Ga0268266_10266075 3300028379 Bacteria 1590
99 Ga0268266_10746444 3300028379 Bacteria 944
100 Ga0268264_10437702 3300028381 Bacteria 1264
101 Ga0265336_10000061 3300028666 Bacteria 102829
102 Ga0307517_10092851 3300028786 Bacteria 2452
103 Ga0307517_10104218 3300028786 Bacteria 2211
104 Ga0307517_10506805 3300028786 Bacteria 613
105 Ga0307515_10040089 3300028794 Bacteria 7418
106 Ga0307515_10073031 3300028794 Bacteria 4618
107 Ga0307515_10622945 3300028794 Bacteria 690
108 Ga0265324_10001647 3300029957 Bacteria 12347
109 Ga0307511_10251940 3300030521 Bacteria 847
110 Ga0307512_10199409 3300030522 Bacteria 1086
111 Ga0265330_10000099 3300031235 Bacteria 72344
112 Ga0265332_10000002 3300031238 Bacteria 709510
113 Ga0265325_10034352 3300031241 Bacteria 2698
114 Ga0265327_10000778 3300031251 Bacteria 49242
115 Ga0265327_10040473 3300031251 Bacteria 2520
116 Ga0265316_10006286 3300031344 Bacteria 11374
117 Ga0307513_10214799 3300031456 Bacteria 1751
118 Ga0307513_10267409 3300031456 Bacteria 1495
119 Ga0307513_10406207 3300031456 Bacteria 1095
120 Ga0307513_10446211 3300031456 Bacteria 1019
121 Ga0307509_10004959 3300031507 Bacteria 18830
122 Ga0307509_10006861 3300031507 Bacteria 15150
123 Ga0307509_10045189 3300031507 Bacteria 4752
124 Ga0307509_10159708 3300031507 Bacteria 2154
125 Ga0307509_10281895 3300031507 Bacteria 1422
126 Ga0307509_10963465 3300031507 Bacteria 519
127 Ga0307408_100124837 3300031548 Bacteria 2000
128 Ga0265313_10288836 3300031595 Bacteria 661
129 Ga0307508_10000097 3300031616 Bacteria 103662
130 Ga0307508_10097079 3300031616 Bacteria 2538
131 Ga0307508_10202950 3300031616 Bacteria 1583
132 Ga0307508_10632736 3300031616 Bacteria 674
133 Ga0307514_10230381 3300031649 Bacteria 1124
134 Ga0307514_10286111 3300031649 Bacteria 938
135 Ga0316575_10029489 3300031665 Bacteria 2143
136 Ga0265314_10000089 3300031711 Bacteria 138050
137 Ga0307516_10000858 3300031730 Bacteria 41638
138 Ga0307516_10005205 3300031730 Bacteria 15661
139 Ga0316577_10023736 3300031733 Bacteria 3405
140 Ga0307518_10053294 3300031838 Bacteria 2940
141 Ga0307412_10141081 3300031911 Bacteria 1765
142 Ga0307409_100724946 3300031995 Bacteria 996
143 Ga0307416_100050379 3300032002 Bacteria 3319
144 Ga0307411_11306663 3300032005 Bacteria 661
145 Ga0307507_10083410 3300033179 Bacteria 2795
146 Ga0307510_10187866 3300033180 Bacteria 1618
147 Ga0307510_10199277 3300033180 Bacteria 1539
148 Ga0307510_10233804 3300033180 Bacteria 1338
149 Ga0373923_0179776 3300035111 Bacteria 972
150 Ga0373943_0112490 3300035170 Bacteria 1437
151 Ga0373946_0239246 3300035171 Bacteria 882
152 Ga0316574_0005180 3300035398 Bacteria 6937
153 Ga0316574_0074604 3300035398 Unclassified 2147
154 Ga0316574_0154224 3300035398 Unclassified 1480
155 Ga0373931_0021102 3300035691 Bacteria 3266
156 Ga0373931_0024417 3300035691 Bacteria 3062
157 Ga0373927_0345298 3300035695 Bacteria 981
158 Ga0373947_0397136 3300035725 Bacteria 930
159 Ga0373937_0155142 3300036401 Bacteria 2146
160 Ga0316582_0113477 3300036647 Unclassified 1806
161 Ga0316584_0022443 3300036712 Bacteria 4603
162 Ga0316584_0946353 3300036712 Unclassified 578
163 Ga0373925_0097943 3300037068 Bacteria 2250
164 Ga0436360_1147806 3300039438 Bacteria 1485
165 Ga0436361_0704832 3300039447 Bacteria 27869
166 Ga0436361_1210726 3300039447 Bacteria 3491
167 Ga0436363_0616561 3300039450 Bacteria 6138
168 Ga0436362_0160475 3300039453 Bacteria 6589
169 Ga0439461_0122631 3300041410 Bacteria 651
170 Ga0451793_0273639 3300041452 Bacteria 890
171 Ga0451797_1404492 3300041453 Bacteria 799
172 Ga0451843_1137242 3300041509 Bacteria 1359
173 Ga0439462_0036582 3300042015 Bacteria 1306
174 Ga0450923_022978 3300042125 Bacteria 1227
175 Ga0450890_005557 3300042127 Bacteria 1619
176 Ga0450894_014298 3300042131 Bacteria 1045
177 Ga0450910_058103 3300042147 Bacteria 649
178 Ga0439446_0034790 3300042156 Bacteria 1467
