F401022

General Info

Members Datasets Scaffolds Average Seq Length
311 200 264 520

Family's Representative Sequence

Representative Sequence 3300003773|Ga0055537_1000760|Ga0055537_10007604
Length 510
Sequence MSTEPLRFDNRFIRDLPGDDETGPRVREVRGAAWSAVMPTPVAAPRLLAYSPELAEQLGLGQDLLDSPDFARVFGGNALYDGMQPWAANYGGHQFGHWAGQLGDGRAISLGELLAPEGARWELQLKGAGRTPYSRGADGRAVLRSSIREFLCSEAMHHLGVPTTRALSLVATGDSVVRDMFYDGHPEAEPGAVVCRVAPSFLRFGSFELPASRGDVTLLRQLVNLCIARDFPELATGGQQPYAAWFAQVCERTAVLVAHWMRVGFVHGVMNTDNLSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLTRLAQALAPLFRFQAVHARCERDDIAAKLGLAECQDADLALMADWLTLLHDGEMDMTLAFRGLIDLDPQAPRLAVLEEAFYSEARRDAVLPALQQWLHRYAARLQADALDPVQRRERMAAANPLYVLRNWLAQEAIELAGEGDLSGVHTLQEVLRRPYEVQPGREHYAAKRPEWARNKAGCSMLSCSS

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
12 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
13 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
14 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
15 2818991457 Xanthomonas translucens 569 Isolate Unclassified
16 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
17 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
18 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
19 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
20 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
21 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
22 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
23 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
24 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
25 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
26 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
27 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
28 2919513703 Luteimonas sp. 3794 Isolate Unclassified
29 2919675420 Luteimonas terrae 4099 Isolate Unclassified
30 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
31 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
32 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
33 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
34 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
35 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
36 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
37 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
38 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
39 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
40 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
41 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
42 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
43 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
44 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
45 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
46 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
47 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
48 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
49 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
55 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
200 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.89
Metatranscriptomes 0
Isolates 15.11

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 18.97
Nodule 0.32
Rhizoplane 1.61
Rhizosphere 50.48
Stem 0
Stem Tuber 0
Unclassified 28.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000214 3300002705 Bacteria 40310
