F401116

General Info

Members Datasets Scaffolds Average Seq Length
311 204 622 186

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100687299|Ga0068855_1006872992
Length 214
Sequence MSKTESKMVELGTEAPAFEVLDVVKGEPWGRDDVFAQSWDDDVSDQVNMMAGGGTSKHGRHGMLLMFICVHCPYVKHVEQELARIGRDYEGRIGIAAISSNDIGAYPEDSPEHMKEQALRLGFNFPYLFDETQETARSYGAACTPDFFLFDAEMKLVYRGQLDDSRPQRASGGGNDIPVTGKDLRAAMDAVIAGKRPDTNQRSSIGCNIKWRES

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 0.64
Rhizosphere 96.78
Stem 0
Stem Tuber 0
Unclassified 5.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100687299 3300005563 Bacteria 1096
2 SwRhRL3b_contig_1124861 2162886006 Bacteria 1165
3 LJNas_1009633 3300000546 Bacteria 1032
4 rootH1_10110982 3300003316 Bacteria 1469
5 rootH2_10105308 3300003320 Bacteria 2612
6 Ga0065712_10424025 3300005290 Bacteria 709
7 Ga0065715_10211397 3300005293 Unclassified 1312
8 Ga0065715_10279425 3300005293 Bacteria 1090
9 Ga0065707_10000566 3300005295 Bacteria 26530
10 Ga0070658_10000006 3300005327 Bacteria 374835
11 Ga0070658_10018824 3300005327 Bacteria 5532
12 Ga0070658_10080282 3300005327 Bacteria 2679
13 Ga0070683_100071273 3300005329 Bacteria 3242
14 Ga0070670_100141449 3300005331 Bacteria 2081
15 Ga0070680_100018754 3300005336 Bacteria 5474
16 Ga0070680_100314899 3300005336 Bacteria 1328
17 Ga0070680_100668836 3300005336 Bacteria 893
18 Ga0070682_100436394 3300005337 Bacteria 999
19 Ga0070660_100036401 3300005339 Bacteria 3728
20 Ga0070660_100109386 3300005339 Bacteria 2197
21 Ga0070660_100120303 3300005339 Bacteria 2095
22 Ga0070660_100164214 3300005339 Bacteria 1791
23 Ga0070660_100317548 3300005339 Bacteria 1279
24 Ga0070661_100007186 3300005344 Bacteria 7674
25 Ga0070692_10009799 3300005345 Bacteria 4336
26 Ga0070668_100195610 3300005347 Bacteria 1658
27 Ga0070671_100001020 3300005355 Bacteria 20592
28 Ga0070674_100647390 3300005356 Bacteria 898
29 Ga0070659_100021996 3300005366 Bacteria 4865
30 Ga0070659_100025241 3300005366 Bacteria 4562
31 Ga0070667_101054452 3300005367 Bacteria 759
32 Ga0070701_10092680 3300005438 Bacteria 1658
33 Ga0070708_100038073 3300005445 Bacteria 4199
34 Ga0070663_100048156 3300005455 Bacteria 3021
35 Ga0070663_100052845 3300005455 Bacteria 2899
36 Ga0070663_100409778 3300005455 Bacteria 1110
37 Ga0070678_100920141 3300005456 Unclassified 800
38 Ga0070662_100255949 3300005457 Bacteria 1409
39 Ga0070681_10019682 3300005458 Bacteria 6760
40 Ga0070707_100025163 3300005468 Bacteria 5644
41 Ga0070707_100087813 3300005468 Bacteria 3008
42 Ga0070679_100121792 3300005530 Bacteria 2593
43 Ga0070679_100198435 3300005530 Bacteria 1973
44 Ga0070679_100235457 3300005530 Bacteria 1790
45 Ga0070684_100025543 3300005535 Bacteria 4967
46 Ga0068853_100000174 3300005539 Bacteria 44771
47 Ga0068853_100119703 3300005539 Bacteria 2347
48 Ga0068853_100177082 3300005539 Bacteria 1932
49 Ga0070686_100010810 3300005544 Archaea 5161
50 Ga0070665_100024793 3300005548 Bacteria 6042
51 Ga0070665_100075553 3300005548 Bacteria 3376
