F401084

General Info

Members Datasets Scaffolds Average Seq Length
311 168 307 213

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100223263|Ga0070714_1002232633
Length 247
Sequence VKGCEVVMFWTGTTLPLNVVAGAHSACKCNVALMALNLSVDELLTTTRSVRKRLDFDKPVSREVLMECLDLALQAPTGSNSQGWQWVFIEDADEKKAIGEIYLDNARGYLKSPAQEYADGDTRGERMPAVRDSATYLAEHIHEAPVLMIPCIEGREDKQPMGGAGYWASLHPAVWSFCLALRSRGLGTCWTTLHLIRGGEEKVADIVGIPYEKYSQGGLFPIAYTKGTDFKPAKRLPAEQLTHWNTW

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
3 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
4 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.04
Nodule 0
Rhizoplane 14.47
Rhizosphere 50.48
Stem 0
Stem Tuber 0
Unclassified 18.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10089003 3300003320 Bacteria 2771
2 Ga0055540_1001481 3300003792 Bacteria 13973
3 Ga0055540_1002635 3300003792 Bacteria 9303
4 Ga0055540_1004493 3300003792 Bacteria 6260
5 Ga0070683_100098269 3300005329 Bacteria 2755
6 Ga0070682_100072852 3300005337 Bacteria 2202
7 Ga0068868_100234855 3300005338 Bacteria 1539
8 Ga0070669_100013274 3300005353 Bacteria 5855
9 Ga0070671_100452879 3300005355 Bacteria 1101
10 Ga0070671_100678628 3300005355 Bacteria 893
11 Ga0070674_100162238 3300005356 Bacteria 1697
12 Ga0070667_100000722 3300005367 Bacteria 31740
13 Ga0070667_100386501 3300005367 Bacteria 1272
14 Ga0070714_100223263 3300005435 Bacteria 1732
15 Ga0070714_100455523 3300005435 Bacteria 1216
16 Ga0070714_100805088 3300005435 Bacteria 910
17 Ga0070713_100193545 3300005436 Bacteria 1834
18 Ga0070710_10326383 3300005437 Bacteria 1009
19 Ga0070708_100364683 3300005445 Bacteria 1361
20 Ga0070663_100108884 3300005455 Bacteria 2079
21 Ga0070663_100319067 3300005455 Bacteria 1249
22 Ga0070678_100851326 3300005456 Bacteria 831
23 Ga0070685_10010167 3300005466 Bacteria 4885
24 Ga0068853_100064787 3300005539 Bacteria 3170
25 Ga0070686_100140209 3300005544 Bacteria 1682
26 Ga0070693_100061368 3300005547 Bacteria 2185
27 Ga0068852_100469245 3300005616 Bacteria 1249
28 Ga0068859_100251673 3300005617 Bacteria 1857
29 Ga0068858_100230455 3300005842 Bacteria 1756
30 Ga0068860_100607725 3300005843 Bacteria 1099
31 Ga0081455_10347756 3300005937 Bacteria 1047
32 Ga0075365_10000705 3300006038 Bacteria 13444
33 Ga0075365_10210822 3300006038 Bacteria 1362
34 Ga0075365_10342326 3300006038 Bacteria 1054
35 Ga0075368_10015011 3300006042 Bacteria 2868
36 Ga0075363_100001263 3300006048 Bacteria 9407
37 Ga0075363_100003824 3300006048 Bacteria 6490
38 Ga0075363_100006656 3300006048 Bacteria 5268
39 Ga0075363_100016444 3300006048 Bacteria 3654
40 Ga0075363_100393589 3300006048 Bacteria 814
41 Ga0075364_10008785 3300006051 Bacteria 6046
42 Ga0075364_10048009 3300006051 Bacteria 2781
43 Ga0075364_10077092 3300006051 Bacteria 2200
44 Ga0075364_10393140 3300006051 Bacteria 946
45 Ga0070715_10249332 3300006163 Bacteria 927
46 Ga0075362_10006082 3300006177 Bacteria 4470
47 Ga0075362_10018252 3300006177 Bacteria 2900
48 Ga0075369_10001847 3300006186 Bacteria 7394
49 Ga0075369_10044745 3300006186 Bacteria 1902
50 Ga0075369_10094727 3300006186 Bacteria 1335
51 Ga0075369_10141566 3300006186 Bacteria 1097
52 Ga0075366_10187437 3300006195 Bacteria 1257
53 Ga0075370_10006823 3300006353 Bacteria 5772
54 Ga0075370_10026962 3300006353 Bacteria 3185
55 Ga0075370_10028984 3300006353 Bacteria 3080
56 Ga0075370_10091166 3300006353 Bacteria 1758
57 Ga0068865_100672742 3300006881 Bacteria 882
58 Ga0097620_100251680 3300006931 Bacteria 1857
59 Ga0105240_10837634 3300009093 Bacteria 994
60 Ga0111539_10080732 3300009094 Bacteria 3825
61 Ga0111539_10561421 3300009094 Bacteria 1329
62 Ga0105245_10886119 3300009098 Bacteria 934
63 Ga0105248_10043695 3300009177 Bacteria 5025
64 Ga0105248_11135472 3300009177 Bacteria 883
65 Ga0105237_10245229 3300009545 Bacteria 1793
66 Ga0105239_10840641 3300010375 Bacteria 1052
67 Ga0157369_10086659 3300013105 Bacteria 3344
68 Ga0163162_10119227 3300013306 Bacteria 2741
69 Ga0157375_10222070 3300013308 Bacteria 2048
70 Ga0163163_10189240 3300014325 Bacteria 2107
71 Ga0163163_10247511 3300014325 Bacteria 1833
72 Ga0157377_10069783 3300014745 Bacteria 2028
73 Ga0157379_10273565 3300014968 Bacteria 1536
74 Ga0163161_10503383 3300017792 Bacteria 987
75 Ga0213872_10069523 3300021361 Bacteria 1588
76 Ga0213874_10049398 3300021377 Bacteria 1286
77 Ga0213874_10191124 3300021377 Bacteria 732
78 Ga0213876_10002857 3300021384 Bacteria 10036
79 Ga0213876_10006130 3300021384 Bacteria 6571
80 Ga0213876_10019073 3300021384 Bacteria 3622