2 JGI25164J39214_1000310 3300002772 Bacteria 32075
3 JGI25152J39213_1000931 3300002773 Bacteria 14347
4 JGI25150J39212_1001048 3300002774 Bacteria 8442
5 JGI25151J46595_10000178 3300003187 Bacteria 80734
6 JGI25165J46597_1000580 3300003214 Bacteria 32075
7 JGI25153J46596_10000131 3300003215 Bacteria 80734
8 rootH2_10006484 3300003320 Bacteria 5108
9 Ga0055535_1000457 3300003761 Bacteria 37713
10 Ga0055542_1000496 3300003762 Bacteria 36150
11 Ga0055537_1000760 3300003773 Bacteria 16494
12 Ga0055524_1000174 3300003775 Bacteria 73269
13 Ga0055536_1004959 3300003781 Bacteria 6628
14 Ga0055534_1000084 3300003784 Bacteria 73269
15 Ga0055534_1000364 3300003784 Bacteria 28397
16 Ga0055528_1000016 3300003790 Bacteria 158479
17 Ga0055528_1000453 3300003790 Bacteria 32772
18 Ga0055530_10002975 3300003791 Bacteria 10192
19 Ga0055530_10004909 3300003791 Bacteria 6632
20 Ga0055531_10006497 3300003794 Bacteria 6628
21 Ga0055531_10008331 3300003794 Bacteria 5492
22 Ga0055531_10010320 3300003794 Bacteria 4656
23 Ga0055531_10024400 3300003794 Bacteria 2233
24 Ga0058692_1000002 3300003856 Bacteria 508401
25 Ga0058692_1000018 3300003856 Bacteria 264544
26 Ga0065704_10070659 3300005289 Bacteria 18211
27 Ga0065704_10077530 3300005289 Bacteria 4704
28 Ga0070670_100007556 3300005331 Bacteria 9226
29 Ga0070659_100007528 3300005366 Bacteria 7912
30 Ga0070681_10005351 3300005458 Bacteria 12391
31 Ga0070665_100045164 3300005548 Bacteria 4424
32 Ga0068857_100015568 3300005577 Bacteria 6643
33 Ga0068856_100000116 3300005614 Bacteria 79220
34 Ga0075364_10000145 3300006051 Bacteria 31120
35 Ga0105251_10000048 3300009011 Bacteria 110218
36 Ga0105240_10003022 3300009093 Bacteria 26452
37 Ga0105243_10010881 3300009148 Bacteria 6882
38 Ga0105237_10000105 3300009545 Bacteria 118218
39 Ga0105238_10053844 3300009551 Bacteria 4043
40 Ga0105029_100212 3300009984 Bacteria 2982
41 Ga0157373_10038157 3300013100 Bacteria 3443
42 Ga0157373_10046232 3300013100 Bacteria 3106
43 Ga0157373_10100722 3300013100 Bacteria 2033
44 Ga0157371_10000337 3300013102 Bacteria 60433
45 Ga0157371_10019239 3300013102 Bacteria 5038
46 Ga0157371_10044930 3300013102 Bacteria 3145
47 Ga0157370_10021892 3300013104 Bacteria 6366
48 Ga0157370_10061408 3300013104 Bacteria 3567
49 Ga0157369_10197253 3300013105 Bacteria 2113
50 Ga0157372_10053481 3300013307 Bacteria 4501
51 Ga0157372_10114021 3300013307 Bacteria 3098
52 Ga0182008_10000115 3300014497 Bacteria 61294
53 Ga0182006_1013417 3300015261 Bacteria 3556
54 Ga0182007_10000103 3300015262 Bacteria 59975
55 Ga0182005_1000251 3300015265 Bacteria 34134
56 Ga0182005_1004923 3300015265 Bacteria 4233
57 Ga0183369_1006 3300015685 Bacteria 449058
58 Ga0163161_10029834 3300017792 Bacteria 3877
59 Ga0163161_10031141 3300017792 Bacteria 3799
60 Ga0163161_10048719 3300017792 Bacteria 3060
61 Ga0209672_100045 3300025228 Bacteria 264926
62 Ga0207427_100139 3300025231 Bacteria 84807
63 Ga0209437_100462 3300025233 Bacteria 32102
64 Ga0209258_100200 3300025242 Bacteria 123379
65 Ga0207425_1000899 3300025245 Bacteria 14378
66 Ga0209646_1000431 3300025246 Bacteria 23248
67 Ga0209026_1000111 3300025250 Bacteria 140599
68 Ga0209026_1000737 3300025250 Bacteria 18882
69 Ga0209148_1000045 3300025254 Bacteria 448076
70 Ga0209759_1000247 3300025256 Bacteria 80850
71 Ga0209129_1000178 3300025258 Bacteria 92006
72 Ga0209233_1000251 3300025261 Bacteria 84807