52 Ga0068855_100072781 3300005563 Bacteria 3994
53 Ga0068855_100080166 3300005563 Bacteria 3785
54 Ga0068855_100117591 3300005563 Bacteria 3045
55 Ga0068855_100156770 3300005563 Bacteria 2586
56 Ga0068857_100034906 3300005577 Bacteria 4450
57 Ga0068854_100000186 3300005578 Bacteria 41742
58 Ga0068854_100003111 3300005578 Bacteria 10323
59 Ga0068854_100299630 3300005578 Bacteria 1300
60 Ga0068856_100565722 3300005614 Bacteria 1158
61 Ga0068856_100922237 3300005614 Bacteria 892
62 Ga0070702_100674246 3300005615 Bacteria 785
63 Ga0068852_100150635 3300005616 Bacteria 2163
64 Ga0068859_100406375 3300005617 Unclassified 1458
65 Ga0068863_100026667 3300005841 Bacteria 5510
66 Ga0068863_100433395 3300005841 Bacteria 1289
67 Ga0068858_100626249 3300005842 Bacteria 1045
68 Ga0068862_100187668 3300005844 Bacteria 1859
69 Ga0075432_10020261 3300006058 Bacteria 2274
70 Ga0075367_10144556 3300006178 Bacteria 1474
71 Ga0097621_100058707 3300006237 Bacteria 3148
72 Ga0068871_100036316 3300006358 Bacteria 3923
73 Ga0075428_100000007 3300006844 Bacteria 273226
74 Ga0075430_100455792 3300006846 Bacteria 1055
75 Ga0075431_100013407 3300006847 Bacteria 8282
76 Ga0075429_100581756 3300006880 Bacteria 981
77 Ga0075435_100540024 3300007076 Bacteria 1009
78 Ga0105240_10022181 3300009093 Bacteria 8423
79 Ga0105240_10113679 3300009093 Bacteria 3271
80 Ga0111539_10000009 3300009094 Bacteria 375223
81 Ga0105247_10423615 3300009101 Unclassified 954
82 Ga0105241_10564822 3300009174 Bacteria 1023
83 Ga0105242_10892167 3300009176 Bacteria 888
84 Ga0105248_10094189 3300009177 Bacteria 3373
85 Ga0105248_10572295 3300009177 Bacteria 1275
86 Ga0105237_10008018 3300009545 Bacteria 11494
87 Ga0105238_10024687 3300009551 Bacteria 6128
88 Ga0105238_11744663 3300009551 Bacteria 654
89 Ga0105249_10027783 3300009553 Bacteria 5105
90 Ga0157373_10177334 3300013100 Unclassified 1500
91 Ga0157371_10388731 3300013102 Bacteria 1019
92 Ga0157370_10017000 3300013104 Bacteria 7352
93 Ga0157370_10064812 3300013104 Bacteria 3458
94 Ga0157370_10072444 3300013104 Bacteria 3251
95 Ga0157370_10099466 3300013104 Bacteria 2726
96 Ga0157370_10158454 3300013104 Bacteria 2106
97 Ga0157370_10416998 3300013104 Bacteria 1235
98 Ga0157369_10020050 3300013105 Bacteria 7478
99 Ga0157369_10034745 3300013105 Bacteria 5529
100 Ga0157369_10205551 3300013105 Bacteria 2065
101 Ga0157374_10000045 3300013296 Bacteria 143116
102 Ga0157374_10178965 3300013296 Bacteria 2070
103 Ga0163162_10013234 3300013306 Bacteria 8057
104 Ga0163162_10382328 3300013306 Bacteria 1541
105 Ga0163162_10584534 3300013306 Bacteria 1244
106 Ga0157372_10010017 3300013307 Bacteria 10080
107 Ga0157372_10052996 3300013307 Bacteria 4520
108 Ga0157380_11293741 3300014326 Bacteria 776
109 Ga0157379_10053308 3300014968 Bacteria 3613
110 Ga0157379_10449953 3300014968 Bacteria 1189
111 Ga0157379_11208933 3300014968 Archaea 727
112 Ga0157376_10000309 3300014969 Bacteria 32560
113 Ga0157376_10203174 3300014969 Bacteria 1824