81 Ga0213875_10005317 3300021388 Bacteria 6925
82 Ga0213875_10012643 3300021388 Bacteria 4159
83 Ga0209673_1022649 3300025273 Bacteria 2161
84 Ga0209051_1001752 3300025303 Bacteria 17263
85 Ga0209051_1002102 3300025303 Bacteria 14961
86 Ga0209051_1002406 3300025303 Bacteria 13458
87 Ga0209051_1012294 3300025303 Bacteria 4150
88 Ga0207642_10078364 3300025899 Bacteria 1597
89 Ga0207695_10664131 3300025913 Bacteria 923
90 Ga0207671_10236827 3300025914 Bacteria 1433
91 Ga0207700_10087887 3300025928 Bacteria 2445
92 Ga0207664_10108065 3300025929 Bacteria 2309
93 Ga0207664_10463158 3300025929 Bacteria 1132
94 Ga0207664_10652443 3300025929 Bacteria 946
95 Ga0207664_11117723 3300025929 Bacteria 704
96 Ga0207644_10120252 3300025931 Bacteria 1999
97 Ga0207644_10620349 3300025931 Bacteria 899
98 Ga0207669_10047865 3300025937 Bacteria 2536
99 Ga0207665_10143705 3300025939 Bacteria 1704
100 Ga0207711_10069330 3300025941 Bacteria 3056
101 Ga0207640_10556045 3300025981 Bacteria 965
102 Ga0207658_10004559 3300025986 Bacteria 9611
103 Ga0207703_10651718 3300026035 Bacteria 999
104 Ga0207703_10765159 3300026035 Bacteria 921
105 Ga0207639_10044745 3300026041 Bacteria 3330
106 Ga0207678_10017171 3300026067 Bacteria 6353
107 Ga0207678_10379179 3300026067 Bacteria 1222
108 Ga0207675_100424964 3300026118 Bacteria 1313
109 Ga0207698_10799750 3300026142 Bacteria 945
110 Ga0268264_10429591 3300028381 Bacteria 1275
111 Ga0307405_10498364 3300031731 Bacteria 976
112 Ga0307413_10360921 3300031824 Bacteria 1125
113 Ga0307410_10249609 3300031852 Bacteria 1379
114 Ga0307412_10371347 3300031911 Bacteria 1155
115 Ga0307409_100294101 3300031995 Bacteria 1507
116 Ga0307409_100489484 3300031995 Bacteria 1195
117 Ga0307416_100052549 3300032002 Bacteria 3263
118 Ga0307416_100557948 3300032002 Bacteria 1220
119 Ga0307414_10170606 3300032004 Bacteria 1739
120 Ga0307415_100278018 3300032126 Bacteria 1375
121 Ga0436364_0178326 3300037853 Bacteria 9377
122 Ga0436364_0303129 3300037853 Bacteria 102080
123 Ga0436364_0529249 3300037853 Bacteria 39037
124 Ga0436364_1366244 3300037853 Bacteria 1288
125 Ga0436365_0133306 3300039437 Bacteria 59687
126 Ga0436365_0393632 3300039437 Bacteria 30038
127 Ga0436365_0500692 3300039437 Bacteria 1202
128 Ga0436365_0842203 3300039437 Bacteria 27860
129 Ga0436365_1111318 3300039437 Bacteria 2109
130 Ga0436365_1406222 3300039437 Bacteria 3063
131 Ga0436361_1162518 3300039447 Bacteria 1476
132 Ga0436363_0391372 3300039450 Bacteria 3640
133 Ga0436363_0691693 3300039450 Bacteria 2361
134 Ga0436363_1112948 3300039450 Bacteria 1440
135 Ga0436362_0963953 3300039453 Bacteria 992
136 Ga0439466_0008319 3300041411 Bacteria 3910
137 Ga0439465_0026879 3300041413 Bacteria 1821
138 Ga0451793_0140214 3300041452 Bacteria 3381
139 Ga0451843_0719068 3300041509 Bacteria 1190
140 Ga0451853_0432786 3300041512 Bacteria 1137
141 Ga0439431_0022522 3300041997 Bacteria 1519
142 Ga0439442_130724 3300042002 Bacteria 552
143 Ga0439445_0038468 3300042004 Bacteria 1265
144 Ga0466969_0009264 3300044656 Bacteria 5220
145 Ga0466969_0151791 3300044656 Bacteria 1067
146 Ga0466972_0028748 3300044658 Bacteria 2740
147 Ga0466965_0012053 3300044683 Bacteria 4060
148 Ga0466965_0042751 3300044683 Bacteria 2236
149 Ga0466966_0013686 3300044684 Bacteria 5368
150 Ga0466966_0061593 3300044684 Bacteria 2366
151 Ga0466966_0175981 3300044684 Bacteria 1299
152 Ga0466961_0002938 3300044693 Bacteria 10582
153 Ga0466963_0007103 3300044694 Bacteria 6671
154 Ga0466963_0046163 3300044694 Bacteria 2871
155 Ga0466963_0233252 3300044694 Bacteria 1290
156 Ga0466963_0438687 3300044694 Bacteria 921
157 Ga0453684_0214238 3300044712 Bacteria 2236
158 Ga0453684_0328250 3300044712 Bacteria 1731
159 Ga0466971_0215619 3300044719 Bacteria 909
160 Ga0466968_0014952 3300044735 Bacteria 3073
161 Ga0466970_0002489 3300044765 Bacteria 8895
162 Ga0466970_0029435 3300044765 Bacteria 2891
163 Ga0466957_0021395 3300044842 Bacteria 3810
164 Ga0466960_0001475 3300044901 Bacteria 8577
165 Ga0466960_0012164 3300044901 Bacteria 3623
166 Ga0466960_0108526 3300044901 Bacteria 1439
167 Ga0466959_0001602 3300045049 Bacteria 13955
168 Ga0466959_0007515 3300045049 Bacteria 7653
169 Ga0466958_0008215 3300045836 Bacteria 5781
170 Ga0466958_0044365 3300045836 Bacteria 2680
171 Ga0466958_0307382 3300045836 Bacteria 1018
172 Ga0466967_0001096 3300045976 Bacteria 14982
173 Ga0466967_0023199 3300045976 Bacteria 5081
174 Ga0495606_0040835 3300046507 Bacteria 3115
175 Ga0495606_0279307 3300046507 Bacteria 914
176 Ga0495628_0416903 3300046516 Bacteria 979