73 Ga0209565_1000001 3300025263 Bacteria 2950419
74 Ga0209565_1000014 3300025263 Bacteria 530302
75 Ga0209455_1000035 3300025272 Bacteria 479071
76 Ga0209455_1000211 3300025272 Bacteria 82660
77 Ga0209673_1000001 3300025273 Bacteria 3176258
78 Ga0209673_1000065 3300025273 Bacteria 252799
79 Ga0209130_1004802 3300025284 Bacteria 4963
80 Ga0209675_1000001 3300025291 Bacteria 2950293
81 Ga0209675_1000011 3300025291 Bacteria 520597
82 Ga0209676_1000079 3300025292 Bacteria 290447
83 Ga0209676_1000086 3300025292 Bacteria 264155
84 Ga0209676_1000324 3300025292 Bacteria 92019
85 Ga0209676_1001686 3300025292 Bacteria 19134
86 Ga0209025_1000012 3300025294 Bacteria 924362
87 Ga0209564_1000001 3300025295 Bacteria 3176258
88 Ga0209564_1000221 3300025295 Bacteria 129537
89 Ga0209758_1000018 3300025297 Bacteria 753320
90 Ga0209050_1000689 3300025298 Bacteria 50775
91 Ga0209050_1006230 3300025298 Bacteria 7148
92 Ga0209256_1000002 3300025299 Bacteria 1906740
93 Ga0209051_1006051 3300025303 Bacteria 6906
94 Ga0209257_1000081 3300025304 Bacteria 306577
95 Ga0209257_1000251 3300025304 Bacteria 123796
96 Ga0209257_1006196 3300025304 Bacteria 7853
97 Ga0209257_1008000 3300025304 Bacteria 6173
98 Ga0207713_1000276 3300025735 Bacteria 61303
99 Ga0207647_10013404 3300025904 Bacteria 5683
100 Ga0207707_10004791 3300025912 Bacteria 11869
101 Ga0207707_10015313 3300025912 Bacteria 6676
102 Ga0207695_10001526 3300025913 Bacteria 38277
103 Ga0207695_10001623 3300025913 Bacteria 36467
104 Ga0207695_10010557 3300025913 Bacteria 11294
105 Ga0207671_10004557 3300025914 Bacteria 13165
106 Ga0207657_10068945 3300025919 Bacteria 3003
107 Ga0207650_10043001 3300025925 Bacteria 3314
108 Ga0207690_10005024 3300025932 Bacteria 7814
109 Ga0207690_10070329 3300025932 Bacteria 2410
110 Ga0207709_10002852 3300025935 Bacteria 10599
111 Ga0207709_10010431 3300025935 Bacteria 5114
112 Ga0207667_10014869 3300025949 Bacteria 8851
113 Ga0207678_10006028 3300026067 Bacteria 10782
114 Ga0207702_10000170 3300026078 Bacteria 77504
115 Ga0207674_10054542 3300026116 Bacteria 4069
116 Ga0209371_1000004 3300027312 Bacteria 1098197
117 Ga0209371_1000011 3300027312 Bacteria 848456
118 Ga0209971_1000868 3300027682 Bacteria 7800
119 Ga0268256_1000005 3300030500 Bacteria 1082342
120 Ga0268256_1000011 3300030500 Bacteria 848625
121 Ga0307413_10005607 3300031824 Bacteria 5626
122 Ga0307406_10001269 3300031901 Bacteria 14134
123 Ga0307412_10035295 3300031911 Bacteria 3193
124 Ga0307414_10006364 3300032004 Bacteria 6578
125 Ga0307414_10012548 3300032004 Bacteria 5015
126 Ga0395898_0025758 3300037466 Bacteria 5923
127 Ga0395898_0086080 3300037466 Bacteria 3029
128 Ga0395901_0000832 3300038443 Bacteria 34003
129 Ga0395901_0006085 3300038443 Bacteria 12223
130 Ga0237819_00775 3300038705 Bacteria 10226
131 Ga0237819_02445 3300038705 Bacteria 3737
132 Ga0439439_0005812 3300041406 Bacteria 2834
133 Ga0439465_0005458 3300041413 Bacteria 4059
134 Ga0451800_0623110 3300041459 Bacteria 3299
135 Ga0451807_0289573 3300041486 Bacteria 2889
136 Ga0439445_0000818 3300042004 Bacteria 6572
137 Ga0439449_0005171 3300042007 Bacteria 5010
138 Ga0450911_000201 3300042115 Bacteria 23369
139 Ga0451577_0009269 3300042876 Bacteria 9486
140 Ga0466989_0047582 3300044663 Bacteria 2616
141 Ga0466966_0003802 3300044684 Bacteria 9957
142 Ga0466961_0026381 3300044693 Bacteria 3735