114 Ga0157376_10889872 3300014969 Bacteria 908
115 Ga0207682_10030944 3300025893 Unclassified 2146
116 Ga0207647_10031007 3300025904 Bacteria 3445
117 Ga0207705_10000012 3300025909 Bacteria 472336
118 Ga0207705_10005749 3300025909 Bacteria 9257
119 Ga0207705_10089666 3300025909 Bacteria 2250
120 Ga0207705_10107831 3300025909 Bacteria 2055
121 Ga0207707_10102450 3300025912 Bacteria 2502
122 Ga0207707_10429332 3300025912 Bacteria 1132
123 Ga0207695_10008216 3300025913 Bacteria 13110
124 Ga0207695_10115772 3300025913 Bacteria 2655
125 Ga0207695_10149955 3300025913 Bacteria 2272
126 Ga0207671_10165005 3300025914 Bacteria 1717
127 Ga0207693_10606796 3300025915 Bacteria 852
128 Ga0207660_10024960 3300025917 Bacteria 4052
129 Ga0207657_10016614 3300025919 Bacteria 7091
130 Ga0207657_10176182 3300025919 Bacteria 1730
131 Ga0207657_10222724 3300025919 Bacteria 1511
132 Ga0207657_10281265 3300025919 Bacteria 1321
133 Ga0207649_10019175 3300025920 Bacteria 3906
134 Ga0207652_10062029 3300025921 Bacteria 3230
135 Ga0207652_10323945 3300025921 Unclassified 1391
136 Ga0207646_10012542 3300025922 Bacteria 8138
137 Ga0207646_10337836 3300025922 Bacteria 1361
138 Ga0207681_10926021 3300025923 Bacteria 730
139 Ga0207700_10117876 3300025928 Bacteria 2147
140 Ga0207644_10273842 3300025931 Bacteria 1353
141 Ga0207690_10002265 3300025932 Bacteria 11729
142 Ga0207669_10064157 3300025937 Bacteria 2272
143 Ga0207711_10324963 3300025941 Bacteria 1422
144 Ga0207711_10733049 3300025941 Bacteria 921
145 Ga0207667_10120694 3300025949 Bacteria 2701
146 Ga0207667_10222481 3300025949 Bacteria 1934
147 Ga0207640_10000034 3300025981 Bacteria 112705
148 Ga0207640_10016055 3300025981 Bacteria 4347
149 Ga0207640_10727905 3300025981 Bacteria 853
150 Ga0207658_10764292 3300025986 Bacteria 876
151 Ga0207639_10000115 3300026041 Bacteria 62079
152 Ga0207639_10013171 3300026041 Bacteria 5782
153 Ga0207678_10003865 3300026067 Bacteria 13464
154 Ga0207678_10012986 3300026067 Bacteria 7311
155 Ga0207678_10032218 3300026067 Bacteria 4568
156 Ga0207678_10067787 3300026067 Bacteria 3062
157 Ga0207641_10011813 3300026088 Bacteria 7166
158 Ga0207641_10044379 3300026088 Bacteria 3739
159 Ga0207674_10001373 3300026116 Bacteria 31477
160 Ga0207698_10378835 3300026142 Bacteria 1345
161 Ga0207428_10000022 3300027907 Bacteria 273333
162 Ga0268266_10005587 3300028379 Bacteria 11682
163 Ga0268266_10005931 3300028379 Bacteria 11297
164 Ga0268266_10055425 3300028379 Bacteria 3408
165 Ga0268265_10019240 3300028380 Bacteria 4742
166 Ga0268264_10328202 3300028381 Bacteria 1449
167 Ga0316576_10098304 3300031727 Bacteria 2186
168 Ga0307405_10732492 3300031731 Bacteria 822
169 Ga0307416_100231073 3300032002 Bacteria 1783
170 Ga0307411_10047916 3300032005 Bacteria 2766
171 Ga0307411_10200206 3300032005 Unclassified 1533
172 Ga0373940_0070285 3300035088 Bacteria 1018
173 Ga0373949_0041512 3300035090 Bacteria 1132
174 Ga0373939_0018411 3300035114 Bacteria 1871