179 Ga0439464_0013316 3300042439 Bacteria 2201
180 Ga0451577_0065073 3300042876 Bacteria 3251
181 Ga0451577_0606632 3300042876 Bacteria 993
182 Ga0453684_1250806 3300044712 Bacteria 777
183 Ga0466968_0707107 3300044735 Bacteria 515
184 Ga0466957_0211773 3300044842 Bacteria 1276
185 Ga0466960_0359418 3300044901 Bacteria 832
186 Ga0451576_0009077 3300045051 Bacteria 11576
187 Ga0495592_0000113 3300046454 Bacteria 71049
188 Ga0495651_0162935 3300046462 Bacteria 1596
189 Ga0495650_0046014 3300046471 Bacteria 1833
190 Ga0495605_0083849 3300046474 Bacteria 1487
191 Ga0495639_0181239 3300046475 Bacteria 1025
192 Ga0495585_0113302 3300046492 Bacteria 1440
193 Ga0495585_0306844 3300046492 Bacteria 779
194 Ga0495583_0199747 3300046506 Bacteria 813
195 Ga0495606_0002268 3300046507 Bacteria 22764
196 Ga0495630_0021124 3300046517 Bacteria 4806
197 Ga0495632_0033188 3300046519 Bacteria 2652
198 Ga0495632_0076125 3300046519 Bacteria 1605
199 Ga0495643_0047790 3300046522 Bacteria 2316
200 Ga0495643_0121683 3300046522 Bacteria 1318
201 Ga0495648_0038294 3300046524 Bacteria 3069
202 Ga0495666_0113382 3300046526 Bacteria 1273
203 Ga0495652_0236887 3300046529 Bacteria 1361
204 Ga0495621_0335411 3300046539 Bacteria 632
205 Ga0495597_0046706 3300046542 Bacteria 1918
206 Ga0495656_0129323 3300046615 Bacteria 1200
207 Ga0495668_0054551 3300046616 Bacteria 2209
208 Ga0495668_0067276 3300046616 Bacteria 1971
209 Ga0495625_0012510 3300046660 Bacteria 6872
210 Ga0495625_0027356 3300046660 Bacteria 4295
211 Ga0495625_0042125 3300046660 Bacteria 3320
212 Ga0495659_0041447 3300046664 Bacteria 1645
213 Ga0495624_0034633 3300046690 Bacteria 3265
214 Ga0495649_0000983 3300046694 Bacteria 22478
215 Ga0495649_0003001 3300046694 Bacteria 11583
216 Ga0495649_0385893 3300046694 Bacteria 704
217 Ga0495687_002139 3300047443 Bacteria 16502
218 Ga0495685_023782 3300047447 Bacteria 2110
219 Ga0495593_0029619 3300047673 Bacteria 3000
220 Ga0495614_0236141 3300048089 Bacteria 834
221 Ga0495626_0139180 3300048091 Bacteria 1030
222 Ga0495626_0200728 3300048091 Bacteria 818
223 Ga0496106_0249677 3300048909 Bacteria 1418
224 Ga0496125_0694889 3300048928 Bacteria 541
225 Ga0501031_0112290 3300049568 Bacteria 1780
226 Ga0501032_0051996 3300049569 Unclassified 2761
227 Ga0501032_0166214 3300049569 Bacteria 1448
228 Ga0501033_0004211 3300049570 Bacteria 11575
229 Ga0501034_0578444 3300049571 Bacteria 1030
230 Ga0501036_0023620 3300049572 Bacteria 5181
231 Ga0501036_0027494 3300049572 Unclassified 4805
232 Ga0501037_0285347 3300049573 Bacteria 1149
233 Ga0501038_0054194 3300049574 Bacteria 3450
234 Ga0501038_0054291 3300049574 Unclassified 3446
235 Ga0501039_0001515 3300049575 Bacteria 17103
236 Ga0501039_0233636 3300049575 Bacteria 1445
237 Ga0501040_0013559 3300049576 Bacteria 5359
238 Ga0501040_0018963 3300049576 Bacteria 4573
239 Ga0501041_0006145 3300049577 Bacteria 7017
240 Ga0501042_0005802 3300049578 Bacteria 7973
241 Ga0501043_0000004 3300049579 Bacteria 291085
242 Ga0501043_0023701 3300049579 Bacteria 4814
243 Ga0501043_0152105 3300049579 Bacteria 1811
244 Ga0501046_0000016 3300049580 Bacteria 234374
245 Ga0501046_0011151 3300049580 Bacteria 7699
246 Ga0501046_0053134 3300049580 Bacteria 3191
247 Ga0501047_0000012 3300049581 Bacteria 368824
248 Ga0501048_0004759 3300049582 Bacteria 10341
249 Ga0501048_0036857 3300049582 Bacteria 3514
250 Ga0501048_0092375 3300049582 Bacteria 2134
251 Ga0501068_0022110 3300049584 Bacteria 3716
252 Ga0501071_0000220 3300049587 Bacteria 26239
253 Ga0501071_0166528 3300049587 Bacteria 1649
254 Ga0501071_0682648 3300049587 Bacteria 791
255 Ga0501072_0000641 3300049588 Bacteria 25081
256 Ga0501072_0104883 3300049588 Bacteria 2247
257 Ga0501073_0107543 3300049589 Bacteria 1935
258 Ga0501074_0054315 3300049590 Unclassified 2889
259 Ga0501075_0000398 3300049591 Bacteria 25242
260 Ga0501075_0035292 3300049591 Bacteria 3728