143 Ga0466971_0016463 3300044719 Bacteria 3264
144 Ga0466959_0003832 3300045049 Bacteria 9976
145 Ga0495627_002650 3300046453 Bacteria 8410
146 Ga0495638_0000007 3300046460 Bacteria 602783
147 Ga0495638_0002984 3300046460 Bacteria 13503
148 Ga0495638_0042287 3300046460 Bacteria 2879
149 Ga0495610_0004353 3300046512 Bacteria 10509
150 Ga0495610_0054043 3300046512 Bacteria 1942
151 Ga0495631_0012989 3300046518 Bacteria 4054
152 Ga0495643_0005007 3300046522 Bacteria 9084
153 Ga0495663_0000254 3300046525 Bacteria 20648
154 Ga0495663_0000667 3300046525 Bacteria 11844
155 Ga0495663_0002186 3300046525 Bacteria 5959
156 Ga0495663_0009512 3300046525 Bacteria 2698
157 Ga0495633_0002737 3300046558 Bacteria 12205
158 Ga0495633_0008750 3300046558 Bacteria 5668
159 Ga0495633_0021283 3300046558 Bacteria 3245
160 Ga0495633_0026251 3300046558 Bacteria 2859
161 Ga0495625_0036621 3300046660 Bacteria 3605
162 Ga0495671_0008423 3300046692 Bacteria 5802
163 Ga0495636_0000021 3300047318 Bacteria 72964
164 Ga0495672_0000596 3300047320 Bacteria 40742
165 Ga0495686_0051118 3300047472 Bacteria 2594
166 Ga0496105_0021887 3300048908 Bacteria 5175
167 Ga0496113_0101420 3300048916 Bacteria 2231
168 Ga0496114_0001100 3300048917 Bacteria 20414
169 Ga0496116_0000978 3300048919 Bacteria 35089
170 Ga0496116_0011500 3300048919 Bacteria 7316
171 Ga0496117_0000810 3300048920 Bacteria 48467
172 Ga0496117_0001291 3300048920 Bacteria 36931
173 Ga0496117_0001357 3300048920 Bacteria 35796
174 Ga0496117_0003022 3300048920 Bacteria 20187
175 Ga0496117_0017844 3300048920 Bacteria 5914
176 Ga0496117_0093855 3300048920 Bacteria 1923
177 Ga0496118_0000579 3300048921 Bacteria 60445
178 Ga0496118_0003511 3300048921 Bacteria 19659
179 Ga0496118_0005968 3300048921 Bacteria 13587
180 Ga0496118_0010286 3300048921 Bacteria 9280
181 Ga0496118_0011790 3300048921 Bacteria 8488
182 Ga0496118_0071065 3300048921 Bacteria 2508
183 Ga0496118_0097615 3300048921 Bacteria 1998
184 Ga0496119_0001017 3300048922 Bacteria 35895
185 Ga0496119_0001260 3300048922 Bacteria 31474
186 Ga0496119_0003751 3300048922 Bacteria 15551
187 Ga0496119_0066635 3300048922 Bacteria 2126
188 Ga0496120_0000335 3300048923 Bacteria 78595
189 Ga0496120_0000511 3300048923 Bacteria 60526
190 Ga0496120_0000885 3300048923 Bacteria 42196
191 Ga0496121_0003167 3300048924 Bacteria 23721
192 Ga0496121_0009571 3300048924 Bacteria 11103
193 Ga0496121_0044710 3300048924 Bacteria 3815
194 Ga0496122_0001198 3300048925 Bacteria 44276
195 Ga0496122_0004262 3300048925 Bacteria 17939
196 Ga0496122_0043293 3300048925 Bacteria 3529
197 Ga0496122_0050522 3300048925 Bacteria 3170
198 Ga0496122_0050523 3300048925 Bacteria 3170
199 Ga0496123_0000101 3300048926 Bacteria 169939
200 Ga0496123_0002081 3300048926 Bacteria 25765
201 Ga0496123_0003760 3300048926 Bacteria 16647
202 Ga0496123_0006472 3300048926 Bacteria 11333
203 Ga0496123_0061314 3300048926 Bacteria 2418
204 Ga0496124_0000932 3300048927 Bacteria 47111
205 Ga0496124_0001594 3300048927 Bacteria 32654
206 Ga0496124_0003368 3300048927 Bacteria 19637
207 Ga0496124_0005461 3300048927 Bacteria 14287
208 Ga0496124_0007341 3300048927 Bacteria 11740
209 Ga0496124_0008353 3300048927 Bacteria 10841
210 Ga0496124_0070030 3300048927 Bacteria 2910
211 Ga0496125_0001775 3300048928 Bacteria 29811
212 Ga0496125_0002225 3300048928 Bacteria 25834