175 Ga0373962_0060451 3300035242 Bacteria 1112
176 Ga0373937_0113191 3300036401 Bacteria 2525
177 Ga0316584_0054176 3300036712 Bacteria 3002
178 Ga0373925_0761539 3300037068 Bacteria 798
179 Ga0439435_0037912 3300042436 Unclassified 1338
180 Ga0450916_024959 3300042530 Bacteria 842
181 Ga0453683_0077215 3300044673 Bacteria 2086
182 Ga0495617_032949 3300046452 Unclassified 1740
183 Ga0495603_0004404 3300046455 Bacteria 8398
184 Ga0495603_0315396 3300046455 Bacteria 898
185 Ga0495629_0011026 3300046459 Bacteria 6566
186 Ga0495629_0205084 3300046459 Unclassified 1362
187 Ga0495651_0121482 3300046462 Bacteria 1918
188 Ga0495651_0149696 3300046462 Bacteria 1684
189 Ga0495650_0001367 3300046471 Bacteria 24135
190 Ga0495580_0031939 3300046472 Bacteria 3802
191 Ga0495580_0214147 3300046472 Bacteria 1325
192 Ga0495580_0222592 3300046472 Unclassified 1297
193 Ga0495582_0001790 3300046473 Bacteria 12134
194 Ga0495582_0081303 3300046473 Bacteria 1799
195 Ga0495639_0015626 3300046475 Bacteria 3292
196 Ga0495662_0000317 3300046476 Bacteria 21000
197 Ga0495664_0085020 3300046477 Bacteria 1899
198 Ga0495664_0159895 3300046477 Bacteria 1366
199 Ga0495585_0022975 3300046492 Bacteria 3579
200 Ga0495585_0108826 3300046492 Bacteria 1476
201 Ga0495594_0002005 3300046499 Bacteria 10600
202 Ga0495594_0004610 3300046499 Bacteria 7099
203 Ga0495594_0004649 3300046499 Bacteria 7074
204 Ga0495606_0422794 3300046507 Bacteria 689
205 Ga0495608_0430312 3300046511 Bacteria 805
206 Ga0495628_0006206 3300046516 Bacteria 10448
207 Ga0495628_0273536 3300046516 Bacteria 1256
208 Ga0495631_0238118 3300046518 Bacteria 776
209 Ga0495644_0000044 3300046523 Bacteria 60246
210 Ga0495666_0001255 3300046526 Bacteria 12292
211 Ga0495642_0032904 3300046528 Unclassified 2083
212 Ga0495652_0076256 3300046529 Bacteria 2781
213 Ga0495665_0010953 3300046531 Bacteria 4906
214 Ga0495640_0285324 3300046533 Unclassified 1027
215 Ga0495640_0289464 3300046533 Bacteria 1019
216 Ga0495640_0696433 3300046533 Bacteria 610
217 Ga0495586_0031211 3300046535 Bacteria 2852
218 Ga0495587_0029502 3300046536 Bacteria 3330
219 Ga0495609_0026364 3300046538 Bacteria 2662
220 Ga0495609_0086475 3300046538 Bacteria 1367
221 Ga0495645_0024275 3300046543 Bacteria 4398
222 Ga0495645_0339143 3300046543 Bacteria 971
223 Ga0495622_0006435 3300046557 Bacteria 5449
224 Ga0495633_0040388 3300046558 Unclassified 2223
225 Ga0495667_0048846 3300046559 Bacteria 2794
226 Ga0495667_0355698 3300046559 Bacteria 925
227 Ga0495668_0043022 3300046616 Bacteria 2513
228 Ga0495668_0110746 3300046616 Bacteria 1502
229 Ga0495668_0180060 3300046616 Bacteria 1158
230 Ga0495634_0017980 3300046642 Bacteria 5037
231 Ga0495611_0060648 3300046648 Bacteria 1719
232 Ga0495625_0000580 3300046660 Bacteria 53177
233 Ga0495625_0070653 3300046660 Bacteria 2451
234 Ga0495625_0258235 3300046660 Bacteria 1128
235 Ga0495635_0151918 3300046663 Bacteria 1576
236 Ga0495635_0450016 3300046663 Bacteria 851
237 Ga0495657_0574810 3300046675 Bacteria 653