261 Ga0501076_0026495 3300049592 Bacteria 4491
262 Ga0501076_0042995 3300049592 Bacteria 3559
263 Ga0501077_0016225 3300049593 Bacteria 4691
264 Ga0501077_0024979 3300049593 Bacteria 3794
265 Ga0501079_0000320 3300049741 Bacteria 30212
266 Ga0501080_0012052 3300049742 Bacteria 7922
267 Ga0501080_0066968 3300049742 Bacteria 3340
268 Ga0501081_0000163 3300049743 Bacteria 30783
269 Ga0501081_0054400 3300049743 Bacteria 2766
270 Ga0501083_0121893 3300049744 Bacteria 1710
271 Ga0501035_0105119 3300049822 Bacteria 2475
272 Ga0501035_0177937 3300049822 Bacteria 1834
273 Ga0501045_0000537 3300049824 Bacteria 23761
274 Ga0501045_0038282 3300049824 Bacteria 3487
275 Ga0501045_0156526 3300049824 Bacteria 1695
276 nmdc:mga03683_278146_c1 3300050489 Bacteria 782
277 nmdc:mga03683_42064_c1 3300050489 Bacteria 1879
278 nmdc:mga0yw44_59729_c1 3300050492 Bacteria 2333
279 nmdc:mga0k408_14609_c2 3300050493 Bacteria 2801
280 nmdc:mga0k408_193847_c1 3300050493 Bacteria 1213
281 nmdc:mga0k408_76947_c1 3300050493 Bacteria 1951
282 nmdc:mga06z11_40795_c1 3300050494 Bacteria 2319
283 nmdc:mga04h51_68382_c1 3300050495 Bacteria 1234
284 nmdc:mga07m45_371625_c1 3300050496 Bacteria 830
285 nmdc:mga07m45_42216_c1 3300050496 Bacteria 2556
286 nmdc:mga07m45_4498_c1 3300050496 Bacteria 6826
287 nmdc:mga07m45_4696_c1 3300050496 Bacteria 6705
288 nmdc:mga07m45_5965_c1 3300050496 Bacteria 6120
289 nmdc:mga09592_7751_c1 3300050508 Bacteria 8730
290 nmdc:mga09592_820687_c1 3300050508 Bacteria 786
291 Ga0500578_0025990 3300053086 Bacteria 3758
292 Ga0500578_0072506 3300053086 Bacteria 2194
293 Ga0500578_0232293 3300053086 Bacteria 1117
294 Ga0500651_0292981 3300053093 Bacteria 935
295 Ga0500651_0504426 3300053093 Bacteria 667
296 Ga0500569_191101 3300053109 Bacteria 696
297 Ga0500572_098520 3300053111 Bacteria 933
298 Ga0500658_0024426 3300053134 Bacteria 2315
299 Ga0500559_0007463 3300053136 Bacteria 4843
300 Ga0500564_202618 3300053138 Bacteria 814
301 Ga0500619_022758 3300053154 Bacteria 1823
302 Ga0500636_0025677 3300053177 Bacteria 3482
303 Ga0500645_017444 3300053730 Bacteria 2250
304 Ga0500587_032169 3300053739 Bacteria 724
305 Ga0501084_0001338 3300054114 Bacteria 19458
306 Ga0501084_0022901 3300054114 Bacteria 5213
307 Ga0500661_013301 3300055283 Bacteria 1483
308 Ga0501082_0012991 3300060353 Bacteria 7158
309 Ga0501082_0022449 3300060353 Bacteria 5435
310 Ga0530510_0033205 3300061734 Unclassified 3715
311 Ga0530510_0154657 3300061734 Bacteria 1694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031733 Ga0316577_10023736 Ga0316577_100237363 130
2 3300035398 Ga0316574_0154224 Ga0316574_0154224_211_606 130
3 3300036647 Ga0316582_0113477 Ga0316582_0113477_785_1180 130
4 3300036712 Ga0316584_0022443 Ga0316584_0022443_4100_4495 130
5 3300049822 Ga0501035_0105119 Ga0501035_0105119_943_1368 138
6 3300042147 Ga0450910_058103 Ga0450910_058103_19_444 141
7 3300041509 Ga0451843_1137242 Ga0451843_1137242_248_682 144
8 3300031665 Ga0316575_10029489 Ga0316575_100294893 145
9 3300035398 Ga0316574_0074604 Ga0316574_0074604_853_1290 145
10 3300028786 Ga0307517_10104218 Ga0307517_101042182 148
11 3300046664 Ga0495659_0041447 Ga0495659_0041447_198_650 150
12 iso_pu_bacteria 2643221654 2644302379 151
13 iso_pu_bacteria 2687453129 2687578842 151
14 3300005327 Ga0070658_10059752 Ga0070658_100597524 155
15 3300005331 Ga0070670_100314586 Ga0070670_1003145863 155
16 3300005334 Ga0068869_101227450 Ga0068869_1012274501 155
17 3300005354 Ga0070675_100041039 Ga0070675_1000410393 155
18 3300005355 Ga0070671_100262820 Ga0070671_1002628202 155
19 3300005356 Ga0070674_100045092 Ga0070674_1000450923 155
20 3300005364 Ga0070673_100030813 Ga0070673_1000308134 155
21 3300005364 Ga0070673_100108545 Ga0070673_1001085453 155
22 3300005367 Ga0070667_100003920 Ga0070667_1000039207 155
23 3300005367 Ga0070667_100319465 Ga0070667_1003194652 155