213 Ga0496125_0004974 3300048928 Bacteria 15028
214 Ga0496125_0013252 3300048928 Bacteria 8116
215 Ga0496126_0001534 3300048929 Bacteria 35571
216 Ga0496126_0006254 3300048929 Bacteria 13310
217 Ga0496126_0007181 3300048929 Bacteria 12261
218 Ga0496126_0037935 3300048929 Bacteria 4487
219 Ga0496126_0045256 3300048929 Bacteria 4046
220 Ga0496126_0079192 3300048929 Bacteria 2909
221 Ga0501031_0068313 3300049568 Bacteria 2315
222 Ga0501032_0091694 3300049569 Bacteria 2015
223 Ga0501033_0006265 3300049570 Bacteria 9324
224 Ga0501033_0025173 3300049570 Bacteria 4483
225 Ga0501033_0084267 3300049570 Bacteria 2329
226 Ga0501034_0000083 3300049571 Bacteria 169656
227 Ga0501034_0000578 3300049571 Bacteria 57983
228 Ga0501034_0040668 3300049571 Bacteria 4705
229 Ga0501034_0050861 3300049571 Bacteria 4178
230 Ga0501034_0116649 3300049571 Bacteria 2658
231 Ga0501036_0037580 3300049572 Bacteria 4096
232 Ga0501036_0080507 3300049572 Bacteria 2753
233 Ga0501036_0099582 3300049572 Bacteria 2458
234 Ga0501036_0117003 3300049572 Bacteria 2251
235 Ga0501037_0006309 3300049573 Bacteria 8673
236 Ga0501038_0022587 3300049574 Bacteria 5634
237 Ga0501038_0034297 3300049574 Bacteria 4463
238 Ga0501039_0052905 3300049575 Bacteria 3141
239 Ga0501043_0014742 3300049579 Bacteria 6120
240 Ga0501043_0051895 3300049579 Bacteria 3222
241 Ga0501043_0099382 3300049579 Bacteria 2287
242 Ga0501046_0134168 3300049580 Bacteria 1876
243 Ga0501047_0005868 3300049581 Bacteria 11556
244 Ga0501047_0041493 3300049581 Bacteria 4446
245 Ga0501047_0160062 3300049581 Bacteria 2123
246 Ga0501073_0001203 3300049589 Bacteria 18872
247 Ga0501073_0049252 3300049589 Bacteria 2955
248 Ga0501074_0029452 3300049590 Bacteria 3977
249 Ga0501079_0112211 3300049741 Bacteria 2119
250 Ga0501080_0010669 3300049742 Bacteria 8407
251 Ga0501080_0093111 3300049742 Bacteria 2798
252 Ga0501080_0116546 3300049742 Bacteria 2476
253 Ga0501083_0016678 3300049744 Bacteria 5133
254 Ga0501035_0006165 3300049822 Bacteria 11284
255 Ga0501035_0071938 3300049822 Bacteria 3061
256 Ga0501044_0009464 3300049823 Bacteria 10608
257 Ga0501044_0066546 3300049823 Bacteria 3673
258 nmdc:mga00v17_1971_c1 3300050491 Bacteria 10615
259 nmdc:mga00v17_50924_c1 3300050491 Bacteria 2518
260 Ga0500651_0002872 3300053093 Bacteria 9254
261 Ga0500634_0000171 3300053161 Bacteria 21519
262 Ga0501084_0052309 3300054114 Bacteria 3418
263 Ga0501082_0139835 3300060353 Bacteria 2101
264 Ga0466962_0010854 3300061719 Bacteria 4380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10070659 Ga0065704_1007065914 489
2 3300003856 Ga0058692_1000002 Ga0058692_100000225 496
3 3300027312 Ga0209371_1000004 Ga0209371_1000004233 496
4 3300030500 Ga0268256_1000005 Ga0268256_1000005812 496
5 3300013100 Ga0157373_10046232 Ga0157373_100462321 504
6 3300041413 Ga0439465_0005458 Ga0439465_0005458_2366_3925 505
7 3300042007 Ga0439449_0005171 Ga0439449_0005171_2334_3893 505
8 3300025292 Ga0209676_1000324 Ga0209676_100032428 506
9 3300003320 rootH2_10006484 rootH2_100064845 508
10 3300003773 Ga0055537_1000760 Ga0055537_10007604 510
11 3300003784 Ga0055534_1000364 Ga0055534_100036411 510
12 3300003790 Ga0055528_1000453 Ga0055528_100045314 510
13 3300003794 Ga0055531_10024400 Ga0055531_100244002 510
14 3300006051 Ga0075364_10000145 Ga0075364_1000014528 510
15 3300025263 Ga0209565_1000014 Ga0209565_100001464 510
