F402071

General Info

Members Datasets Scaffolds Average Seq Length
313 207 313 121

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100842388|Ga0070694_1008423882
Length 114
Sequence MAASGKPTPTEIKLHQKSRVLEVSFSDGSRFELPYEFLRVHSPSAEVVLQVGKKDVDVLSLEPVGSYAVQPHFSDGHGTGIYSWEYLYDLGVNRQALWQSYLERLEAAGARREA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0
Rhizoplane 6.71
Rhizosphere 75.72
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004161 3300003203 Bacteria 6754
2 rootH1_10096354 3300003316 Bacteria 2099
3 rootL2_10079766 3300003322 Bacteria 1714
4 Ga0065707_10081964 3300005295 Bacteria 27001
5 Ga0070683_101057916 3300005329 Bacteria 779
6 Ga0070670_100181826 3300005331 Unclassified 1826
7 Ga0070670_101431831 3300005331 Bacteria 634
8 Ga0070666_10025912 3300005335 Bacteria 3825
9 Ga0070666_10341963 3300005335 Bacteria 1069
10 Ga0070682_100190478 3300005337 Bacteria 1440
11 Ga0070661_100888513 3300005344 Bacteria 735
12 Ga0070675_100786063 3300005354 Bacteria 870
13 Ga0070675_101078034 3300005354 Bacteria 738
14 Ga0070671_100001010 3300005355 Bacteria 20683
15 Ga0070671_100270773 3300005355 Bacteria 1444
16 Ga0070667_100000011 3300005367 Bacteria 269772
17 Ga0070667_100038280 3300005367 Bacteria 4021
18 Ga0070667_100483699 3300005367 Bacteria 1133
19 Ga0070709_10146227 3300005434 Bacteria 1629
20 Ga0070709_10165875 3300005434 Bacteria 1539
21 Ga0070709_10311672 3300005434 Bacteria 1152
22 Ga0070713_100186323 3300005436 Bacteria 1868
23 Ga0070711_100221234 3300005439 Bacteria 1472
24 Ga0070694_100369260 3300005444 Bacteria 1116
25 Ga0070694_100842388 3300005444 Bacteria 754
26 Ga0070663_100016890 3300005455 Bacteria 4750
27 Ga0070678_100573789 3300005456 Bacteria 1004
28 Ga0070662_101383099 3300005457 Bacteria 606
29 Ga0070681_10045493 3300005458 Bacteria 4391
30 Ga0070681_10157278 3300005458 Bacteria 2197
31 Ga0070699_100029409 3300005518 Bacteria 4737
32 Ga0070679_100038601 3300005530 Bacteria 4748
33 Ga0070684_100032314 3300005535 Bacteria 4459
34 Ga0070695_100058360 3300005545 Bacteria 2495
35 Ga0070696_100418943 3300005546 Bacteria 1051
36 Ga0070693_100266517 3300005547 Bacteria 1142
37 Ga0070665_100013430 3300005548 Bacteria 8240
38 Ga0070665_100090629 3300005548 Bacteria 3063
39 Ga0070665_100144570 3300005548 Unclassified 2382
40 Ga0070665_101722205 3300005548 Bacteria 634
41 Ga0068855_101251648 3300005563 Bacteria 770
42 Ga0070664_100445082 3300005564 Bacteria 1189
43 Ga0068857_101349311 3300005577 Unclassified 693
44 Ga0068857_101901465 3300005577 Bacteria 583
45 Ga0068854_100432797 3300005578 Bacteria 1095
46 Ga0068854_101056691 3300005578 Bacteria 721
47 Ga0068856_100250202 3300005614 Bacteria 1787
48 Ga0068856_100658553 3300005614 Bacteria 1068
49 Ga0068859_100000220 3300005617 Bacteria 56619
50 Ga0068859_100077159 3300005617 Bacteria 3373
51 Ga0068859_100506935 3300005617 Bacteria 1302
52 Ga0068864_100377959 3300005618 Bacteria 1342
53 Ga0068864_101550143 3300005618 Bacteria 666
54 Ga0068864_102269475 3300005618 Unclassified 549
55 Ga0068861_100162805 3300005719 Unclassified 1842
56 Ga0068861_100201998 3300005719 Bacteria 1669
57 Ga0068851_10685710 3300005834 Bacteria 629
58 Ga0068863_100003136 3300005841 Bacteria 16324
59 Ga0068863_100013962 3300005841 Bacteria 7742
60 Ga0068858_100005686 3300005842 Bacteria 12185
61 Ga0068858_100007166 3300005842 Bacteria 10817
62 Ga0068858_100380758 3300005842 Bacteria 1354
63 Ga0068858_101326764 3300005842 Bacteria 708
64 Ga0068860_100000355 3300005843 Bacteria 61547
65 Ga0068860_100013566 3300005843 Bacteria 7988
66 Ga0068862_100022607 3300005844 Bacteria 5260
67 Ga0068862_100475855 3300005844 Bacteria 1181
68 Ga0068862_100910972 3300005844 Bacteria 865
69 Ga0081455_10004496 3300005937 Bacteria 15599
70 Ga0081539_10000055 3300005985 Bacteria 257359
71 Ga0070717_10955938 3300006028 Unclassified 780
72 Ga0070715_10076209 3300006163 Bacteria 1511
73 Ga0070716_100332570 3300006173 Bacteria 1069
74 Ga0097621_100487026 3300006237 Bacteria 1115
75 Ga0097621_100591992 3300006237 Bacteria 1013
76 Ga0068871_100103006 3300006358 Bacteria 2393
77 Ga0068871_100547404 3300006358 Bacteria 1048
78 Ga0097620_100000220 3300006931 Bacteria 56619
79 Ga0097620_100077162 3300006931 Bacteria 3373
80 Ga0097620_100506905 3300006931 Bacteria 1302
81 Ga0099795_10067531 3300007788 Bacteria 1342
82 Ga0105250_10041969 3300009092 Unclassified 1833
83 Ga0105240_10150679 3300009093 Bacteria 2770
84 Ga0105240_11438097 3300009093 Bacteria 724