177 Ga0495686_0002701 3300047472 Bacteria 16248
178 Ga0495686_0023810 3300047472 Bacteria 4031
179 Ga0495686_0379326 3300047472 Bacteria 763
180 Ga0496100_0000225 3300048903 Bacteria 30548
181 Ga0496100_0001287 3300048903 Bacteria 12243
182 Ga0496100_0010237 3300048903 Bacteria 5303
183 Ga0496101_0000002 3300048904 Bacteria 410971
184 Ga0496101_0000118 3300048904 Bacteria 77684
185 Ga0496101_0000933 3300048904 Bacteria 17243
186 Ga0496102_0000003 3300048905 Bacteria 592263
187 Ga0496102_0022017 3300048905 Bacteria 5645
188 Ga0496102_0102925 3300048905 Bacteria 2655
189 Ga0496102_0109481 3300048905 Bacteria 2574
190 Ga0496102_0257664 3300048905 Bacteria 1645
191 Ga0496103_0000014 3300048906 Bacteria 290397
192 Ga0496103_0002879 3300048906 Bacteria 10677
193 Ga0496103_0132003 3300048906 Bacteria 1595
194 Ga0496103_0133805 3300048906 Bacteria 1584
195 Ga0496104_0026925 3300048907 Bacteria 5315
196 Ga0496104_0743854 3300048907 Bacteria 888
197 Ga0496105_0009653 3300048908 Bacteria 7555
198 Ga0496106_0006137 3300048909 Bacteria 8888
199 Ga0496106_0090879 3300048909 Bacteria 2356
200 Ga0496106_0137313 3300048909 Bacteria 1921
201 Ga0496107_0000106 3300048910 Bacteria 40710
202 Ga0496107_0001748 3300048910 Bacteria 13670
203 Ga0496107_0011142 3300048910 Bacteria 6256
204 Ga0496107_0309402 3300048910 Bacteria 1176
205 Ga0496108_0005477 3300048911 Bacteria 10264
206 Ga0496109_0000077 3300048912 Bacteria 103492
207 Ga0496109_0011451 3300048912 Bacteria 7626
208 Ga0496109_0585190 3300048912 Bacteria 1052
209 Ga0496110_0000645 3300048913 Bacteria 23879
210 Ga0496110_0075435 3300048913 Bacteria 2996
211 Ga0496110_0499034 3300048913 Bacteria 1108
212 Ga0496111_0000485 3300048914 Bacteria 20417
213 Ga0496111_0231279 3300048914 Bacteria 1373
214 Ga0496112_0008288 3300048915 Bacteria 9300
215 Ga0496112_0168499 3300048915 Bacteria 2156
216 Ga0496112_0194414 3300048915 Bacteria 1990
217 Ga0496113_0294586 3300048916 Bacteria 1299
218 Ga0496113_0656117 3300048916 Bacteria 839
219 Ga0496114_0000712 3300048917 Bacteria 24721
220 Ga0496114_0000880 3300048917 Bacteria 22492
221 Ga0496114_0736154 3300048917 Bacteria 863
222 Ga0496115_0006185 3300048918 Bacteria 8757
223 Ga0496115_0016508 3300048918 Bacteria 5624
224 Ga0496116_0000071 3300048919 Bacteria 244521
225 Ga0496116_0005986 3300048919 Bacteria 11154
226 Ga0496117_0000003 3300048920 Bacteria 1881097
227 Ga0496117_0007608 3300048920 Bacteria 10525
228 Ga0496117_0086444 3300048920 Bacteria 2037
229 Ga0496118_0000001 3300048921 Bacteria 1881100
230 Ga0496118_0000604 3300048921 Bacteria 59356
231 Ga0496118_0005885 3300048921 Bacteria 13737
232 Ga0496119_0002123 3300048922 Bacteria 22312
233 Ga0496119_0003282 3300048922 Bacteria 16914
234 Ga0496119_0017731 3300048922 Bacteria 5340
235 Ga0496119_0060564 3300048922 Bacteria 2265
236 Ga0496120_0000157 3300048923 Bacteria 112786
237 Ga0496120_0004585 3300048923 Bacteria 11506
238 Ga0496120_0043131 3300048923 Bacteria 2630
239 Ga0496121_0000002 3300048924 Bacteria 1494588
240 Ga0496121_0000019 3300048924 Bacteria 499976
241 Ga0496121_0008006 3300048924 Bacteria 12613
242 Ga0496121_0176379 3300048924 Bacteria 1547
243 Ga0496122_0000051 3300048925 Bacteria 265104
244 Ga0496123_0022676 3300048926 Bacteria 4830
245 Ga0496124_0000002 3300048927 Bacteria 1494588
246 Ga0496124_0218427 3300048927 Bacteria 1436
247 Ga0496124_0479528 3300048927 Bacteria 840
248 Ga0496125_0000002 3300048928 Bacteria 1480920
249 Ga0496126_0000011 3300048929 Bacteria 744275
250 Ga0496126_0000186 3300048929 Bacteria 140016
251 Ga0496126_0041051 3300048929 Bacteria 4286
252 Ga0496126_0265730 3300048929 Bacteria 1425
253 Ga0501032_0004162 3300049569 Bacteria 10961
254 Ga0501032_0107653 3300049569 Bacteria 1846
255 Ga0501033_0008684 3300049570 Bacteria 7860
256 Ga0501033_0118148 3300049570 Bacteria 1926
257 Ga0501034_0001377 3300049571 Bacteria 32679
258 Ga0501034_0160426 3300049571 Bacteria 2220
259 Ga0501034_0319895 3300049571 Bacteria 1485
260 Ga0501036_0089796 3300049572 Bacteria 2596
261 Ga0501037_0002295 3300049573 Bacteria 13802
262 Ga0501043_0023762 3300049579 Bacteria 4808
263 Ga0501043_0258775 3300049579 Bacteria 1339
264 Ga0501046_0003003 3300049580 Bacteria 15591
265 Ga0501046_0470870 3300049580 Bacteria 902
266 Ga0501047_0005540 3300049581 Bacteria 11880
267 Ga0501047_0031165 3300049581 Bacteria 5143
268 Ga0501047_0576470 3300049581 Bacteria 948
269 Ga0501048_0010853 3300049582 Bacteria 6791
270 Ga0501069_0014837 3300049585 Bacteria 4171
271 Ga0501069_0132457 3300049585 Bacteria 1428