238 Ga0495599_0027907 3300046678 Bacteria 3536
239 Ga0495646_0087915 3300046680 Bacteria 1800
240 Ga0495669_0002936 3300046684 Bacteria 7007
241 Ga0495669_0045824 3300046684 Bacteria 1951
242 Ga0495613_0024889 3300046689 Bacteria 4460
243 Ga0495613_0053349 3300046689 Bacteria 2975
244 Ga0495624_0012402 3300046690 Bacteria 5829
245 Ga0495670_0039026 3300046691 Bacteria 2368
246 Ga0495670_0246286 3300046691 Bacteria 952
247 Ga0495649_0319021 3300046694 Bacteria 789
248 Ga0495600_0023960 3300046809 Bacteria 3928
249 Ga0495581_0017380 3300047315 Bacteria 4176
250 Ga0495604_0008588 3300047317 Bacteria 8070
251 Ga0495674_0310172 3300047319 Bacteria 1287
252 Ga0495672_0001831 3300047320 Bacteria 20338
253 Ga0495672_0083629 3300047320 Bacteria 1772
254 Ga0495676_0027918 3300047321 Bacteria 4832
255 Ga0495680_0206819 3300047322 Bacteria 1406
256 Ga0495683_0021580 3300047323 Bacteria 3318
257 Ga0495683_0238940 3300047323 Bacteria 802
258 Ga0495675_0017536 3300047444 Bacteria 4538
259 Ga0495673_0022641 3300047469 Unclassified 3076
260 Ga0495673_0057633 3300047469 Bacteria 1677
261 Ga0495684_0017333 3300047471 Bacteria 5544
262 Ga0495686_0021670 3300047472 Bacteria 4261
263 Ga0495593_0044379 3300047673 Bacteria 2378
264 Ga0495614_0061659 3300048089 Unclassified 1611
265 Ga0496104_0696376 3300048907 Bacteria 924
266 Ga0496108_1080172 3300048911 Bacteria 683
267 Ga0496126_0000018 3300048929 Bacteria 581170
268 Ga0496126_0000770 3300048929 Bacteria 57986
269 Ga0496126_0414427 3300048929 Bacteria 1090
270 Ga0495682_0039643 3300049460 Bacteria 1729
271 Ga0501031_0573497 3300049568 Bacteria 726
272 Ga0501032_0003281 3300049569 Bacteria 12454
273 Ga0501033_0076500 3300049570 Bacteria 2457
274 Ga0501036_0007562 3300049572 Bacteria 8867
275 Ga0501036_0982526 3300049572 Bacteria 691
276 Ga0501037_0139381 3300049573 Bacteria 1736
277 Ga0501037_0209715 3300049573 Bacteria 1374
278 Ga0501038_0013560 3300049574 Bacteria 7427
279 Ga0501038_0321704 3300049574 Bacteria 1210
280 Ga0501039_0108955 3300049575 Bacteria 2165
281 Ga0501040_0354593 3300049576 Bacteria 1051
282 Ga0501041_0014000 3300049577 Bacteria 4759
283 Ga0501042_0210672 3300049578 Bacteria 1402
284 Ga0501043_0010436 3300049579 Bacteria 7275
285 Ga0501046_0000056 3300049580 Bacteria 129342
286 Ga0501047_0012091 3300049581 Bacteria 8170
287 Ga0501047_0160055 3300049581 Bacteria 2123
288 Ga0501070_0435837 3300049586 Bacteria 1058
289 Ga0501070_0682182 3300049586 Bacteria 814
290 Ga0501072_0437916 3300049588 Bacteria 1035
291 Ga0501073_0007972 3300049589 Bacteria 7861
292 Ga0501080_0112965 3300049742 Bacteria 2518
293 Ga0501080_0636171 3300049742 Bacteria 945
294 Ga0501080_0936969 3300049742 Bacteria 753
295 Ga0501035_0002066 3300049822 Bacteria 19989
296 Ga0501035_0518508 3300049822 Bacteria 979
297 Ga0501035_1385265 3300049822 Bacteria 539
298 Ga0501044_0006095 3300049823 Bacteria 13304
299 Ga0501044_0157459 3300049823 Bacteria 2250
300 nmdc:mga09592_281918_c1 3300050508 Bacteria 1441