85 Ga0105247_10002339 3300009101 Bacteria 12937
86 Ga0105247_10024472 3300009101 Unclassified 3639
87 Ga0105241_10242409 3300009174 Bacteria 1525
88 Ga0105248_10235150 3300009177 Unclassified 2063
89 Ga0105248_10326235 3300009177 Bacteria 1729
90 Ga0105237_11780073 3300009545 Bacteria 624
91 Ga0105237_11918053 3300009545 Bacteria 600
92 Ga0105238_10089295 3300009551 Unclassified 3069
93 Ga0105238_10359413 3300009551 Bacteria 1445
94 Ga0105249_10056014 3300009553 Bacteria 3609
95 Ga0105249_10532054 3300009553 Bacteria 1224
96 Ga0105249_10701172 3300009553 Bacteria 1072
97 Ga0105239_11295328 3300010375 Bacteria 840
98 Ga0105246_10219797 3300011119 Bacteria 1488
99 Ga0157370_10119899 3300013104 Bacteria 2456
100 Ga0157370_10403735 3300013104 Bacteria 1258
101 Ga0157369_10154728 3300013105 Bacteria 2422
102 Ga0157374_12629664 3300013296 Bacteria 531
103 Ga0157378_10684834 3300013297 Bacteria 1043
104 Ga0163162_10090808 3300013306 Bacteria 3136
105 Ga0163162_10250977 3300013306 Bacteria 1901
106 Ga0157372_10383949 3300013307 Bacteria 1636
107 Ga0163163_10041900 3300014325 Bacteria 4480
108 Ga0163163_10317285 3300014325 Bacteria 1612
109 Ga0157379_10001978 3300014968 Bacteria 16948
110 Ga0157379_10086100 3300014968 Bacteria 2817
111 Ga0157379_10175051 3300014968 Unclassified 1937
112 Ga0157376_11003931 3300014969 Unclassified 857
113 Ga0228598_1004895 3300024227 Bacteria 2819
114 Ga0207656_10032250 3300025321 Bacteria 2175
115 Ga0207696_1035700 3300025711 Unclassified 1478
116 Ga0207710_10001544 3300025900 Bacteria 11332
117 Ga0207710_10172930 3300025900 Bacteria 1057
118 Ga0207680_10014358 3300025903 Bacteria 4095
119 Ga0207680_10032325 3300025903 Bacteria 2974
120 Ga0207647_10019910 3300025904 Bacteria 4505
121 Ga0207699_10011916 3300025906 Bacteria 4407
122 Ga0207699_10198245 3300025906 Bacteria 1359
123 Ga0207699_11001866 3300025906 Bacteria 618
124 Ga0207695_10026166 3300025913 Bacteria 6513
125 Ga0207695_10027562 3300025913 Bacteria 6323
126 Ga0207695_10560590 3300025913 Bacteria 1024
127 Ga0207660_10007266 3300025917 Bacteria 7167
128 Ga0207660_10011615 3300025917 Bacteria 5741
129 Ga0207649_10498531 3300025920 Bacteria 926
130 Ga0207652_11670209 3300025921 Bacteria 541
131 Ga0207694_10059747 3300025924 Bacteria 2966
132 Ga0207694_10075334 3300025924 Bacteria 2641
133 Ga0207650_10100979 3300025925 Bacteria 2220
134 Ga0207644_10011402 3300025931 Bacteria 5880
135 Ga0207706_10317634 3300025933 Bacteria 1356
136 Ga0207665_10183192 3300025939 Bacteria 1518
137 Ga0207711_10222344 3300025941 Unclassified 1727
138 Ga0207711_10555115 3300025941 Bacteria 1071
139 Ga0207711_10688645 3300025941 Bacteria 953
140 Ga0207661_10042987 3300025944 Bacteria 3565
141 Ga0207667_11171392 3300025949 Bacteria 749
142 Ga0207712_10155987 3300025961 Bacteria 1769
143 Ga0207712_10163091 3300025961 Bacteria 1734
144 Ga0207658_10000046 3300025986 Bacteria 130772
145 Ga0207658_10098612 3300025986 Bacteria 2283
146 Ga0207703_10003271 3300026035 Bacteria 13598
147 Ga0207703_10006155 3300026035 Bacteria 9604
148 Ga0207639_10532255 3300026041 Bacteria 1077
149 Ga0207702_11498006 3300026078 Bacteria 668
150 Ga0207641_10001484 3300026088 Bacteria 23002
151 Ga0207641_10030438 3300026088 Bacteria 4471
152 Ga0207676_11257254 3300026095 Bacteria 734
153 Ga0207674_11393986 3300026116 Unclassified 670
154 Ga0207675_100087387 3300026118 Bacteria 2928
155 Ga0207675_100239763 3300026118 Unclassified 1752
156 Ga0207698_10182681 3300026142 Bacteria 1860
157 Ga0268266_10004092 3300028379 Bacteria 14082
158 Ga0268266_10012556 3300028379 Bacteria 7320
159 Ga0268266_10017688 3300028379 Bacteria 6077
160 Ga0268265_10386596 3300028380 Bacteria 1289
161 Ga0268265_10835888 3300028380 Bacteria 900
162 Ga0268265_12179419 3300028380 Bacteria 561
163 Ga0268264_10000085 3300028381 Bacteria 240739
164 Ga0268264_10011987 3300028381 Bacteria 7139
165 Ga0265334_10001271 3300028573 Bacteria 12245
166 Ga0265334_10109804 3300028573 Bacteria 992
167 Ga0265318_10001358 3300028577 Bacteria 14561
168 Ga0307517_10145215 3300028786 Bacteria 1649
169 Ga0307515_10007740 3300028794 Bacteria 21147
170 Ga0265338_10007770 3300028800 Bacteria 13193
171 Ga0265324_10073577 3300029957 Bacteria 1164
172 Ga0307511_10001897 3300030521 Bacteria 21953
173 Ga0307511_10096241 3300030521 Bacteria 1973
174 Ga0265330_10018566 3300031235 Bacteria 3194
175 Ga0265332_10001772 3300031238 Bacteria 11647
176 Ga0265328_10003150 3300031239 Bacteria 7341
177 Ga0265320_10017891 3300031240 Bacteria 3918