272 Ga0501070_0001697 3300049586 Bacteria 19506
273 Ga0501070_0259638 3300049586 Bacteria 1420
274 Ga0501070_0317730 3300049586 Bacteria 1267
275 Ga0501073_0011218 3300049589 Bacteria 6554
276 Ga0501073_0091966 3300049589 Bacteria 2109
277 Ga0501080_0008174 3300049742 Bacteria 9478
278 Ga0501080_0119704 3300049742 Bacteria 2441
279 Ga0501080_0448152 3300049742 Bacteria 1157
280 Ga0501035_0001307 3300049822 Bacteria 25758
281 Ga0501035_0008131 3300049822 Bacteria 9777
282 Ga0501035_0378256 3300049822 Bacteria 1181
283 Ga0501044_0017914 3300049823 Bacteria 7595
284 Ga0501044_0019276 3300049823 Bacteria 7300
285 nmdc:mga03n38_161210_c1 3300050490 Bacteria 1136
286 nmdc:mga03n38_25276_c1 3300050490 Bacteria 2437
287 nmdc:mga03n38_4282_c1 3300050490 Bacteria 4702
288 nmdc:mga03n38_944_c1 3300050490 Bacteria 7862
289 nmdc:mga00v17_21127_c1 3300050491 Bacteria 3739
290 nmdc:mga00v17_44398_c1 3300050491 Bacteria 2680
291 nmdc:mga00v17_920_c1 3300050491 Bacteria 15828
292 nmdc:mga0yw44_14727_c1 3300050492 Bacteria 4163
293 nmdc:mga0yw44_206296_c1 3300050492 Bacteria 1299
294 nmdc:mga0yw44_852_c1 3300050492 Bacteria 11429
295 nmdc:mga0k408_169775_c1 3300050493 Bacteria 1300
296 nmdc:mga07m45_286677_c1 3300050496 Bacteria 958
297 nmdc:mga07m45_763_c1 3300050496 Bacteria 13819
298 nmdc:mga07m45_79869_c1 3300050496 Bacteria 1867
299 nmdc:mga07m45_89818_c1 3300050496 Bacteria 1759
300 nmdc:mga08y16_64344_c1 3300050511 Bacteria 3829
301 nmdc:mga0sz30_63200_c1 3300050516 Bacteria 1584
302 nmdc:mga0sz30_94811_c1 3300050516 Bacteria 1301
303 Ga0500646_0069566 3300053090 Bacteria 1053
304 Ga0500628_049549 3300053129 Bacteria 992
305 Ga0500642_0192174 3300053130 Bacteria 952
306 Ga0500652_001182 3300053131 Bacteria 8321
307 Ga0466962_0046837 3300061719 Bacteria 2066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042002 Ga0439442_130724 Ga0439442_130724_10_540 175
2 3300048927 Ga0496124_0479528 Ga0496124_0479528_15_572 176
3 3300050496 nmdc:mga07m45_286677_c1 nmdc:mga07m45_286677_c1_343_933 196
4 3300044683 Ga0466965_0042751 Ga0466965_0042751_422_1066 197
5 3300044901 Ga0466960_0001475 Ga0466960_0001475_5984_6628 197
6 3300006051 Ga0075364_10393140 Ga0075364_103931402 202
7 3300003792 Ga0055540_1001481 Ga0055540_100148112 204
8 3300003792 Ga0055540_1002635 Ga0055540_10026355 204
9 3300006038 Ga0075365_10210822 Ga0075365_102108222 204
10 3300006186 Ga0075369_10094727 Ga0075369_100947271 204
11 3300006353 Ga0075370_10091166 Ga0075370_100911663 204
12 3300025273 Ga0209673_1022649 Ga0209673_10226494 204
13 3300025303 Ga0209051_1002102 Ga0209051_10021022 204
14 3300025303 Ga0209051_1002406 Ga0209051_100240613 204
15 3300025303 Ga0209051_1012294 Ga0209051_10122944 204
16 3300048927 Ga0496124_0218427 Ga0496124_0218427_241_891 204
17 3300050492 nmdc:mga0yw44_206296_c1 nmdc:mga0yw44_206296_c1_134_784 204
18 3300050496 nmdc:mga07m45_89818_c1 nmdc:mga07m45_89818_c1_1017_1667 204
19 3300050516 nmdc:mga0sz30_94811_c1 nmdc:mga0sz30_94811_c1_204_854 204
20 3300047472 Ga0495686_0023810 Ga0495686_0023810_2719_3399 207
21 3300048922 Ga0496119_0017731 Ga0496119_0017731_2224_2874 207
22 3300048923 Ga0496120_0004585 Ga0496120_0004585_7645_8295 207
23 3300048924 Ga0496121_0008006 Ga0496121_0008006_915_1565 207
24 3300048929 Ga0496126_0041051 Ga0496126_0041051_3439_4119 207
25 3300049742 Ga0501080_0448152 Ga0501080_0448152_93_746 207
26 iso_pu_bacteria 2902792274 2902793296 208
27 iso_pu_bacteria 2929212328 2929213987 208
28 3300005338 Ga0068868_100234855 Ga0068868_1002348551 210
29 3300044712 Ga0453684_0214238 Ga0453684_0214238_1289_1978 210
30 3300044712 Ga0453684_0328250 Ga0453684_0328250_925_1584 210
31 iso_pu_bacteria 2643221687 2644489929 210
32 iso_pu_bacteria 2902837492 2902841554 210
33 3300005843 Ga0068860_100607725 Ga0068860_1006077252 211
34 3300010375 Ga0105239_10840641 Ga0105239_108406412 211
35 3300021388 Ga0213875_10005317 Ga0213875_100053172 211
36 3300028381 Ga0268264_10429591 Ga0268264_104295912 211
37 3300037853 Ga0436364_0303129 Ga0436364_0303129_96252_96911 211
38 3300048905 Ga0496102_0257664 Ga0496102_0257664_670_1308 211
39 3300048913 Ga0496110_0075435 Ga0496110_0075435_320_958 211
40 3300048914 Ga0496111_0231279 Ga0496111_0231279_670_1308 211
41 3300003792 Ga0055540_1004493 Ga0055540_10044934 212
42 3300005337 Ga0070682_100072852 Ga0070682_1000728524 212
43 3300005353 Ga0070669_100013274 Ga0070669_1000132748 212
44 3300005355 Ga0070671_100452879 Ga0070671_1004528791 212
45 3300005355 Ga0070671_100678628 Ga0070671_1006786281 212