24 3300005367 Ga0070667_100373748 Ga0070667_1003737482 155
25 3300005445 Ga0070708_100658441 Ga0070708_1006584411 155
26 3300005467 Ga0070706_100368787 Ga0070706_1003687872 155
27 3300005468 Ga0070707_100910816 Ga0070707_1009108162 155
28 3300005543 Ga0070672_100164732 Ga0070672_1001647323 155
29 3300005548 Ga0070665_100189697 Ga0070665_1001896971 155
30 3300005577 Ga0068857_100026921 Ga0068857_1000269213 155
31 3300005617 Ga0068859_100229609 Ga0068859_1002296093 155
32 3300005718 Ga0068866_10714164 Ga0068866_107141642 155
33 3300005843 Ga0068860_100767027 Ga0068860_1007670272 155
34 3300006038 Ga0075365_10073265 Ga0075365_100732653 155
35 3300006042 Ga0075368_10127688 Ga0075368_101276882 155
36 3300006048 Ga0075363_100056049 Ga0075363_1000560492 155
37 3300006177 Ga0075362_10001495 Ga0075362_100014955 155
38 3300006177 Ga0075362_10031528 Ga0075362_100315282 155
39 3300006177 Ga0075362_10160703 Ga0075362_101607032 155
40 3300006178 Ga0075367_10049587 Ga0075367_100495873 155
41 3300006178 Ga0075367_10052681 Ga0075367_100526812 155
42 3300006186 Ga0075369_10302053 Ga0075369_103020532 155
43 3300006195 Ga0075366_10075227 Ga0075366_100752272 155
44 3300006195 Ga0075366_10109974 Ga0075366_101099742 155
45 3300006195 Ga0075366_10300207 Ga0075366_103002072 155
46 3300006195 Ga0075366_10734305 Ga0075366_107343051 155
47 3300006237 Ga0097621_100867706 Ga0097621_1008677062 155
48 3300006353 Ga0075370_10002205 Ga0075370_100022052 155
49 3300006353 Ga0075370_10004451 Ga0075370_100044516 155
50 3300006353 Ga0075370_10005758 Ga0075370_100057585 155
51 3300006353 Ga0075370_10027587 Ga0075370_100275873 155
52 3300006880 Ga0075429_100003851 Ga0075429_1000038517 155
53 3300006880 Ga0075429_100873346 Ga0075429_1008733462 155
54 3300006931 Ga0097620_100229620 Ga0097620_1002296202 155
55 3300009093 Ga0105240_10744642 Ga0105240_107446421 155
56 3300009098 Ga0105245_10298678 Ga0105245_102986782 155
57 3300009148 Ga0105243_10018034 Ga0105243_100180344 155
58 3300009148 Ga0105243_10674079 Ga0105243_106740792 155
59 3300009148 Ga0105243_11703841 Ga0105243_117038412 155
60 3300009176 Ga0105242_11652480 Ga0105242_116524802 155
61 3300009177 Ga0105248_11927581 Ga0105248_119275812 155
62 3300012502 Ga0157347_1037866 Ga0157347_10378661 155
63 3300013296 Ga0157374_10443140 Ga0157374_104431402 155
64 3300013296 Ga0157374_11105557 Ga0157374_111055572 155
65 3300013297 Ga0157378_10875154 Ga0157378_108751542 155
66 3300013297 Ga0157378_11775162 Ga0157378_117751621 155
67 3300013308 Ga0157375_10032348 Ga0157375_100323484 155
68 3300014497 Ga0182008_10000185 Ga0182008_1000018556 155
69 3300014745 Ga0157377_10150895 Ga0157377_101508951 155
70 3300014968 Ga0157379_10037055 Ga0157379_100370555 155
71 3300014968 Ga0157379_10252436 Ga0157379_102524362 155
72 3300021361 Ga0213872_10001418 Ga0213872_100014182 155
73 3300021361 Ga0213872_10271422 Ga0213872_102714221 155
74 3300025256 Ga0209759_1025515 Ga0209759_10255152 155
75 3300025303 Ga0209051_1003649 Ga0209051_10036495 155
76 3300025907 Ga0207645_10001387 Ga0207645_1000138712 155
77 3300025907 Ga0207645_10279860 Ga0207645_102798602 155
78 3300025925 Ga0207650_10025660 Ga0207650_100256602 155
79 3300025925 Ga0207650_10062539 Ga0207650_100625392 155
80 3300025927 Ga0207687_10823884 Ga0207687_108238842 155
81 3300025931 Ga0207644_10029027 Ga0207644_100290274 155
82 3300025932 Ga0207690_10266604 Ga0207690_102666041 155
83 3300025935 Ga0207709_10013405 Ga0207709_100134053 155
84 3300025935 Ga0207709_10014499 Ga0207709_100144992 155
85 3300025937 Ga0207669_10234210 Ga0207669_102342102 155
86 3300025938 Ga0207704_10176009 Ga0207704_101760093 155
87 3300025940 Ga0207691_10099224 Ga0207691_100992242 155
88 3300025940 Ga0207691_10105151 Ga0207691_101051512 155
89 3300025940 Ga0207691_10228937 Ga0207691_102289373 155
90 3300025942 Ga0207689_10046217 Ga0207689_100462173 155
91 3300025942 Ga0207689_10803166 Ga0207689_108031662 155