178 Ga0265325_10001428 3300031241 Bacteria 16803
179 Ga0265325_10446275 3300031241 Unclassified 564
180 Ga0265329_10001256 3300031242 Bacteria 12399
181 Ga0265340_10010370 3300031247 Bacteria 4985
182 Ga0265340_10020230 3300031247 Bacteria 3424
183 Ga0265340_10100055 3300031247 Bacteria 1348
184 Ga0265339_10009587 3300031249 Bacteria 6069
185 Ga0265331_10019248 3300031250 Bacteria 3527
186 Ga0265316_10028963 3300031344 Bacteria 4560
187 Ga0307408_100359927 3300031548 Bacteria 1237
188 Ga0307408_100882120 3300031548 Bacteria 817
189 Ga0265313_10002857 3300031595 Bacteria 14491
190 Ga0265313_10151885 3300031595 Bacteria 989
191 Ga0307508_10178694 3300031616 Unclassified 1725
192 Ga0307508_10656943 3300031616 Unclassified 654
193 Ga0307514_10391704 3300031649 Bacteria 715
194 Ga0265314_10009630 3300031711 Bacteria 8137
195 Ga0265342_10007273 3300031712 Bacteria 8129
196 Ga0316576_10010475 3300031727 Bacteria 6026
197 Ga0316576_10046536 3300031727 Bacteria 3141
198 Ga0316578_10298791 3300031728 Bacteria 963
199 Ga0307413_11130115 3300031824 Bacteria 678
200 Ga0307518_10149471 3300031838 Unclassified 1618
201 Ga0307410_10550067 3300031852 Bacteria 956
202 Ga0307406_10679970 3300031901 Bacteria 857
203 Ga0307412_11644239 3300031911 Bacteria 587
204 Ga0307409_100051165 3300031995 Bacteria 3160
205 Ga0307416_100681729 3300032002 Bacteria 1115
206 Ga0307411_10003205 3300032005 Bacteria 7536
207 Ga0307415_100093127 3300032126 Bacteria 2187
208 Ga0307510_10000004 3300033180 Bacteria 654130
209 Ga0307510_10153985 3300033180 Unclassified 1910
210 Ga0316215_1005421 3300033544 Bacteria 1229
211 Ga0373936_0021444 3300035113 Bacteria 2512
212 Ga0316574_0020327 3300035398 Bacteria 3929
213 Ga0373927_0641082 3300035695 Unclassified 702
214 Ga0316584_0293465 3300036712 Bacteria 1179
215 Ga0436365_0347073 3300039437 Bacteria 599
216 Ga0436365_0419562 3300039437 Bacteria 1302
217 Ga0436361_1202679 3300039447 Bacteria 632
218 Ga0451793_1780020 3300041452 Bacteria 1007
219 Ga0451795_1205146 3300041456 Bacteria 1860
220 Ga0451800_0508383 3300041459 Bacteria 866
221 Ga0451800_1206790 3300041459 Bacteria 562
222 Ga0451802_0758992 3300041460 Bacteria 527
223 Ga0451807_1250529 3300041486 Bacteria 1786
224 Ga0451577_0016049 3300042876 Bacteria 6947
225 Ga0451577_0115984 3300042876 Bacteria 2398
226 Ga0466969_0000844 3300044656 Bacteria 16634
227 Ga0466969_0011753 3300044656 Bacteria 4630
228 Ga0466972_0043360 3300044658 Bacteria 2185
229 Ga0466966_0000352 3300044684 Bacteria 29833
230 Ga0466966_0063640 3300044684 Bacteria 2324
231 Ga0466961_0000364 3300044693 Bacteria 29379
232 Ga0466963_1179476 3300044694 Unclassified 538
233 Ga0466964_0000030 3300044706 Bacteria 29509
234 Ga0453684_0399521 3300044712 Bacteria 1539
235 Ga0466971_0000134 3300044719 Bacteria 27209
236 Ga0466970_0000166 3300044765 Bacteria 31421
237 Ga0466957_0001082 3300044842 Bacteria 14059
238 Ga0466959_0000393 3300045049 Bacteria 25650
239 Ga0466959_0041256 3300045049 Bacteria 3407
240 Ga0466959_0090345 3300045049 Bacteria 2200
241 Ga0451576_0059422 3300045051 Bacteria 3990
242 Ga0451576_0120985 3300045051 Bacteria 2725
243 Ga0466958_0086290 3300045836 Bacteria 1937
244 Ga0495638_0662339 3300046460 Bacteria 506
245 Ga0495580_0566040 3300046472 Bacteria 753
246 Ga0495606_0097192 3300046507 Unclassified 1800
247 Ga0495632_0045293 3300046519 Bacteria 2192
248 Ga0495632_0156785 3300046519 Bacteria 1050
249 Ga0495643_0259702 3300046522 Bacteria 807
250 Ga0495648_0067923 3300046524 Bacteria 2083
251 Ga0495611_0085111 3300046648 Bacteria 1458
252 Ga0495671_0520654 3300046692 Bacteria 567
253 Ga0495687_061598 3300047443 Bacteria 1543
254 Ga0495673_0272391 3300047469 Bacteria 613
255 Ga0495686_0080231 3300047472 Bacteria 1995
256 Ga0496100_0272958 3300048903 Bacteria 1258
257 Ga0496101_0842316 3300048904 Bacteria 723
258 Ga0496101_0876911 3300048904 Bacteria 707
259 Ga0496101_0892130 3300048904 Unclassified 700
260 Ga0496102_0002132 3300048905 Bacteria 17010
261 Ga0496102_0007331 3300048905 Bacteria 9418
262 Ga0496102_0091057 3300048905 Unclassified 2823
263 Ga0496103_0306539 3300048906 Unclassified 1022
264 Ga0496106_0341783 3300048909 Unclassified 1202
265 Ga0496106_1415419 3300048909 Unclassified 537
266 Ga0496112_0621029 3300048915 Bacteria 1012
267 Ga0496114_0047424 3300048917 Bacteria 3574
268 Ga0496114_0101976 3300048917 Bacteria 2451
269 Ga0496115_0188594 3300048918 Bacteria 1704
270 Ga0496115_0789847 3300048918 Unclassified 740