46 3300005356 Ga0070674_100162238 Ga0070674_1001622382 212
47 3300005367 Ga0070667_100000722 Ga0070667_1000007224 212
48 3300005367 Ga0070667_100386501 Ga0070667_1003865011 212
49 3300005445 Ga0070708_100364683 Ga0070708_1003646832 212
50 3300005455 Ga0070663_100108884 Ga0070663_1001088841 212
51 3300005455 Ga0070663_100319067 Ga0070663_1003190672 212
52 3300005456 Ga0070678_100851326 Ga0070678_1008513261 212
53 3300005466 Ga0070685_10010167 Ga0070685_100101673 212
54 3300005539 Ga0068853_100064787 Ga0068853_1000647872 212
55 3300005544 Ga0070686_100140209 Ga0070686_1001402093 212
56 3300005547 Ga0070693_100061368 Ga0070693_1000613683 212
57 3300005616 Ga0068852_100469245 Ga0068852_1004692451 212
58 3300005617 Ga0068859_100251673 Ga0068859_1002516732 212
59 3300005842 Ga0068858_100230455 Ga0068858_1002304552 212
60 3300006038 Ga0075365_10000705 Ga0075365_1000070510 212
61 3300006042 Ga0075368_10015011 Ga0075368_100150113 212
62 3300006048 Ga0075363_100001263 Ga0075363_1000012633 212
63 3300006048 Ga0075363_100003824 Ga0075363_1000038243 212
64 3300006048 Ga0075363_100006656 Ga0075363_1000066562 212
65 3300006048 Ga0075363_100016444 Ga0075363_1000164444 212
66 3300006048 Ga0075363_100393589 Ga0075363_1003935892 212
67 3300006051 Ga0075364_10048009 Ga0075364_100480094 212
68 3300006051 Ga0075364_10077092 Ga0075364_100770923 212
69 3300006163 Ga0070715_10249332 Ga0070715_102493321 212
70 3300006177 Ga0075362_10006082 Ga0075362_100060824 212
71 3300006177 Ga0075362_10018252 Ga0075362_100182523 212
72 3300006186 Ga0075369_10044745 Ga0075369_100447453 212
73 3300006186 Ga0075369_10141566 Ga0075369_101415661 212
74 3300006195 Ga0075366_10187437 Ga0075366_101874371 212
75 3300006353 Ga0075370_10006823 Ga0075370_100068232 212
76 3300006353 Ga0075370_10026962 Ga0075370_100269623 212
77 3300006881 Ga0068865_100672742 Ga0068865_1006727421 212
78 3300006931 Ga0097620_100251680 Ga0097620_1002516802 212
79 3300009094 Ga0111539_10080732 Ga0111539_100807323 212
80 3300009094 Ga0111539_10561421 Ga0111539_105614212 212
81 3300009098 Ga0105245_10886119 Ga0105245_108861192 212
82 3300009177 Ga0105248_10043695 Ga0105248_100436956 212
83 3300009177 Ga0105248_11135472 Ga0105248_111354722 212
84 3300013306 Ga0163162_10119227 Ga0163162_101192273 212
85 3300013308 Ga0157375_10222070 Ga0157375_102220703 212
86 3300014325 Ga0163163_10189240 Ga0163163_101892402 212
87 3300014325 Ga0163163_10247511 Ga0163163_102475111 212
88 3300014745 Ga0157377_10069783 Ga0157377_100697832 212
89 3300014968 Ga0157379_10273565 Ga0157379_102735652 212
90 3300017792 Ga0163161_10503383 Ga0163161_105033832 212
91 3300025303 Ga0209051_1001752 Ga0209051_10017524 212
92 3300025899 Ga0207642_10078364 Ga0207642_100783642 212
93 3300025931 Ga0207644_10120252 Ga0207644_101202524 212
94 3300025931 Ga0207644_10620349 Ga0207644_106203492 212
95 3300025937 Ga0207669_10047865 Ga0207669_100478652 212
96 3300025941 Ga0207711_10069330 Ga0207711_100693305 212
97 3300025986 Ga0207658_10004559 Ga0207658_100045598 212
98 3300026035 Ga0207703_10651718 Ga0207703_106517182 212
99 3300026041 Ga0207639_10044745 Ga0207639_100447452 212
100 3300026067 Ga0207678_10017171 Ga0207678_100171715 212
101 3300026067 Ga0207678_10379179 Ga0207678_103791792 212
102 3300026118 Ga0207675_100424964 Ga0207675_1004249641 212
103 3300026142 Ga0207698_10799750 Ga0207698_107997501 212
104 3300031731 Ga0307405_10498364 Ga0307405_104983642 212
105 3300031824 Ga0307413_10360921 Ga0307413_103609212 212
106 3300031852 Ga0307410_10249609 Ga0307410_102496091 212
107 3300031911 Ga0307412_10371347 Ga0307412_103713472 212
108 3300031995 Ga0307409_100294101 Ga0307409_1002941011 212
109 3300031995 Ga0307409_100489484 Ga0307409_1004894842 212
110 3300032002 Ga0307416_100052549 Ga0307416_1000525494 212
111 3300032002 Ga0307416_100557948 Ga0307416_1005579482 212
112 3300032004 Ga0307414_10170606 Ga0307414_101706063 212
113 3300032126 Ga0307415_100278018 Ga0307415_1002780182 212
114 3300039450 Ga0436363_1112948 Ga0436363_1112948_360_1010 212
115 3300041452 Ga0451793_0140214 Ga0451793_0140214_527_1177 212
116 3300041509 Ga0451843_0719068 Ga0451843_0719068_374_1024 212
117 3300041512 Ga0451853_0432786 Ga0451853_0432786_141_791 212
118 3300044694 Ga0466963_0233252 Ga0466963_0233252_642_1280 212
119 3300046507 Ga0495606_0040835 Ga0495606_0040835_1851_2492 212
120 3300046507 Ga0495606_0279307 Ga0495606_0279307_182_820 212
121 3300046516 Ga0495628_0416903 Ga0495628_0416903_160_819 212
122 3300047472 Ga0495686_0002701 Ga0495686_0002701_10968_11618 212