92 3300025986 Ga0207658_10002081 Ga0207658_100020812 155
93 3300025986 Ga0207658_10260818 Ga0207658_102608182 155
94 3300026088 Ga0207641_10951564 Ga0207641_109515642 155
95 3300026089 Ga0207648_11160020 Ga0207648_111600201 155
96 3300026118 Ga0207675_100587098 Ga0207675_1005870982 155
97 3300026121 Ga0207683_10508785 Ga0207683_105087852 155
98 3300027665 Ga0209983_1038168 Ga0209983_10381682 155
99 3300027682 Ga0209971_1037708 Ga0209971_10377082 155
100 3300027866 Ga0209813_10142485 Ga0209813_101424852 155
101 3300028379 Ga0268266_10012641 Ga0268266_100126417 155
102 3300028379 Ga0268266_10046491 Ga0268266_100464914 155
103 3300028379 Ga0268266_10266075 Ga0268266_102660752 155
104 3300028379 Ga0268266_10746444 Ga0268266_107464442 155
105 3300028381 Ga0268264_10437702 Ga0268264_104377022 155
106 3300028666 Ga0265336_10000061 Ga0265336_1000006159 155
107 3300028786 Ga0307517_10092851 Ga0307517_100928512 155
108 3300028786 Ga0307517_10506805 Ga0307517_105068051 155
109 3300028794 Ga0307515_10040089 Ga0307515_100400896 155
110 3300028794 Ga0307515_10073031 Ga0307515_100730312 155
111 3300028794 Ga0307515_10622945 Ga0307515_106229451 155
112 3300029957 Ga0265324_10001647 Ga0265324_100016478 155
113 3300030521 Ga0307511_10251940 Ga0307511_102519401 155
114 3300030522 Ga0307512_10199409 Ga0307512_101994092 155
115 3300031235 Ga0265330_10000099 Ga0265330_1000009910 155
116 3300031238 Ga0265332_10000002 Ga0265332_10000002579 155
117 3300031241 Ga0265325_10034352 Ga0265325_100343522 155
118 3300031251 Ga0265327_10000778 Ga0265327_1000077847 155
119 3300031251 Ga0265327_10040473 Ga0265327_100404732 155
120 3300031344 Ga0265316_10006286 Ga0265316_100062868 155
121 3300031456 Ga0307513_10214799 Ga0307513_102147992 155
122 3300031456 Ga0307513_10267409 Ga0307513_102674092 155
123 3300031456 Ga0307513_10406207 Ga0307513_104062071 155
124 3300031456 Ga0307513_10446211 Ga0307513_104462112 155
125 3300031507 Ga0307509_10004959 Ga0307509_1000495921 155
126 3300031507 Ga0307509_10006861 Ga0307509_100068613 155
127 3300031507 Ga0307509_10045189 Ga0307509_100451896 155
128 3300031507 Ga0307509_10159708 Ga0307509_101597083 155
129 3300031507 Ga0307509_10281895 Ga0307509_102818952 155
130 3300031507 Ga0307509_10963465 Ga0307509_109634651 155
131 3300031548 Ga0307408_100124837 Ga0307408_1001248373 155
132 3300031595 Ga0265313_10288836 Ga0265313_102888361 155
133 3300031616 Ga0307508_10000097 Ga0307508_1000009790 155
134 3300031616 Ga0307508_10097079 Ga0307508_100970794 155
135 3300031616 Ga0307508_10202950 Ga0307508_102029502 155
136 3300031616 Ga0307508_10632736 Ga0307508_106327362 155
137 3300031649 Ga0307514_10230381 Ga0307514_102303812 155
138 3300031649 Ga0307514_10286111 Ga0307514_102861112 155
139 3300031711 Ga0265314_10000089 Ga0265314_1000008979 155
140 3300031730 Ga0307516_10000858 Ga0307516_100008589 155
141 3300031730 Ga0307516_10005205 Ga0307516_1000520513 155
142 3300031838 Ga0307518_10053294 Ga0307518_100532943 155
143 3300031911 Ga0307412_10141081 Ga0307412_101410812 155
144 3300031995 Ga0307409_100724946 Ga0307409_1007249462 155
145 3300033179 Ga0307507_10083410 Ga0307507_100834104 155
146 3300033180 Ga0307510_10187866 Ga0307510_101878662 155
147 3300033180 Ga0307510_10199277 Ga0307510_101992772 155
148 3300033180 Ga0307510_10233804 Ga0307510_102338042 155
149 3300035111 Ga0373923_0179776 Ga0373923_0179776_324_791 155
150 3300035170 Ga0373943_0112490 Ga0373943_0112490_950_1417 155
151 3300035171 Ga0373946_0239246 Ga0373946_0239246_139_606 155
152 3300035691 Ga0373931_0021102 Ga0373931_0021102_1933_2400 155
153 3300035691 Ga0373931_0024417 Ga0373931_0024417_1989_2456 155
154 3300035695 Ga0373927_0345298 Ga0373927_0345298_302_769 155
155 3300035725 Ga0373947_0397136 Ga0373947_0397136_11_478 155
156 3300036401 Ga0373937_0155142 Ga0373937_0155142_602_1069 155
157 3300037068 Ga0373925_0097943 Ga0373925_0097943_229_696 155