271 Ga0496117_0000251 3300048920 Bacteria 101431
272 Ga0496117_0058137 3300048920 Bacteria 2680
273 Ga0496118_0000026 3300048921 Bacteria 375725
274 Ga0496118_0043701 3300048921 Bacteria 3518
275 Ga0496118_0143735 3300048921 Unclassified 1507
276 Ga0496118_0149403 3300048921 Bacteria 1465
277 Ga0496119_0000965 3300048922 Bacteria 36888
278 Ga0496119_0017416 3300048922 Bacteria 5404
279 Ga0496119_0028003 3300048922 Bacteria 3857
280 Ga0496119_0205852 3300048922 Unclassified 1015
281 Ga0496120_0000025 3300048923 Bacteria 235805
282 Ga0496120_0061868 3300048923 Bacteria 2087
283 Ga0496120_0328257 3300048923 Bacteria 693
284 Ga0496121_0002537 3300048924 Bacteria 27677
285 Ga0496121_0025297 3300048924 Bacteria 5639
286 Ga0496121_0805595 3300048924 Bacteria 551
287 Ga0496124_0446961 3300048927 Unclassified 882
288 Ga0496125_0002047 3300048928 Bacteria 27258
289 Ga0496125_0049803 3300048928 Bacteria 3476
290 Ga0496125_0228409 3300048928 Unclassified 1192
291 Ga0496126_0001746 3300048929 Bacteria 32210
292 Ga0496126_0024163 3300048929 Bacteria 5870
293 Ga0501076_0365755 3300049592 Bacteria 1185
294 Ga0500635_0220905 3300053080 Bacteria 740
295 Ga0500646_0324873 3300053090 Bacteria 556
296 Ga0500583_0078157 3300053092 Bacteria 1594
297 Ga0500651_0190553 3300053093 Bacteria 1214
298 Ga0500556_0001203 3300053104 Bacteria 12175
299 Ga0500562_076792 3300053108 Bacteria 903
300 Ga0500614_192890 3300053123 Bacteria 626
301 Ga0500658_0138034 3300053134 Unclassified 1092
302 Ga0500568_0274581 3300053139 Bacteria 613
303 Ga0500577_0472218 3300053142 Bacteria 548
304 Ga0500616_0000096 3300053153 Bacteria 179125
305 Ga0500616_0081400 3300053153 Bacteria 1626
306 Ga0500622_0050033 3300053156 Bacteria 2153
307 Ga0500630_073180 3300053159 Bacteria 1617
308 Ga0500639_056447 3300053163 Bacteria 2034
309 Ga0500636_0223868 3300053177 Bacteria 978
310 Ga0500637_0015175 3300053178 Bacteria 4077
311 Ga0500637_0319713 3300053178 Bacteria 839
312 Ga0587111_0172101 3300060346 Bacteria 596
313 Ga0466962_0000084 3300061719 Bacteria 37853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_100842388 Ga0070694_1008423882 103
2 3300005329 Ga0070683_101057916 Ga0070683_1010579161 104
3 3300005439 Ga0070711_100221234 Ga0070711_1002212342 108
4 3300005456 Ga0070678_100573789 Ga0070678_1005737892 108
5 3300005577 Ga0068857_101901465 Ga0068857_1019014652 108
6 3300006237 Ga0097621_100591992 Ga0097621_1005919922 108
7 3300006358 Ga0068871_100103006 Ga0068871_1001030062 108
8 3300005295 Ga0065707_10081964 Ga0065707_1008196429 109
9 3300005434 Ga0070709_10311672 Ga0070709_103116722 109
10 3300005548 Ga0070665_101722205 Ga0070665_1017222052 109
11 3300006163 Ga0070715_10076209 Ga0070715_100762092 109
12 3300009093 Ga0105240_11438097 Ga0105240_114380972 109
13 3300013104 Ga0157370_10119899 Ga0157370_101198993 109
14 3300013105 Ga0157369_10154728 Ga0157369_101547282 109
15 3300025906 Ga0207699_10198245 Ga0207699_101982452 109
16 3300028380 Ga0268265_10835888 Ga0268265_108358882 109
17 3300031247 Ga0265340_10100055 Ga0265340_101000552 109
18 3300031548 Ga0307408_100359927 Ga0307408_1003599272 109
19 3300031852 Ga0307410_10550067 Ga0307410_105500672 109
20 3300031995 Ga0307409_100051165 Ga0307409_1000511653 109
21 3300032002 Ga0307416_100681729 Ga0307416_1006817292 109
22 3300032005 Ga0307411_10003205 Ga0307411_100032055 109
23 3300032126 Ga0307415_100093127 Ga0307415_1000931272 109
24 3300033544 Ga0316215_1005421 Ga0316215_10054212 109
25 3300041459 Ga0451800_1206790 Ga0451800_1206790_181_531 109
26 3300041460 Ga0451802_0758992 Ga0451802_0758992_97_447 109
27 3300048904 Ga0496101_0876911 Ga0496101_0876911_42_383 109
28 3300048917 Ga0496114_0101976 Ga0496114_0101976_2043_2384 109
29 3300053092 Ga0500583_0078157 Ga0500583_0078157_1063_1413 109
30 3300053139 Ga0500568_0274581 Ga0500568_0274581_27_377 109
31 3300053153 Ga0500616_0000096 Ga0500616_0000096_63755_64105 109
32 3300053177 Ga0500636_0223868 Ga0500636_0223868_525_872 109
33 3300053178 Ga0500637_0319713 Ga0500637_0319713_112_459 109
34 3300005331 Ga0070670_101431831 Ga0070670_1014318311 110
35 3300005563 Ga0068855_101251648 Ga0068855_1012516481 110
36 3300005844 Ga0068862_100475855 Ga0068862_1004758553 110
37 3300006358 Ga0068871_100547404 Ga0068871_1005474042 110
38 3300009545 Ga0105237_11918053 Ga0105237_119180531 110
39 3300024227 Ga0228598_1004895 Ga0228598_10048954 110
40 3300025906 Ga0207699_11001866 Ga0207699_110018662 110
41 3300028379 Ga0268266_10017688 Ga0268266_100176883 110