123 3300047472 Ga0495686_0379326 Ga0495686_0379326_107_748 212
124 3300048903 Ga0496100_0000225 Ga0496100_0000225_13534_14175 212
125 3300048903 Ga0496100_0001287 Ga0496100_0001287_1872_2513 212
126 3300048903 Ga0496100_0010237 Ga0496100_0010237_3924_4565 212
127 3300048904 Ga0496101_0000002 Ga0496101_0000002_325895_326536 212
128 3300048904 Ga0496101_0000118 Ga0496101_0000118_20712_21353 212
129 3300048904 Ga0496101_0000933 Ga0496101_0000933_1987_2628 212
130 3300048905 Ga0496102_0000003 Ga0496102_0000003_51211_51852 212
131 3300048905 Ga0496102_0022017 Ga0496102_0022017_2157_2798 212
132 3300048905 Ga0496102_0109481 Ga0496102_0109481_448_1089 212
133 3300048906 Ga0496103_0000014 Ga0496103_0000014_238764_239405 212
134 3300048906 Ga0496103_0002879 Ga0496103_0002879_714_1355 212
135 3300048906 Ga0496103_0132003 Ga0496103_0132003_765_1406 212
136 3300048907 Ga0496104_0026925 Ga0496104_0026925_2893_3534 212
137 3300048907 Ga0496104_0743854 Ga0496104_0743854_62_721 212
138 3300048908 Ga0496105_0009653 Ga0496105_0009653_1289_1930 212
139 3300048909 Ga0496106_0006137 Ga0496106_0006137_2349_2990 212
140 3300048909 Ga0496106_0090879 Ga0496106_0090879_940_1581 212
141 3300048909 Ga0496106_0137313 Ga0496106_0137313_642_1283 212
142 3300048910 Ga0496107_0000106 Ga0496107_0000106_19372_20013 212
143 3300048910 Ga0496107_0001748 Ga0496107_0001748_1782_2423 212
144 3300048910 Ga0496107_0011142 Ga0496107_0011142_4521_5162 212
145 3300048910 Ga0496107_0309402 Ga0496107_0309402_424_1065 212
146 3300048911 Ga0496108_0005477 Ga0496108_0005477_2662_3303 212
147 3300048912 Ga0496109_0000077 Ga0496109_0000077_85927_86568 212
148 3300048912 Ga0496109_0011451 Ga0496109_0011451_1234_1872 212
149 3300048912 Ga0496109_0585190 Ga0496109_0585190_290_949 212
150 3300048913 Ga0496110_0000645 Ga0496110_0000645_12149_12790 212
151 3300048913 Ga0496110_0499034 Ga0496110_0499034_58_696 212
152 3300048914 Ga0496111_0000485 Ga0496111_0000485_10319_10960 212
153 3300048915 Ga0496112_0008288 Ga0496112_0008288_72_710 212
154 3300048915 Ga0496112_0168499 Ga0496112_0168499_512_1150 212
155 3300048915 Ga0496112_0194414 Ga0496112_0194414_263_904 212
156 3300048916 Ga0496113_0294586 Ga0496113_0294586_118_777 212
157 3300048916 Ga0496113_0656117 Ga0496113_0656117_154_792 212
158 3300048917 Ga0496114_0000712 Ga0496114_0000712_491_1132 212
159 3300048917 Ga0496114_0000880 Ga0496114_0000880_8165_8806 212
160 3300048918 Ga0496115_0006185 Ga0496115_0006185_910_1551 212
161 3300048918 Ga0496115_0016508 Ga0496115_0016508_1775_2416 212
162 3300048919 Ga0496116_0000071 Ga0496116_0000071_50346_50987 212
163 3300048919 Ga0496116_0005986 Ga0496116_0005986_60_701 212
164 3300048920 Ga0496117_0000003 Ga0496117_0000003_540412_541053 212
165 3300048920 Ga0496117_0007608 Ga0496117_0007608_9825_10466 212
166 3300048921 Ga0496118_0000001 Ga0496118_0000001_540415_541056 212
167 3300048921 Ga0496118_0005885 Ga0496118_0005885_1171_1812 212
168 3300048922 Ga0496119_0002123 Ga0496119_0002123_6843_7484 212
169 3300048922 Ga0496119_0003282 Ga0496119_0003282_4059_4700 212
170 3300048922 Ga0496119_0060564 Ga0496119_0060564_780_1421 212
171 3300048923 Ga0496120_0000157 Ga0496120_0000157_60813_61454 212
172 3300048923 Ga0496120_0043131 Ga0496120_0043131_925_1566 212
173 3300048924 Ga0496121_0000002 Ga0496121_0000002_1125944_1126585 212
174 3300048924 Ga0496121_0000019 Ga0496121_0000019_60627_61268 212
175 3300048924 Ga0496121_0176379 Ga0496121_0176379_540_1190 212
176 3300048925 Ga0496122_0000051 Ga0496122_0000051_232628_233269 212
177 3300048926 Ga0496123_0022676 Ga0496123_0022676_2874_3515 212
178 3300048927 Ga0496124_0000002 Ga0496124_0000002_368004_368645 212
179 3300048928 Ga0496125_0000002 Ga0496125_0000002_1125944_1126585 212
180 3300048929 Ga0496126_0000011 Ga0496126_0000011_368004_368645 212
181 3300048929 Ga0496126_0000186 Ga0496126_0000186_51232_51873 212
182 3300049571 Ga0501034_0319895 Ga0501034_0319895_734_1372 212
183 3300049586 Ga0501070_0259638 Ga0501070_0259638_514_1152 212
184 3300049589 Ga0501073_0091966 Ga0501073_0091966_1343_1981 212
185 3300049742 Ga0501080_0119704 Ga0501080_0119704_1198_1836 212
186 3300050490 nmdc:mga03n38_161210_c1 nmdc:mga03n38_161210_c1_40_678 212
187 3300050490 nmdc:mga03n38_25276_c1 nmdc:mga03n38_25276_c1_539_1177 212
188 3300050490 nmdc:mga03n38_4282_c1 nmdc:mga03n38_4282_c1_1968_2606 212
189 3300050490 nmdc:mga03n38_944_c1 nmdc:mga03n38_944_c1_6957_7595 212
190 3300050491 nmdc:mga00v17_44398_c1 nmdc:mga00v17_44398_c1_624_1262 212