158 3300039447 Ga0436361_0704832 Ga0436361_0704832_13889_14356 155
159 3300039447 Ga0436361_1210726 Ga0436361_1210726_2220_2687 155
160 3300041452 Ga0451793_0273639 Ga0451793_0273639_246_713 155
161 3300041453 Ga0451797_1404492 Ga0451797_1404492_240_707 155
162 3300042015 Ga0439462_0036582 Ga0439462_0036582_827_1294 155
163 3300042125 Ga0450923_022978 Ga0450923_022978_67_534 155
164 3300042127 Ga0450890_005557 Ga0450890_005557_388_855 155
165 3300042131 Ga0450894_014298 Ga0450894_014298_423_890 155
166 3300042156 Ga0439446_0034790 Ga0439446_0034790_928_1395 155
167 3300042439 Ga0439464_0013316 Ga0439464_0013316_435_902 155
168 3300042876 Ga0451577_0606632 Ga0451577_0606632_484_960 155
169 3300044712 Ga0453684_1250806 Ga0453684_1250806_260_727 155
170 3300044735 Ga0466968_0707107 Ga0466968_0707107_12_479 155
171 3300044842 Ga0466957_0211773 Ga0466957_0211773_589_1056 155
172 3300044901 Ga0466960_0359418 Ga0466960_0359418_228_695 155
173 3300046454 Ga0495592_0000113 Ga0495592_0000113_9779_10246 155
174 3300046462 Ga0495651_0162935 Ga0495651_0162935_195_662 155
175 3300046474 Ga0495605_0083849 Ga0495605_0083849_629_1096 155
176 3300046475 Ga0495639_0181239 Ga0495639_0181239_195_662 155
177 3300046492 Ga0495585_0113302 Ga0495585_0113302_54_521 155
178 3300046492 Ga0495585_0306844 Ga0495585_0306844_117_584 155
179 3300046506 Ga0495583_0199747 Ga0495583_0199747_320_787 155
180 3300046507 Ga0495606_0002268 Ga0495606_0002268_472_939 155
181 3300046517 Ga0495630_0021124 Ga0495630_0021124_3208_3675 155
182 3300046519 Ga0495632_0033188 Ga0495632_0033188_387_854 155
183 3300046519 Ga0495632_0076125 Ga0495632_0076125_275_742 155
184 3300046522 Ga0495643_0047790 Ga0495643_0047790_1550_2017 155
185 3300046522 Ga0495643_0121683 Ga0495643_0121683_753_1220 155
186 3300046524 Ga0495648_0038294 Ga0495648_0038294_899_1366 155
187 3300046526 Ga0495666_0113382 Ga0495666_0113382_70_537 155
188 3300046529 Ga0495652_0236887 Ga0495652_0236887_97_564 155
189 3300046539 Ga0495621_0335411 Ga0495621_0335411_12_479 155
190 3300046542 Ga0495597_0046706 Ga0495597_0046706_320_787 155
191 3300046615 Ga0495656_0129323 Ga0495656_0129323_525_992 155
192 3300046616 Ga0495668_0054551 Ga0495668_0054551_467_934 155
193 3300046616 Ga0495668_0067276 Ga0495668_0067276_383_850 155
194 3300046660 Ga0495625_0012510 Ga0495625_0012510_4417_4884 155
195 3300046660 Ga0495625_0027356 Ga0495625_0027356_820_1287 155
196 3300046660 Ga0495625_0042125 Ga0495625_0042125_1419_1886 155
197 3300046690 Ga0495624_0034633 Ga0495624_0034633_2366_2833 155
198 3300046694 Ga0495649_0000983 Ga0495649_0000983_16505_16972 155
199 3300046694 Ga0495649_0003001 Ga0495649_0003001_6818_7285 155
200 3300046694 Ga0495649_0385893 Ga0495649_0385893_197_664 155
201 3300047443 Ga0495687_002139 Ga0495687_002139_14517_14984 155
202 3300047447 Ga0495685_023782 Ga0495685_023782_600_1067 155
203 3300047673 Ga0495593_0029619 Ga0495593_0029619_2138_2605 155
204 3300048089 Ga0495614_0236141 Ga0495614_0236141_356_823 155
205 3300048091 Ga0495626_0139180 Ga0495626_0139180_338_805 155
206 3300048091 Ga0495626_0200728 Ga0495626_0200728_145_612 155
207 3300048909 Ga0496106_0249677 Ga0496106_0249677_709_1176 155
208 3300048928 Ga0496125_0694889 Ga0496125_0694889_44_511 155
209 3300049579 Ga0501043_0000004 Ga0501043_0000004_70934_71401 155
210 3300049580 Ga0501046_0000016 Ga0501046_0000016_220435_220902 155
211 3300049581 Ga0501047_0000012 Ga0501047_0000012_220115_220582 155
212 3300049582 Ga0501048_0036857 Ga0501048_0036857_423_890 155
213 3300049824 Ga0501045_0156526 Ga0501045_0156526_723_1190 155
214 3300050489 nmdc:mga03683_278146_c1 nmdc:mga03683_278146_c1_237_704 155
215 3300050489 nmdc:mga03683_42064_c1 nmdc:mga03683_42064_c1_759_1226 155
216 3300050492 nmdc:mga0yw44_59729_c1 nmdc:mga0yw44_59729_c1_654_1121 155
217 3300050493 nmdc:mga0k408_14609_c2 nmdc:mga0k408_14609_c2_1699_2166 155