42 3300028380 Ga0268265_10386596 Ga0268265_103865961 110
43 3300028380 Ga0268265_12179419 Ga0268265_121794192 110
44 3300031548 Ga0307408_100882120 Ga0307408_1008821202 110
45 3300031727 Ga0316576_10046536 Ga0316576_100465363 110
46 3300031728 Ga0316578_10298791 Ga0316578_102987911 110
47 3300031824 Ga0307413_11130115 Ga0307413_111301151 110
48 3300031901 Ga0307406_10679970 Ga0307406_106799702 110
49 3300031911 Ga0307412_11644239 Ga0307412_116442392 110
50 3300036712 Ga0316584_0293465 Ga0316584_0293465_77_433 110
51 3300039437 Ga0436365_0347073 Ga0436365_0347073_48_398 110
52 3300039447 Ga0436361_1202679 Ga0436361_1202679_243_593 110
53 3300041456 Ga0451795_1205146 Ga0451795_1205146_367_720 110
54 3300041486 Ga0451807_1250529 Ga0451807_1250529_1182_1535 110
55 3300053104 Ga0500556_0001203 Ga0500556_0001203_4858_5205 110
56 3300053153 Ga0500616_0081400 Ga0500616_0081400_32_388 110
57 3300003316 rootH1_10096354 rootH1_100963542 111
58 3300005344 Ga0070661_100888513 Ga0070661_1008885132 111
59 3300005354 Ga0070675_100786063 Ga0070675_1007860631 111
60 3300005354 Ga0070675_101078034 Ga0070675_1010780341 111
61 3300005458 Ga0070681_10045493 Ga0070681_100454932 111
62 3300005530 Ga0070679_100038601 Ga0070679_1000386014 111
63 3300005535 Ga0070684_100032314 Ga0070684_1000323142 111
64 3300005577 Ga0068857_101349311 Ga0068857_1013493111 111
65 3300005937 Ga0081455_10004496 Ga0081455_100044967 111
66 3300025917 Ga0207660_10011615 Ga0207660_100116154 111
67 3300025944 Ga0207661_10042987 Ga0207661_100429874 111
68 3300026116 Ga0207674_11393986 Ga0207674_113939862 111
69 3300028573 Ga0265334_10109804 Ga0265334_101098042 111
70 3300030521 Ga0307511_10096241 Ga0307511_100962412 111
71 3300031649 Ga0307514_10391704 Ga0307514_103917042 111
72 3300035113 Ga0373936_0021444 Ga0373936_0021444_96_446 111
73 3300048922 Ga0496119_0000965 Ga0496119_0000965_23418_23771 111
74 3300048923 Ga0496120_0000025 Ga0496120_0000025_3265_3618 111
75 3300053159 Ga0500630_073180 Ga0500630_073180_223_573 111
76 3300053163 Ga0500639_056447 Ga0500639_056447_273_623 111
77 3300060346 Ga0587111_0172101 Ga0587111_0172101_42_398 111
78 3300005578 Ga0068854_100432797 Ga0068854_1004327972 112
79 3300005614 Ga0068856_100658553 Ga0068856_1006585532 112
80 3300006173 Ga0070716_100332570 Ga0070716_1003325702 112
81 3300014968 Ga0157379_10086100 Ga0157379_100861002 112
82 3300025913 Ga0207695_10027562 Ga0207695_100275624 112
83 3300025939 Ga0207665_10183192 Ga0207665_101831922 112
84 3300028786 Ga0307517_10145215 Ga0307517_101452152 112
85 3300031595 Ga0265313_10151885 Ga0265313_101518852 112
86 3300044656 Ga0466969_0011753 Ga0466969_0011753_1429_1785 112
87 3300044684 Ga0466966_0063640 Ga0466966_0063640_71_427 112
88 3300045049 Ga0466959_0041256 Ga0466959_0041256_2382_2738 112
89 3300046648 Ga0495611_0085111 Ga0495611_0085111_655_1044 112
90 3300047469 Ga0495673_0272391 Ga0495673_0272391_174_563 112
91 3300049592 Ga0501076_0365755 Ga0501076_0365755_547_915 112
92 3300005719 Ga0068861_100201998 Ga0068861_1002019982 113
93 3300005842 Ga0068858_100380758 Ga0068858_1003807582 113
94 3300009553 Ga0105249_10701172 Ga0105249_107011721 113
95 3300025961 Ga0207712_10163091 Ga0207712_101630913 113
96 3300026118 Ga0207675_100087387 Ga0207675_1000873871 113
97 3300031241 Ga0265325_10446275 Ga0265325_104462751 113
98 3300031727 Ga0316576_10010475 Ga0316576_100104752 113
99 3300035398 Ga0316574_0020327 Ga0316574_0020327_1370_1765 113
100 3300046519 Ga0495632_0045293 Ga0495632_0045293_411_770 113
101 3300053093 Ga0500651_0190553 Ga0500651_0190553_219_581 113
102 3300053108 Ga0500562_076792 Ga0500562_076792_171_530 113
103 3300053142 Ga0500577_0472218 Ga0500577_0472218_156_515 113
104 3300053156 Ga0500622_0050033 Ga0500622_0050033_83_445 113
105 3300003322 rootL2_10079766 rootL2_100797662 114
106 3300005331 Ga0070670_100181826 Ga0070670_1001818262 114
107 3300005335 Ga0070666_10025912 Ga0070666_100259122 114
108 3300005335 Ga0070666_10341963 Ga0070666_103419632 114
109 3300005337 Ga0070682_100190478 Ga0070682_1001904782 114
110 3300005355 Ga0070671_100001010 Ga0070671_10000101014 114
111 3300005355 Ga0070671_100270773 Ga0070671_1002707732 114
112 3300005367 Ga0070667_100000011 Ga0070667_100000011223 114
113 3300005367 Ga0070667_100038280 Ga0070667_1000382803 114
114 3300005367 Ga0070667_100483699 Ga0070667_1004836992 114
115 3300005434 Ga0070709_10146227 Ga0070709_101462272 114
116 3300005434 Ga0070709_10165875 Ga0070709_101658751 114