301 nmdc:mga0qj67_408064_c1 3300050509 Bacteria 1096
302 nmdc:mga06r32_75365_c1 3300050510 Bacteria 3273
303 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
304 nmdc:mga0rr50_748772_c1 3300050513 Bacteria 834
305 Ga0500595_000011 3300053119 Bacteria 268589
306 Ga0500595_006626 3300053119 Bacteria 4888
307 Ga0590071_036067 3300059421 Bacteria 1185
308 Ga0590074_037385 3300059423 Bacteria 868
309 Ga0590077_057119 3300059426 Bacteria 882
310 Ga0501082_0183943 3300060353 Bacteria 1818
311 2884219481 2884215851 Bacteria 4554841
312 Ga0068855_100687299
313 SwRhRL3b_contig_1124861
314 LJNas_1009633
315 rootH1_10110982
316 rootH2_10105308
317 Ga0065712_10424025
318 Ga0065715_10211397
319 Ga0065715_10279425
320 Ga0065707_10000566
321 Ga0070658_10000006
322 Ga0070658_10018824
323 Ga0070658_10080282
324 Ga0070683_100071273
325 Ga0070670_100141449
326 Ga0070680_100018754
327 Ga0070680_100314899
328 Ga0070680_100668836
329 Ga0070682_100436394
330 Ga0070660_100036401
331 Ga0070660_100109386
332 Ga0070660_100120303
333 Ga0070660_100164214
334 Ga0070660_100317548
335 Ga0070661_100007186
336 Ga0070692_10009799
337 Ga0070668_100195610
338 Ga0070671_100001020
339 Ga0070674_100647390
340 Ga0070659_100021996
341 Ga0070659_100025241
342 Ga0070667_101054452
343 Ga0070701_10092680
344 Ga0070708_100038073
345 Ga0070663_100048156
346 Ga0070663_100052845
347 Ga0070663_100409778
348 Ga0070678_100920141
349 Ga0070662_100255949
350 Ga0070681_10019682
351 Ga0070707_100025163
352 Ga0070707_100087813
353 Ga0070679_100121792
354 Ga0070679_100198435
355 Ga0070679_100235457
356 Ga0070684_100025543
357 Ga0068853_100000174
358 Ga0068853_100119703
359 Ga0068853_100177082
360 Ga0070686_100010810
361 Ga0070665_100024793
362 Ga0070665_100075553
363 Ga0068855_100072781
364 Ga0068855_100080166
365 Ga0068855_100117591
366 Ga0068855_100156770
367 Ga0068857_100034906
368 Ga0068854_100000186
369 Ga0068854_100003111
370 Ga0068854_100299630
371 Ga0068856_100565722
372 Ga0068856_100922237
373 Ga0070702_100674246
374 Ga0068852_100150635
375 Ga0068859_100406375
376 Ga0068863_100026667
377 Ga0068863_100433395
378 Ga0068858_100626249
379 Ga0068862_100187668
380 Ga0075432_10020261
381 Ga0075367_10144556
382 Ga0097621_100058707
383 Ga0068871_100036316
384 Ga0075428_100000007
385 Ga0075430_100455792
386 Ga0075431_100013407
387 Ga0075429_100581756
388 Ga0075435_100540024
389 Ga0105240_10022181
390 Ga0105240_10113679
391 Ga0111539_10000009
392 Ga0105247_10423615
393 Ga0105241_10564822
394 Ga0105242_10892167
395 Ga0105248_10094189
396 Ga0105248_10572295
397 Ga0105237_10008018
398 Ga0105238_10024687
399 Ga0105238_11744663
400 Ga0105249_10027783
401 Ga0157373_10177334
402 Ga0157371_10388731
403 Ga0157370_10017000
404 Ga0157370_10064812
405 Ga0157370_10072444
406 Ga0157370_10099466
407 Ga0157370_10158454
408 Ga0157370_10416998
409 Ga0157369_10020050
410 Ga0157369_10034745
411 Ga0157369_10205551
412 Ga0157374_10000045
413 Ga0157374_10178965
414 Ga0163162_10013234
415 Ga0163162_10382328