218 3300050493 nmdc:mga0k408_193847_c1 nmdc:mga0k408_193847_c1_89_556 155
219 3300050493 nmdc:mga0k408_76947_c1 nmdc:mga0k408_76947_c1_1080_1547 155
220 3300050494 nmdc:mga06z11_40795_c1 nmdc:mga06z11_40795_c1_1528_1995 155
221 3300050495 nmdc:mga04h51_68382_c1 nmdc:mga04h51_68382_c1_424_891 155
222 3300050496 nmdc:mga07m45_371625_c1 nmdc:mga07m45_371625_c1_211_678 155
223 3300050496 nmdc:mga07m45_42216_c1 nmdc:mga07m45_42216_c1_1434_1901 155
224 3300050496 nmdc:mga07m45_4498_c1 nmdc:mga07m45_4498_c1_4576_5043 155
225 3300050496 nmdc:mga07m45_4696_c1 nmdc:mga07m45_4696_c1_5584_6051 155
226 3300050496 nmdc:mga07m45_5965_c1 nmdc:mga07m45_5965_c1_3857_4324 155
227 3300050508 nmdc:mga09592_7751_c1 nmdc:mga09592_7751_c1_6496_6963 155
228 3300050508 nmdc:mga09592_820687_c1 nmdc:mga09592_820687_c1_81_548 155
229 3300053086 Ga0500578_0025990 Ga0500578_0025990_1415_1882 155
230 3300053086 Ga0500578_0072506 Ga0500578_0072506_369_836 155
231 3300053086 Ga0500578_0232293 Ga0500578_0232293_528_995 155
232 3300053093 Ga0500651_0292981 Ga0500651_0292981_68_535 155
233 3300053093 Ga0500651_0504426 Ga0500651_0504426_38_505 155
234 3300053109 Ga0500569_191101 Ga0500569_191101_63_530 155
235 3300053111 Ga0500572_098520 Ga0500572_098520_251_718 155
236 3300053134 Ga0500658_0024426 Ga0500658_0024426_1788_2255 155
237 3300053136 Ga0500559_0007463 Ga0500559_0007463_2070_2537 155
238 3300053138 Ga0500564_202618 Ga0500564_202618_176_643 155
239 3300053154 Ga0500619_022758 Ga0500619_022758_154_621 155
240 3300053177 Ga0500636_0025677 Ga0500636_0025677_1901_2368 155
241 3300053730 Ga0500645_017444 Ga0500645_017444_346_813 155
242 3300053739 Ga0500587_032169 Ga0500587_032169_242_709 155
243 3300055283 Ga0500661_013301 Ga0500661_013301_998_1465 155
244 3300005295 Ga0065707_10155599 Ga0065707_101555993 156
245 3300005336 Ga0070680_100072402 Ga0070680_1000724023 156
246 3300005440 Ga0070705_101322414 Ga0070705_1013224141 156
247 3300005445 Ga0070708_100678399 Ga0070708_1006783992 156
248 3300021377 Ga0213874_10004222 Ga0213874_100042224 156
249 3300027526 Ga0209968_1006847 Ga0209968_10068472 156
250 3300027695 Ga0209966_1000013 Ga0209966_100001369 156
251 3300027717 Ga0209998_10032580 Ga0209998_100325802 156
252 3300032002 Ga0307416_100050379 Ga0307416_1000503793 156
253 3300032005 Ga0307411_11306663 Ga0307411_113066631 156
254 3300035398 Ga0316574_0005180 Ga0316574_0005180_6124_6594 156
255 3300036712 Ga0316584_0946353 Ga0316584_0946353_63_533 156
256 3300039438 Ga0436360_1147806 Ga0436360_1147806_543_1013 156
257 3300039450 Ga0436363_0616561 Ga0436363_0616561_4868_5341 156
258 3300039453 Ga0436362_0160475 Ga0436362_0160475_5774_6244 156
259 3300041410 Ga0439461_0122631 Ga0439461_0122631_48_518 156
260 3300042876 Ga0451577_0065073 Ga0451577_0065073_1061_1537 156
261 3300045051 Ga0451576_0009077 Ga0451576_0009077_4896_5366 156
262 3300046471 Ga0495650_0046014 Ga0495650_0046014_743_1213 156
263 3300049568 Ga0501031_0112290 Ga0501031_0112290_918_1397 156
264 3300049569 Ga0501032_0051996 Ga0501032_0051996_2151_2630 156
265 3300049569 Ga0501032_0166214 Ga0501032_0166214_794_1273 156
266 3300049570 Ga0501033_0004211 Ga0501033_0004211_6773_7252 156
267 3300049571 Ga0501034_0578444 Ga0501034_0578444_428_907 156
268 3300049572 Ga0501036_0023620 Ga0501036_0023620_805_1284 156
269 3300049572 Ga0501036_0027494 Ga0501036_0027494_1194_1673 156
270 3300049573 Ga0501037_0285347 Ga0501037_0285347_416_895 156
271 3300049574 Ga0501038_0054194 Ga0501038_0054194_798_1277 156
272 3300049574 Ga0501038_0054291 Ga0501038_0054291_683_1162 156
273 3300049575 Ga0501039_0001515 Ga0501039_0001515_10237_10716 156
274 3300049575 Ga0501039_0233636 Ga0501039_0233636_253_732 156
275 3300049576 Ga0501040_0013559 Ga0501040_0013559_4376_4855 156
276 3300049576 Ga0501040_0018963 Ga0501040_0018963_2840_3319 156