117 3300005436 Ga0070713_100186323 Ga0070713_1001863233 114
118 3300005444 Ga0070694_100369260 Ga0070694_1003692603 114
119 3300005455 Ga0070663_100016890 Ga0070663_1000168905 114
120 3300005457 Ga0070662_101383099 Ga0070662_1013830991 114
121 3300005458 Ga0070681_10157278 Ga0070681_101572781 114
122 3300005518 Ga0070699_100029409 Ga0070699_1000294096 114
123 3300005545 Ga0070695_100058360 Ga0070695_1000583602 114
124 3300005546 Ga0070696_100418943 Ga0070696_1004189433 114
125 3300005547 Ga0070693_100266517 Ga0070693_1002665172 114
126 3300005548 Ga0070665_100013430 Ga0070665_1000134302 114
127 3300005548 Ga0070665_100090629 Ga0070665_1000906293 114
128 3300005548 Ga0070665_100144570 Ga0070665_1001445702 114
129 3300005564 Ga0070664_100445082 Ga0070664_1004450822 114
130 3300005578 Ga0068854_101056691 Ga0068854_1010566911 114
131 3300005614 Ga0068856_100250202 Ga0068856_1002502022 114
132 3300005617 Ga0068859_100000220 Ga0068859_10000022017 114
133 3300005617 Ga0068859_100077159 Ga0068859_1000771593 114
134 3300005617 Ga0068859_100506935 Ga0068859_1005069352 114
135 3300005618 Ga0068864_100377959 Ga0068864_1003779592 114
136 3300005618 Ga0068864_101550143 Ga0068864_1015501432 114
137 3300005618 Ga0068864_102269475 Ga0068864_1022694751 114
138 3300005719 Ga0068861_100162805 Ga0068861_1001628052 114
139 3300005834 Ga0068851_10685710 Ga0068851_106857101 114
140 3300005841 Ga0068863_100003136 Ga0068863_1000031362 114
141 3300005841 Ga0068863_100013962 Ga0068863_1000139625 114
142 3300005842 Ga0068858_100005686 Ga0068858_1000056866 114
143 3300005842 Ga0068858_100007166 Ga0068858_1000071668 114
144 3300005842 Ga0068858_101326764 Ga0068858_1013267642 114
145 3300005843 Ga0068860_100000355 Ga0068860_10000035512 114
146 3300005843 Ga0068860_100013566 Ga0068860_1000135662 114
147 3300005844 Ga0068862_100022607 Ga0068862_1000226076 114
148 3300005844 Ga0068862_100910972 Ga0068862_1009109721 114
149 3300005985 Ga0081539_10000055 Ga0081539_1000005539 114
150 3300006028 Ga0070717_10955938 Ga0070717_109559381 114
151 3300006237 Ga0097621_100487026 Ga0097621_1004870262 114
152 3300006931 Ga0097620_100000220 Ga0097620_10000022017 114
153 3300006931 Ga0097620_100077162 Ga0097620_1000771623 114
154 3300006931 Ga0097620_100506905 Ga0097620_1005069052 114
155 3300007788 Ga0099795_10067531 Ga0099795_100675312 114
156 3300009092 Ga0105250_10041969 Ga0105250_100419692 114
157 3300009093 Ga0105240_10150679 Ga0105240_101506791 114
158 3300009101 Ga0105247_10002339 Ga0105247_100023397 114
159 3300009101 Ga0105247_10024472 Ga0105247_100244722 114
160 3300009174 Ga0105241_10242409 Ga0105241_102424092 114
161 3300009177 Ga0105248_10235150 Ga0105248_102351502 114
162 3300009177 Ga0105248_10326235 Ga0105248_103262351 114
163 3300009545 Ga0105237_11780073 Ga0105237_117800731 114
164 3300009551 Ga0105238_10089295 Ga0105238_100892953 114
165 3300009551 Ga0105238_10359413 Ga0105238_103594132 114
166 3300009553 Ga0105249_10056014 Ga0105249_100560142 114
167 3300009553 Ga0105249_10532054 Ga0105249_105320542 114
168 3300010375 Ga0105239_11295328 Ga0105239_112953281 114
169 3300011119 Ga0105246_10219797 Ga0105246_102197972 114
170 3300013104 Ga0157370_10403735 Ga0157370_104037352 114
171 3300013296 Ga0157374_12629664 Ga0157374_126296641 114
172 3300013297 Ga0157378_10684834 Ga0157378_106848342 114
173 3300013306 Ga0163162_10090808 Ga0163162_100908082 114
174 3300013306 Ga0163162_10250977 Ga0163162_102509772 114
175 3300013307 Ga0157372_10383949 Ga0157372_103839492 114
176 3300014325 Ga0163163_10041900 Ga0163163_100419003 114
177 3300014325 Ga0163163_10317285 Ga0163163_103172852 114
178 3300014968 Ga0157379_10001978 Ga0157379_100019784 114
179 3300014968 Ga0157379_10175051 Ga0157379_101750513 114
180 3300014969 Ga0157376_11003931 Ga0157376_110039312 114
181 3300025321 Ga0207656_10032250 Ga0207656_100322501 114
182 3300025711 Ga0207696_1035700 Ga0207696_10357002 114
183 3300025900 Ga0207710_10001544 Ga0207710_100015444 114
184 3300025900 Ga0207710_10172930 Ga0207710_101729302 114
185 3300025903 Ga0207680_10014358 Ga0207680_100143583 114
186 3300025903 Ga0207680_10032325 Ga0207680_100323254 114
187 3300025904 Ga0207647_10019910 Ga0207647_100199103 114
188 3300025906 Ga0207699_10011916 Ga0207699_100119165 114
189 3300025913 Ga0207695_10026166 Ga0207695_100261664 114
190 3300025913 Ga0207695_10560590 Ga0207695_105605902 114
191 3300025917 Ga0207660_10007266 Ga0207660_100072663 114
192 3300025920 Ga0207649_10498531 Ga0207649_104985311 114