191 3300050491 nmdc:mga00v17_920_c1 nmdc:mga00v17_920_c1_6920_7558 212
192 3300050492 nmdc:mga0yw44_14727_c1 nmdc:mga0yw44_14727_c1_190_828 212
193 3300050492 nmdc:mga0yw44_852_c1 nmdc:mga0yw44_852_c1_6624_7262 212
194 3300050493 nmdc:mga0k408_169775_c1 nmdc:mga0k408_169775_c1_108_746 212
195 3300050496 nmdc:mga07m45_763_c1 nmdc:mga07m45_763_c1_8081_8719 212
196 3300050511 nmdc:mga08y16_64344_c1 nmdc:mga08y16_64344_c1_1427_2068 212
197 3300053090 Ga0500646_0069566 Ga0500646_0069566_68_721 212
198 3300053129 Ga0500628_049549 Ga0500628_049549_223_861 212
199 3300053131 Ga0500652_001182 Ga0500652_001182_1343_1981 212
200 3300003320 rootH2_10089003 rootH2_100890033 214
201 3300005329 Ga0070683_100098269 Ga0070683_1000982693 214
202 3300005435 Ga0070714_100223263 Ga0070714_1002232633 214
203 3300005435 Ga0070714_100455523 Ga0070714_1004555232 214
204 3300005435 Ga0070714_100805088 Ga0070714_1008050882 214
205 3300005436 Ga0070713_100193545 Ga0070713_1001935452 214
206 3300005437 Ga0070710_10326383 Ga0070710_103263832 214
207 3300005937 Ga0081455_10347756 Ga0081455_103477562 214
208 3300006038 Ga0075365_10342326 Ga0075365_103423262 214
209 3300006051 Ga0075364_10008785 Ga0075364_100087854 214
210 3300006186 Ga0075369_10001847 Ga0075369_100018473 214
211 3300006353 Ga0075370_10028984 Ga0075370_100289843 214
212 3300009093 Ga0105240_10837634 Ga0105240_108376342 214
213 3300009545 Ga0105237_10245229 Ga0105237_102452292 214
214 3300013105 Ga0157369_10086659 Ga0157369_100866592 214
215 3300021361 Ga0213872_10069523 Ga0213872_100695232 214
216 3300021377 Ga0213874_10049398 Ga0213874_100493982 214
217 3300021377 Ga0213874_10191124 Ga0213874_101911241 214
218 3300021384 Ga0213876_10002857 Ga0213876_100028573 214
219 3300021384 Ga0213876_10006130 Ga0213876_100061304 214
220 3300021384 Ga0213876_10019073 Ga0213876_100190732 214
221 3300021388 Ga0213875_10012643 Ga0213875_100126434 214
222 3300025913 Ga0207695_10664131 Ga0207695_106641312 214
223 3300025914 Ga0207671_10236827 Ga0207671_102368272 214
224 3300025928 Ga0207700_10087887 Ga0207700_100878873 214
225 3300025929 Ga0207664_10108065 Ga0207664_101080652 214
226 3300025929 Ga0207664_10463158 Ga0207664_104631582 214
227 3300025929 Ga0207664_10652443 Ga0207664_106524432 214
228 3300025929 Ga0207664_11117723 Ga0207664_111177231 214
229 3300025939 Ga0207665_10143705 Ga0207665_101437053 214
230 3300025981 Ga0207640_10556045 Ga0207640_105560452 214
231 3300026035 Ga0207703_10765159 Ga0207703_107651592 214
232 3300037853 Ga0436364_0178326 Ga0436364_0178326_4004_4648 214
233 3300037853 Ga0436364_0529249 Ga0436364_0529249_9357_10004 214
234 3300037853 Ga0436364_1366244 Ga0436364_1366244_42_686 214
235 3300039437 Ga0436365_0133306 Ga0436365_0133306_45533_46177 214
236 3300039437 Ga0436365_0393632 Ga0436365_0393632_1441_2085 214
237 3300039437 Ga0436365_0500692 Ga0436365_0500692_415_1059 214
238 3300039437 Ga0436365_0842203 Ga0436365_0842203_17430_18074 214
239 3300039437 Ga0436365_1111318 Ga0436365_1111318_963_1610 214
240 3300039437 Ga0436365_1406222 Ga0436365_1406222_2193_2840 214
241 3300039447 Ga0436361_1162518 Ga0436361_1162518_61_705 214
242 3300039450 Ga0436363_0391372 Ga0436363_0391372_2856_3500 214
243 3300039450 Ga0436363_0691693 Ga0436363_0691693_151_798 214
244 3300039453 Ga0436362_0963953 Ga0436362_0963953_54_698 214
245 3300041411 Ga0439466_0008319 Ga0439466_0008319_2236_2892 214
246 3300041413 Ga0439465_0026879 Ga0439465_0026879_269_925 214
247 3300041997 Ga0439431_0022522 Ga0439431_0022522_310_966 214
248 3300042004 Ga0439445_0038468 Ga0439445_0038468_531_1187 214
249 3300044656 Ga0466969_0009264 Ga0466969_0009264_409_1053 214
250 3300044656 Ga0466969_0151791 Ga0466969_0151791_150_797 214
251 3300044658 Ga0466972_0028748 Ga0466972_0028748_107_751 214
252 3300044683 Ga0466965_0012053 Ga0466965_0012053_2606_3253 214
253 3300044684 Ga0466966_0013686 Ga0466966_0013686_2336_2980 214
254 3300044684 Ga0466966_0061593 Ga0466966_0061593_1037_1681 214
255 3300044684 Ga0466966_0175981 Ga0466966_0175981_102_749 214
256 3300044693 Ga0466961_0002938 Ga0466961_0002938_62_709 214
257 3300044694 Ga0466963_0007103 Ga0466963_0007103_3184_3828 214
258 3300044694 Ga0466963_0046163 Ga0466963_0046163_845_1489 214
259 3300044694 Ga0466963_0438687 Ga0466963_0438687_27_671 214
260 3300044719 Ga0466971_0215619 Ga0466971_0215619_109_753 214
261 3300044735 Ga0466968_0014952 Ga0466968_0014952_220_864 214
262 3300044765 Ga0466970_0002489 Ga0466970_0002489_5978_6622 214
263 3300044765 Ga0466970_0029435 Ga0466970_0029435_672_1319 214