277 3300049577 Ga0501041_0006145 Ga0501041_0006145_636_1115 156
278 3300049578 Ga0501042_0005802 Ga0501042_0005802_488_967 156
279 3300049579 Ga0501043_0023701 Ga0501043_0023701_928_1407 156
280 3300049579 Ga0501043_0152105 Ga0501043_0152105_860_1339 156
281 3300049580 Ga0501046_0011151 Ga0501046_0011151_6978_7457 156
282 3300049580 Ga0501046_0053134 Ga0501046_0053134_1485_1964 156
283 3300049582 Ga0501048_0004759 Ga0501048_0004759_9313_9792 156
284 3300049582 Ga0501048_0092375 Ga0501048_0092375_1502_1981 156
285 3300049584 Ga0501068_0022110 Ga0501068_0022110_2308_2787 156
286 3300049587 Ga0501071_0000220 Ga0501071_0000220_6402_6881 156
287 3300049587 Ga0501071_0166528 Ga0501071_0166528_85_564 156
288 3300049587 Ga0501071_0682648 Ga0501071_0682648_34_507 156
289 3300049588 Ga0501072_0000641 Ga0501072_0000641_9287_9766 156
290 3300049588 Ga0501072_0104883 Ga0501072_0104883_367_846 156
291 3300049589 Ga0501073_0107543 Ga0501073_0107543_1126_1605 156
292 3300049590 Ga0501074_0054315 Ga0501074_0054315_1031_1510 156
293 3300049591 Ga0501075_0000398 Ga0501075_0000398_12225_12704 156
294 3300049591 Ga0501075_0035292 Ga0501075_0035292_807_1286 156
295 3300049592 Ga0501076_0026495 Ga0501076_0026495_555_1034 156
296 3300049592 Ga0501076_0042995 Ga0501076_0042995_833_1312 156
297 3300049593 Ga0501077_0016225 Ga0501077_0016225_2454_2933 156
298 3300049593 Ga0501077_0024979 Ga0501077_0024979_2437_2916 156
299 3300049741 Ga0501079_0000320 Ga0501079_0000320_5977_6456 156
300 3300049742 Ga0501080_0012052 Ga0501080_0012052_6510_6989 156
301 3300049742 Ga0501080_0066968 Ga0501080_0066968_1531_2010 156
302 3300049743 Ga0501081_0000163 Ga0501081_0000163_7984_8463 156
303 3300049743 Ga0501081_0054400 Ga0501081_0054400_1520_1999 156
304 3300049744 Ga0501083_0121893 Ga0501083_0121893_226_705 156
305 3300049822 Ga0501035_0177937 Ga0501035_0177937_661_1140 156
306 3300049824 Ga0501045_0000537 Ga0501045_0000537_11117_11596 156
307 3300049824 Ga0501045_0038282 Ga0501045_0038282_1271_1750 156
308 3300054114 Ga0501084_0001338 Ga0501084_0001338_10154_10633 156
309 3300054114 Ga0501084_0022901 Ga0501084_0022901_2256_2735 156
310 3300060353 Ga0501082_0012991 Ga0501082_0012991_4325_4804 156
311 3300060353 Ga0501082_0022449 Ga0501082_0022449_3915_4394 156
312 3300061734 Ga0530510_0033205 Ga0530510_0033205_2281_2760 156
313 3300061734 Ga0530510_0154657 Ga0530510_0154657_23_502 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

16

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9709 1 154
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9647 1 154
5twj-assembly2.cif.gz_A crystal structure of rlmh in complex with s-adenosylmethionine 0.9597 2 156
5twj-assembly2.cif.gz_A crystal structure of rlmh in complex with s-adenosylmethionine 0.9418 2 156
1o6d-assembly1.cif.gz_A crystal structure of a hypothetical protein 0.9415 1 151
ID Description Score Start End Superfamily
1ns5A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.963 3 154 3.40.1280.10
1ns5A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9505 3 154 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9415 1 151 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9354 1 151 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9275 1 155 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A537B0I3-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.987 1 156 GO:0005737
GO:0070038
AF-A0A4R6DU39-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.985 1 156 GO:0005737
GO:0070038
AF-A0A1G0F1N7-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.985 1 138 GO:0006364
GO:0008168
GO:0032259
AF-A0A5C7JE22-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9837 1 156 GO:0005737
GO:0070038
AF-A0A257SLI6-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9832 1 133 GO:0006364
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.46 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map