193 3300025921 Ga0207652_11670209 Ga0207652_116702091 114
194 3300025924 Ga0207694_10059747 Ga0207694_100597473 114
195 3300025924 Ga0207694_10075334 Ga0207694_100753342 114
196 3300025925 Ga0207650_10100979 Ga0207650_101009792 114
197 3300025931 Ga0207644_10011402 Ga0207644_100114022 114
198 3300025933 Ga0207706_10317634 Ga0207706_103176341 114
199 3300025941 Ga0207711_10222344 Ga0207711_102223442 114
200 3300025941 Ga0207711_10555115 Ga0207711_105551151 114
201 3300025941 Ga0207711_10688645 Ga0207711_106886451 114
202 3300025949 Ga0207667_11171392 Ga0207667_111713922 114
203 3300025961 Ga0207712_10155987 Ga0207712_101559872 114
204 3300025986 Ga0207658_10000046 Ga0207658_1000004681 114
205 3300025986 Ga0207658_10098612 Ga0207658_100986122 114
206 3300026035 Ga0207703_10003271 Ga0207703_100032718 114
207 3300026035 Ga0207703_10006155 Ga0207703_100061555 114
208 3300026041 Ga0207639_10532255 Ga0207639_105322552 114
209 3300026078 Ga0207702_11498006 Ga0207702_114980061 114
210 3300026088 Ga0207641_10001484 Ga0207641_100014845 114
211 3300026088 Ga0207641_10030438 Ga0207641_100304384 114
212 3300026095 Ga0207676_11257254 Ga0207676_112572542 114
213 3300026118 Ga0207675_100239763 Ga0207675_1002397632 114
214 3300026142 Ga0207698_10182681 Ga0207698_101826811 114
215 3300028379 Ga0268266_10004092 Ga0268266_100040928 114
216 3300028379 Ga0268266_10012556 Ga0268266_100125562 114
217 3300028381 Ga0268264_10000085 Ga0268264_1000008557 114
218 3300028381 Ga0268264_10011987 Ga0268264_100119877 114
219 3300028573 Ga0265334_10001271 Ga0265334_1000127112 114
220 3300028577 Ga0265318_10001358 Ga0265318_100013587 114
221 3300028800 Ga0265338_10007770 Ga0265338_100077705 114
222 3300029957 Ga0265324_10073577 Ga0265324_100735772 114
223 3300030521 Ga0307511_10001897 Ga0307511_1000189724 114
224 3300031235 Ga0265330_10018566 Ga0265330_100185662 114
225 3300031238 Ga0265332_10001772 Ga0265332_100017724 114
226 3300031239 Ga0265328_10003150 Ga0265328_100031509 114
227 3300031240 Ga0265320_10017891 Ga0265320_100178913 114
228 3300031241 Ga0265325_10001428 Ga0265325_1000142812 114
229 3300031242 Ga0265329_10001256 Ga0265329_100012569 114
230 3300031247 Ga0265340_10010370 Ga0265340_100103704 114
231 3300031247 Ga0265340_10020230 Ga0265340_100202305 114
232 3300031249 Ga0265339_10009587 Ga0265339_100095872 114
233 3300031250 Ga0265331_10019248 Ga0265331_100192483 114
234 3300031344 Ga0265316_10028963 Ga0265316_100289633 114
235 3300031595 Ga0265313_10002857 Ga0265313_100028577 114
236 3300031616 Ga0307508_10178694 Ga0307508_101786942 114
237 3300031616 Ga0307508_10656943 Ga0307508_106569431 114
238 3300031711 Ga0265314_10009630 Ga0265314_100096303 114
239 3300031712 Ga0265342_10007273 Ga0265342_100072739 114
240 3300031838 Ga0307518_10149471 Ga0307518_101494712 114
241 3300033180 Ga0307510_10000004 Ga0307510_10000004188 114
242 3300033180 Ga0307510_10153985 Ga0307510_101539852 114
243 3300035695 Ga0373927_0641082 Ga0373927_0641082_270_635 114
244 3300039437 Ga0436365_0419562 Ga0436365_0419562_74_439 114
245 3300041452 Ga0451793_1780020 Ga0451793_1780020_25_390 114
246 3300041459 Ga0451800_0508383 Ga0451800_0508383_130_495 114
247 3300042876 Ga0451577_0016049 Ga0451577_0016049_1094_1504 114
248 3300042876 Ga0451577_0115984 Ga0451577_0115984_1886_2281 114
249 3300044656 Ga0466969_0000844 Ga0466969_0000844_14854_15243 114
250 3300044658 Ga0466972_0043360 Ga0466972_0043360_1771_2160 114
251 3300044684 Ga0466966_0000352 Ga0466966_0000352_3720_4109 114
252 3300044693 Ga0466961_0000364 Ga0466961_0000364_17364_17753 114
253 3300044694 Ga0466963_1179476 Ga0466963_1179476_63_428 114
254 3300044706 Ga0466964_0000030 Ga0466964_0000030_20063_20452 114
255 3300044712 Ga0453684_0399521 Ga0453684_0399521_739_1149 114
256 3300044719 Ga0466971_0000134 Ga0466971_0000134_15471_15860 114
257 3300044765 Ga0466970_0000166 Ga0466970_0000166_20830_21219 114
258 3300044842 Ga0466957_0001082 Ga0466957_0001082_10222_10611 114
259 3300045049 Ga0466959_0000393 Ga0466959_0000393_9791_10180 114
260 3300045049 Ga0466959_0090345 Ga0466959_0090345_529_894 114
261 3300045051 Ga0451576_0059422 Ga0451576_0059422_2398_2799 114
262 3300045051 Ga0451576_0120985 Ga0451576_0120985_882_1292 114
263 3300045836 Ga0466958_0086290 Ga0466958_0086290_551_940 114
264 3300046460 Ga0495638_0662339 Ga0495638_0662339_115_480 114
265 3300046472 Ga0495580_0566040 Ga0495580_0566040_87_452 114
266 3300046507 Ga0495606_0097192 Ga0495606_0097192_338_703 114