16 3300025273 Ga0209673_1000065 Ga0209673_1000065201 510
17 3300025291 Ga0209675_1000011 Ga0209675_1000011344 510
18 3300025295 Ga0209564_1000221 Ga0209564_1000221127 510
19 3300025304 Ga0209257_1008000 Ga0209257_10080005 510
20 3300050491 nmdc:mga00v17_1971_c1 nmdc:mga00v17_1971_c1_4431_5987 510
21 3300048917 Ga0496114_0001100 Ga0496114_0001100_11249_12817 511
22 3300048929 Ga0496126_0006254 Ga0496126_0006254_7555_9123 511
23 iso_pu_bacteria 2643221573 2643878697 513
24 iso_pu_bacteria 2643221720 2644660013 513
25 iso_pu_bacteria 2643221728 2644697316 513
26 iso_pu_bacteria 2852684882 2852686107 513
27 iso_pu_bacteria 2895511927 2895515691 513
28 iso_pu_bacteria 2895522137 2895523522 513
29 iso_pu_bacteria 2895525241 2895526313 513
30 iso_pu_bacteria 2919130084 2919133646 513
31 iso_pu_bacteria 2929195423 2929197299 513
32 iso_pu_bacteria 2643221593 2643974230 514
33 iso_pu_bacteria 2747842501 2748016001 514
34 iso_pu_bacteria 2941489479 2941493772 514
35 iso_pu_bacteria 2995948881 2995951108 514
36 iso_pu_bacteria 2643221559 2643817501 515
37 iso_pu_bacteria 2643221586 2643940155 515
38 iso_pu_bacteria 2643221612 2644079283 515
39 iso_pu_bacteria 2643221727 2644694727 515
40 iso_pu_bacteria 2818991457 2819662902 515
41 iso_pu_bacteria 8021626552 8021629430 515
42 3300002773 JGI25152J39213_1000931 JGI25152J39213_10009317 516
43 3300002774 JGI25150J39212_1001048 JGI25150J39212_10010487 516
44 3300003187 JGI25151J46595_10000178 JGI25151J46595_1000017867 516
45 3300003215 JGI25153J46596_10000131 JGI25153J46596_100001316 516
46 3300025245 Ga0207425_1000899 Ga0207425_10008996 516
47 3300025258 Ga0209129_1000178 Ga0209129_10001786 516
48 3300025294 Ga0209025_1000012 Ga0209025_1000012114 516
49 3300025297 Ga0209758_1000018 Ga0209758_1000018544 516
50 3300003794 Ga0055531_10008331 Ga0055531_100083313 517
51 3300003856 Ga0058692_1000018 Ga0058692_100001895 517
52 3300005289 Ga0065704_10077530 Ga0065704_100775301 517
53 3300005331 Ga0070670_100007556 Ga0070670_1000075565 517
54 3300009011 Ga0105251_10000048 Ga0105251_1000004859 517
55 3300009148 Ga0105243_10010881 Ga0105243_100108812 517
56 3300015265 Ga0182005_1004923 Ga0182005_10049232 517
57 3300025304 Ga0209257_1000251 Ga0209257_100025124 517
58 3300025735 Ga0207713_1000276 Ga0207713_100027626 517
59 3300025925 Ga0207650_10043001 Ga0207650_100430012 517
60 3300025935 Ga0207709_10010431 Ga0207709_100104315 517
61 3300027312 Ga0209371_1000011 Ga0209371_1000011133 517
62 3300030500 Ga0268256_1000011 Ga0268256_1000011133 517
63 3300041459 Ga0451800_0623110 Ga0451800_0623110_996_2549 517
64 3300041486 Ga0451807_0289573 Ga0451807_0289573_649_2202 517
65 3300048920 Ga0496117_0001357 Ga0496117_0001357_28102_29655 517
66 3300048921 Ga0496118_0011790 Ga0496118_0011790_4667_6220 517
67 3300048921 Ga0496118_0097615 Ga0496118_0097615_331_1884 517
68 3300048922 Ga0496119_0001260 Ga0496119_0001260_17277_18830 517
69 3300048923 Ga0496120_0000885 Ga0496120_0000885_6471_8024 517
70 3300048925 Ga0496122_0001198 Ga0496122_0001198_6469_8022 517
71 3300048925 Ga0496122_0004262 Ga0496122_0004262_2475_4043 517
72 3300048926 Ga0496123_0000101 Ga0496123_0000101_36696_38249 517
73 3300048926 Ga0496123_0003760 Ga0496123_0003760_13500_15068 517
74 3300048927 Ga0496124_0000932 Ga0496124_0000932_33818_35371 517
75 3300048929 Ga0496126_0045256 Ga0496126_0045256_408_1976 517