416 Ga0163162_10584534
417 Ga0157372_10010017
418 Ga0157372_10052996
419 Ga0157380_11293741
420 Ga0157379_10053308
421 Ga0157379_10449953
422 Ga0157379_11208933
423 Ga0157376_10000309
424 Ga0157376_10203174
425 Ga0157376_10889872
426 Ga0207682_10030944
427 Ga0207647_10031007
428 Ga0207705_10000012
429 Ga0207705_10005749
430 Ga0207705_10089666
431 Ga0207705_10107831
432 Ga0207707_10102450
433 Ga0207707_10429332
434 Ga0207695_10008216
435 Ga0207695_10115772
436 Ga0207695_10149955
437 Ga0207671_10165005
438 Ga0207693_10606796
439 Ga0207660_10024960
440 Ga0207657_10016614
441 Ga0207657_10176182
442 Ga0207657_10222724
443 Ga0207657_10281265
444 Ga0207649_10019175
445 Ga0207652_10062029
446 Ga0207652_10323945
447 Ga0207646_10012542
448 Ga0207646_10337836
449 Ga0207681_10926021
450 Ga0207700_10117876
451 Ga0207644_10273842
452 Ga0207690_10002265
453 Ga0207669_10064157
454 Ga0207711_10324963
455 Ga0207711_10733049
456 Ga0207667_10120694
457 Ga0207667_10222481
458 Ga0207640_10000034
459 Ga0207640_10016055
460 Ga0207640_10727905
461 Ga0207658_10764292
462 Ga0207639_10000115
463 Ga0207639_10013171
464 Ga0207678_10003865
465 Ga0207678_10012986
466 Ga0207678_10032218
467 Ga0207678_10067787
468 Ga0207641_10011813
469 Ga0207641_10044379
470 Ga0207674_10001373
471 Ga0207698_10378835
472 Ga0207428_10000022
473 Ga0268266_10005587
474 Ga0268266_10005931
475 Ga0268266_10055425
476 Ga0268265_10019240
477 Ga0268264_10328202
478 Ga0316576_10098304
479 Ga0307405_10732492
480 Ga0307416_100231073
481 Ga0307411_10047916
482 Ga0307411_10200206
483 Ga0373940_0070285
484 Ga0373949_0041512
485 Ga0373939_0018411
486 Ga0373962_0060451
487 Ga0373937_0113191
488 Ga0316584_0054176
489 Ga0373925_0761539
490 Ga0439435_0037912
491 Ga0450916_024959
492 Ga0453683_0077215
493 Ga0495617_032949
494 Ga0495603_0004404
495 Ga0495603_0315396
496 Ga0495629_0011026
497 Ga0495629_0205084
498 Ga0495651_0121482
499 Ga0495651_0149696
500 Ga0495650_0001367
501 Ga0495580_0031939
502 Ga0495580_0214147
503 Ga0495580_0222592
504 Ga0495582_0001790
505 Ga0495582_0081303
506 Ga0495639_0015626
507 Ga0495662_0000317
508 Ga0495664_0085020
509 Ga0495664_0159895
510 Ga0495585_0022975
511 Ga0495585_0108826
512 Ga0495594_0002005
513 Ga0495594_0004610
514 Ga0495594_0004649
515 Ga0495606_0422794
516 Ga0495608_0430312
517 Ga0495628_0006206
518 Ga0495628_0273536
519 Ga0495631_0238118
520 Ga0495644_0000044
521 Ga0495666_0001255
522 Ga0495642_0032904
523 Ga0495652_0076256
524 Ga0495665_0010953
525 Ga0495640_0285324
526 Ga0495640_0289464
527 Ga0495640_0696433
528 Ga0495586_0031211
529 Ga0495587_0029502
530 Ga0495609_0026364
531 Ga0495609_0086475
532 Ga0495645_0024275
533 Ga0495645_0339143
534 Ga0495622_0006435
535 Ga0495633_0040388
536 Ga0495667_0048846
537 Ga0495667_0355698
538 Ga0495668_0043022
539 Ga0495668_0110746
540 Ga0495668_0180060
541 Ga0495634_0017980
542 Ga0495611_0060648
543 Ga0495625_0000580
544 Ga0495625_0070653
545 Ga0495625_0258235
546 Ga0495635_0151918