267 3300046519 Ga0495632_0156785 Ga0495632_0156785_324_689 114
268 3300046522 Ga0495643_0259702 Ga0495643_0259702_262_627 114
269 3300046524 Ga0495648_0067923 Ga0495648_0067923_981_1346 114
270 3300046692 Ga0495671_0520654 Ga0495671_0520654_21_386 114
271 3300047443 Ga0495687_061598 Ga0495687_061598_642_1007 114
272 3300047472 Ga0495686_0080231 Ga0495686_0080231_1104_1469 114
273 3300048903 Ga0496100_0272958 Ga0496100_0272958_298_663 114
274 3300048904 Ga0496101_0842316 Ga0496101_0842316_52_417 114
275 3300048904 Ga0496101_0892130 Ga0496101_0892130_60_425 114
276 3300048905 Ga0496102_0002132 Ga0496102_0002132_11757_12116 114
277 3300048905 Ga0496102_0007331 Ga0496102_0007331_2291_2656 114
278 3300048905 Ga0496102_0091057 Ga0496102_0091057_1480_1845 114
279 3300048906 Ga0496103_0306539 Ga0496103_0306539_125_490 114
280 3300048909 Ga0496106_0341783 Ga0496106_0341783_240_605 114
281 3300048909 Ga0496106_1415419 Ga0496106_1415419_24_386 114
282 3300048915 Ga0496112_0621029 Ga0496112_0621029_322_687 114
283 3300048917 Ga0496114_0047424 Ga0496114_0047424_2763_3128 114
284 3300048918 Ga0496115_0188594 Ga0496115_0188594_343_720 114
285 3300048918 Ga0496115_0789847 Ga0496115_0789847_344_709 114
286 3300048920 Ga0496117_0000251 Ga0496117_0000251_34321_34686 114
287 3300048920 Ga0496117_0058137 Ga0496117_0058137_1745_2104 114
288 3300048921 Ga0496118_0000026 Ga0496118_0000026_367116_367481 114
289 3300048921 Ga0496118_0043701 Ga0496118_0043701_3093_3452 114
290 3300048921 Ga0496118_0143735 Ga0496118_0143735_1059_1424 114
291 3300048921 Ga0496118_0149403 Ga0496118_0149403_1073_1438 114
292 3300048922 Ga0496119_0017416 Ga0496119_0017416_77_442 114
293 3300048922 Ga0496119_0028003 Ga0496119_0028003_643_1008 114
294 3300048922 Ga0496119_0205852 Ga0496119_0205852_435_800 114
295 3300048923 Ga0496120_0061868 Ga0496120_0061868_917_1282 114
296 3300048923 Ga0496120_0328257 Ga0496120_0328257_233_598 114
297 3300048924 Ga0496121_0002537 Ga0496121_0002537_11154_11519 114
298 3300048924 Ga0496121_0025297 Ga0496121_0025297_3030_3395 114
299 3300048924 Ga0496121_0805595 Ga0496121_0805595_155_520 114
300 3300048927 Ga0496124_0446961 Ga0496124_0446961_415_780 114
301 3300048928 Ga0496125_0002047 Ga0496125_0002047_17981_18346 114
302 3300048928 Ga0496125_0049803 Ga0496125_0049803_133_498 114
303 3300048928 Ga0496125_0228409 Ga0496125_0228409_642_1007 114
304 3300048929 Ga0496126_0001746 Ga0496126_0001746_13822_14199 114
305 3300048929 Ga0496126_0024163 Ga0496126_0024163_1308_1673 114
306 3300053080 Ga0500635_0220905 Ga0500635_0220905_209_574 114
307 3300053090 Ga0500646_0324873 Ga0500646_0324873_43_408 114
308 3300053123 Ga0500614_192890 Ga0500614_192890_111_476 114
309 3300053134 Ga0500658_0138034 Ga0500658_0138034_451_816 114
310 3300053178 Ga0500637_0015175 Ga0500637_0015175_1727_2089 114
311 3300061719 Ga0466962_0000084 Ga0466962_0000084_28606_28995 114
312 3300003203 JGI25406J46586_10004161 JGI25406J46586_100041615 116
313 3300028794 Ga0307515_10007740 Ga0307515_1000774017 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

12

88

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.9432 4 99
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.9023 4 99
5tul-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(55) 0.8899 6 31
2l6p-assembly1.cif.gz_A nmr solution structure of the protein np_253742.1 0.878 5 115
2l6n-assembly1.cif.gz_A nmr solution structure of the protein yp_001092504.1 0.8615 6 116
ID Description Score Start End Superfamily
3luuA00 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9412 4 99 3.30.2020.30
af_F1Q6R7_532_775_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9121 7 32 2.130.10.10
af_A0A0P0WS15_683_864_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9114 10 34 2.130.10.10
af_Q54GQ0_68_145_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8995 29 97 3.30.2020.30
3luuA00 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8995 4 99 3.30.2020.30
ID Description Score Start End GO Terms
AF-G7EIC3-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9787 54 115 GO:0046872
AF-A0A3B9TVQ7-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9715 58 115 GO:0046872
AF-A0A841HJ93-F1-model_v4 DUF971 family protein 0.9696 6 115 GO:0046872
AF-F5SZZ2-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9684 55 115 GO:0046872
AF-A0A534CPT4-F1-model_v4 DUF971 domain-containing protein 0.967 6 114 GO:0046872

Feature Viewer

pLDDT pTM Quality
85.86 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map