264 3300044842 Ga0466957_0021395 Ga0466957_0021395_1328_1975 214
265 3300044901 Ga0466960_0012164 Ga0466960_0012164_1206_1850 214
266 3300044901 Ga0466960_0108526 Ga0466960_0108526_11_658 214
267 3300045049 Ga0466959_0001602 Ga0466959_0001602_9366_10013 214
268 3300045049 Ga0466959_0007515 Ga0466959_0007515_4157_4801 214
269 3300045836 Ga0466958_0008215 Ga0466958_0008215_1832_2476 214
270 3300045836 Ga0466958_0044365 Ga0466958_0044365_674_1318 214
271 3300045836 Ga0466958_0307382 Ga0466958_0307382_321_965 214
272 3300045976 Ga0466967_0001096 Ga0466967_0001096_4961_5605 214
273 3300045976 Ga0466967_0023199 Ga0466967_0023199_1379_2023 214
274 3300048905 Ga0496102_0102925 Ga0496102_0102925_1530_2174 214
275 3300048906 Ga0496103_0133805 Ga0496103_0133805_835_1479 214
276 3300048917 Ga0496114_0736154 Ga0496114_0736154_209_853 214
277 3300048920 Ga0496117_0086444 Ga0496117_0086444_946_1590 214
278 3300048921 Ga0496118_0000604 Ga0496118_0000604_13613_14257 214
279 3300048929 Ga0496126_0265730 Ga0496126_0265730_276_920 214
280 3300049569 Ga0501032_0004162 Ga0501032_0004162_6909_7553 214
281 3300049569 Ga0501032_0107653 Ga0501032_0107653_690_1334 214
282 3300049570 Ga0501033_0008684 Ga0501033_0008684_3732_4376 214
283 3300049570 Ga0501033_0118148 Ga0501033_0118148_674_1318 214
284 3300049571 Ga0501034_0001377 Ga0501034_0001377_24474_25118 214
285 3300049571 Ga0501034_0160426 Ga0501034_0160426_629_1273 214
286 3300049572 Ga0501036_0089796 Ga0501036_0089796_654_1298 214
287 3300049573 Ga0501037_0002295 Ga0501037_0002295_3498_4142 214
288 3300049579 Ga0501043_0023762 Ga0501043_0023762_1564_2208 214
289 3300049579 Ga0501043_0258775 Ga0501043_0258775_649_1293 214
290 3300049580 Ga0501046_0003003 Ga0501046_0003003_2808_3452 214
291 3300049580 Ga0501046_0470870 Ga0501046_0470870_165_809 214
292 3300049581 Ga0501047_0005540 Ga0501047_0005540_1425_2069 214
293 3300049581 Ga0501047_0031165 Ga0501047_0031165_477_1121 214
294 3300049581 Ga0501047_0576470 Ga0501047_0576470_188_850 214
295 3300049582 Ga0501048_0010853 Ga0501048_0010853_3420_4064 214
296 3300049585 Ga0501069_0014837 Ga0501069_0014837_3255_3899 214
297 3300049585 Ga0501069_0132457 Ga0501069_0132457_175_837 214
298 3300049586 Ga0501070_0001697 Ga0501070_0001697_10876_11520 214
299 3300049586 Ga0501070_0317730 Ga0501070_0317730_189_851 214
300 3300049589 Ga0501073_0011218 Ga0501073_0011218_4512_5156 214
301 3300049742 Ga0501080_0008174 Ga0501080_0008174_630_1274 214
302 3300049822 Ga0501035_0001307 Ga0501035_0001307_3165_3809 214
303 3300049822 Ga0501035_0008131 Ga0501035_0008131_2226_2870 214
304 3300049822 Ga0501035_0378256 Ga0501035_0378256_376_1020 214
305 3300049823 Ga0501044_0017914 Ga0501044_0017914_3274_3918 214
306 3300049823 Ga0501044_0019276 Ga0501044_0019276_756_1400 214
307 3300050491 nmdc:mga00v17_21127_c1 nmdc:mga00v17_21127_c1_158_802 214
308 3300050496 nmdc:mga07m45_79869_c1 nmdc:mga07m45_79869_c1_413_1057 214
309 3300050516 nmdc:mga0sz30_63200_c1 nmdc:mga0sz30_63200_c1_838_1482 214
310 3300053130 Ga0500642_0192174 Ga0500642_0192174_190_834 214
311 3300061719 Ga0466962_0046837 Ga0466962_0046837_56_700 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

44

224

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8258 5 193
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.8037 7 214
3kwk-assembly1.cif.gz_A-2 crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution 0.8015 7 214
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.7972 11 214
3to0-assembly1.cif.gz_A crystal structure of mus musculus iodotyrosine deiodinase (iyd) c217a, c239a bound to fmn 0.791 19 211
ID Description Score Start End Superfamily
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9634 6 212 3.40.109.10
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9588 6 212 3.40.109.10
3gb5A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7855 9 211 3.40.109.10
3m5kB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7706 7 214 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7655 10 214 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A655ATK2-F1-model_v4 Oxidoreductase (EC 1.-.-.-) 0.9704 97 214 GO:0016491
AF-A0A1T3WA41-F1-model_v4 Nitroreductase 0.9497 68 214 GO:0016491
AF-A0A3B8XC35-F1-model_v4 Nitroreductase 0.9436 27 214 GO:0016491
AF-A0A4P5RC31-F1-model_v4 Oxidoreductase 0.9427 4 214 GO:0016491
AF-A0A1A2NNC3-F1-model_v4 Nitroreductase 0.9427 1 177 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.51 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map