547 Ga0495635_0450016
548 Ga0495657_0574810
549 Ga0495599_0027907
550 Ga0495646_0087915
551 Ga0495669_0002936
552 Ga0495669_0045824
553 Ga0495613_0024889
554 Ga0495613_0053349
555 Ga0495624_0012402
556 Ga0495670_0039026
557 Ga0495670_0246286
558 Ga0495649_0319021
559 Ga0495600_0023960
560 Ga0495581_0017380
561 Ga0495604_0008588
562 Ga0495674_0310172
563 Ga0495672_0001831
564 Ga0495672_0083629
565 Ga0495676_0027918
566 Ga0495680_0206819
567 Ga0495683_0021580
568 Ga0495683_0238940
569 Ga0495675_0017536
570 Ga0495673_0022641
571 Ga0495673_0057633
572 Ga0495684_0017333
573 Ga0495686_0021670
574 Ga0495593_0044379
575 Ga0495614_0061659
576 Ga0496104_0696376
577 Ga0496108_1080172
578 Ga0496126_0000018
579 Ga0496126_0000770
580 Ga0496126_0414427
581 Ga0495682_0039643
582 Ga0501031_0573497
583 Ga0501032_0003281
584 Ga0501033_0076500
585 Ga0501036_0007562
586 Ga0501036_0982526
587 Ga0501037_0139381
588 Ga0501037_0209715
589 Ga0501038_0013560
590 Ga0501038_0321704
591 Ga0501039_0108955
592 Ga0501040_0354593
593 Ga0501041_0014000
594 Ga0501042_0210672
595 Ga0501043_0010436
596 Ga0501046_0000056
597 Ga0501047_0012091
598 Ga0501047_0160055
599 Ga0501070_0435837
600 Ga0501070_0682182
601 Ga0501072_0437916
602 Ga0501073_0007972
603 Ga0501080_0112965
604 Ga0501080_0636171
605 Ga0501080_0936969
606 Ga0501035_0002066
607 Ga0501035_0518508
608 Ga0501035_1385265
609 Ga0501044_0006095
610 Ga0501044_0157459
611 nmdc:mga09592_281918_c1
612 nmdc:mga0qj67_408064_c1
613 nmdc:mga06r32_75365_c1
614 nmdc:mga08y16_21_c1
615 nmdc:mga0rr50_748772_c1
616 Ga0500595_000011
617 Ga0500595_006626
618 Ga0590071_036067
619 Ga0590074_037385
620 Ga0590077_057119
621 Ga0501082_0183943
622 2884219481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

54

159

0.87

PF08534

Redoxin

Redoxin

54

176

0.82

PF13098

Thioredoxin_2

Thioredoxin-like domain

56

170

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9876 1 177
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9868 1 177
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9821 1 177
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9758 1 177
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.9407 2 177
ID Description Score Start End Superfamily
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9839 1 177 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.974 1 177 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.973 1 177 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9686 1 177 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9348 2 177 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1Z4EJ21-F1-model_v4 Thioredoxin family protein 0.9975 66 177 GO:0016209
GO:0016491
AF-A0A3S1YF74-F1-model_v4 Thioredoxin family protein 0.9961 35 177 GO:0016491
AF-A0A846FSI1-F1-model_v4 deleted 0.9948 31 177
AF-A0A7Y2Y870-F1-model_v4 Thioredoxin family protein 0.9932 48 177 GO:0016209
GO:0016491
AF-A0A2G1Z9N8-F1-model_v4 Thioredoxin family protein 0.9929 1 142 GO:0016209
GO:0016491

Map