76 iso_pu_bacteria 2576861471 2578458666 517
77 iso_pu_bacteria 2747842428 2747948221 517
78 iso_pu_bacteria 2765235840 2765578714 517
79 iso_pu_bacteria 2816332141 2816516788 517
80 iso_pu_bacteria 2842391507 2842395024 517
81 iso_pu_bacteria 2842757796 2842758372 517
82 iso_pu_bacteria 2852649853 2852651041 517
83 iso_pu_bacteria 2857442823 2857445995 517
84 iso_pu_bacteria 2874220319 2874221342 517
85 iso_pu_bacteria 2919089067 2919091847 517
86 iso_pu_bacteria 2919134579 2919138020 517
87 iso_pu_bacteria 2928496128 2928496311 517
88 iso_pu_bacteria 2931380184 2931381004 517
89 iso_pu_bacteria 2937610967 2937612163 517
90 iso_pu_bacteria 2939589442 2939590801 517
91 iso_pu_bacteria 2939622612 2939622989 517
92 iso_pu_bacteria 2939626828 2939629748 517
93 iso_pu_bacteria 2941475908 2941478082 517
94 iso_pu_bacteria 2961047084 2961048108 517
95 iso_pu_bacteria 2961064222 2961065125 517
96 iso_pu_bacteria 2974307012 2974309170 517
97 iso_pu_bacteria 2977247770 2977249888 517
98 iso_pu_bacteria 2984514374 2984515622 517
99 3300003775 Ga0055524_1000174 Ga0055524_100017423 518
100 3300003784 Ga0055534_1000084 Ga0055534_100008423 518
101 3300003790 Ga0055528_1000016 Ga0055528_100001641 518
102 3300013307 Ga0157372_10114021 Ga0157372_101140212 518
103 3300025263 Ga0209565_1000001 Ga0209565_10000011738 518
104 3300025273 Ga0209673_1000001 Ga0209673_10000011738 518
105 3300025291 Ga0209675_1000001 Ga0209675_1000001794 518
106 3300025295 Ga0209564_1000001 Ga0209564_1000001956 518
107 3300025299 Ga0209256_1000002 Ga0209256_1000002596 518
108 3300031901 Ga0307406_10001269 Ga0307406_100012696 518
109 3300037466 Ga0395898_0025758 Ga0395898_0025758_2097_3653 518
110 3300037466 Ga0395898_0086080 Ga0395898_0086080_1043_2599 518
111 3300038443 Ga0395901_0000832 Ga0395901_0000832_28015_29571 518
112 3300038443 Ga0395901_0006085 Ga0395901_0006085_8041_9597 518
113 3300038705 Ga0237819_00775 Ga0237819_00775_2901_4457 518
114 3300048920 Ga0496117_0093855 Ga0496117_0093855_203_1759 518
115 3300049568 Ga0501031_0068313 Ga0501031_0068313_315_1871 518
116 3300049570 Ga0501033_0084267 Ga0501033_0084267_452_2008 518
117 3300049571 Ga0501034_0116649 Ga0501034_0116649_1055_2611 518
118 3300049579 Ga0501043_0014742 Ga0501043_0014742_1923_3479 518
119 3300049580 Ga0501046_0134168 Ga0501046_0134168_63_1619 518
120 3300049581 Ga0501047_0005868 Ga0501047_0005868_7663_9219 518
121 3300049581 Ga0501047_0041493 Ga0501047_0041493_345_1901 518
122 iso_pu_bacteria 2923516293 2923518576 518
123 3300003761 Ga0055535_1000457 Ga0055535_100045717 519
124 3300003762 Ga0055542_1000496 Ga0055542_100049611 519
125 3300005366 Ga0070659_100007528 Ga0070659_1000075285 519
126 3300005458 Ga0070681_10005351 Ga0070681_100053516 519
127 3300005577 Ga0068857_100015568 Ga0068857_1000155683 519
128 3300005614 Ga0068856_100000116 Ga0068856_10000011634 519
129 3300009093 Ga0105240_10003022 Ga0105240_1000302217 519
130 3300009545 Ga0105237_10000105 Ga0105237_1000010580 519
131 3300009551 Ga0105238_10053844 Ga0105238_100538443 519
132 3300009984 Ga0105029_100212 Ga0105029_1002123 519
133 3300013100 Ga0157373_10038157 Ga0157373_100381572 519
134 3300013102 Ga0157371_10044930 Ga0157371_100449302 519
135 3300013307 Ga0157372_10053481 Ga0157372_100534815 519
136 3300015685 Ga0183369_1006 Ga0183369_1006273 519
137 3300025250 Ga0209026_1000111 Ga0209026_100011136 519
138 3300025272 Ga0209455_1000211 Ga0209455_100021123 519
139 3300025292 Ga0209676_1000086 Ga0209676_100008662 519
140 3300025904 Ga0207647_10013404 Ga0207647_100134045 519
141 3300025912 Ga0207707_10004791 Ga0207707_100047916 519
142 3300025912 Ga0207707_10015313 Ga0207707_100153135 519
143 3300025913 Ga0207695_10001526 Ga0207695_1000152628 519
144 3300025913 Ga0207695_10001623 Ga0207695_1000162321 519
145 3300025913 Ga0207695_10010557 Ga0207695_100105577 519
146 3300025914 Ga0207671_10004557 Ga0207671_100045572 519
147 3300025919 Ga0207657_10068945 Ga0207657_100689452 519
148 3300025932 Ga0207690_10005024 Ga0207690_100050243 519
149 3300025932 Ga0207690_10070329 Ga0207690_100703292 519
150 3300025949 Ga0207667_10014869 Ga0207667_100148695 519
151 3300026067 Ga0207678_10006028 Ga0207678_100060285 519
152 3300026078 Ga0207702_10000170 Ga0207702_1000017012 519
153 3300026116 Ga0207674_10054542 Ga0207674_100545423 519
154 3300031824 Ga0307413_10005607 Ga0307413_100056073 519
155 3300032004 Ga0307414_10012548 Ga0307414_100125486 519
156 3300041406 Ga0439439_0005812 Ga0439439_0005812_657_2222 519
157 3300042004 Ga0439445_0000818 Ga0439445_0000818_2660_4219 519
158 3300042876 Ga0451577_0009269 Ga0451577_0009269_7074_8648 519
159 3300046460 Ga0495638_0000007 Ga0495638_0000007_278759_280321 519
160 3300046525 Ga0495663_0000254 Ga0495663_0000254_9964_11523 519
161 3300046692 Ga0495671_0008423 Ga0495671_0008423_1810_3369 519
162 3300047318 Ga0495636_0000021 Ga0495636_0000021_9265_10824 519
163 3300048922 Ga0496119_0003751 Ga0496119_0003751_9344_10912 519
164 3300048923 Ga0496120_0000335 Ga0496120_0000335_28411_29979 519
165 3300048929 Ga0496126_0007181 Ga0496126_0007181_7261_8829 519
166 3300049570 Ga0501033_0006265 Ga0501033_0006265_3980_5539 519
167 3300049570 Ga0501033_0025173 Ga0501033_0025173_102_1661 519
168 3300049571 Ga0501034_0000083 Ga0501034_0000083_117444_119012 519
169 3300049571 Ga0501034_0000578 Ga0501034_0000578_55386_56945 519
170 3300049571 Ga0501034_0050861 Ga0501034_0050861_1002_2561 519
171 3300049572 Ga0501036_0037580 Ga0501036_0037580_1962_3521 519
172 3300049572 Ga0501036_0080507 Ga0501036_0080507_343_1902 519
173 3300049572 Ga0501036_0099582 Ga0501036_0099582_298_1857 519
174 3300049574 Ga0501038_0034297 Ga0501038_0034297_884_2443 519
175 3300049579 Ga0501043_0051895 Ga0501043_0051895_1342_2901 519
176 3300049589 Ga0501073_0001203 Ga0501073_0001203_12867_14426 519
177 3300049590 Ga0501074_0029452 Ga0501074_0029452_1916_3475 519
178 3300049741 Ga0501079_0112211 Ga0501079_0112211_54_1613 519
179 3300049742 Ga0501080_0010669 Ga0501080_0010669_5998_7557 519
180 3300049742 Ga0501080_0116546 Ga0501080_0116546_73_1632 519
181 3300049744 Ga0501083_0016678 Ga0501083_0016678_764_2335 519
182 3300049822 Ga0501035_0071938 Ga0501035_0071938_1318_2877 519
183 3300049823 Ga0501044_0066546 Ga0501044_0066546_2019_3578 519
184 3300053093 Ga0500651_0002872 Ga0500651_0002872_213_1772 519
185 3300054114 Ga0501084_0052309 Ga0501084_0052309_126_1685 519
186 3300060353 Ga0501082_0139835 Ga0501082_0139835_44_1603 519
187 iso_pu_bacteria 2571042365 2572254058 519
188 iso_pu_bacteria 8021622325 8021626420 519
189 3300002705 JGI25156J39149_1000214 JGI25156J39149_100021424 521
190 3300002772 JGI25164J39214_1000310 JGI25164J39214_100031024 521
191 3300003214 JGI25165J46597_1000580 JGI25165J46597_100058024 521
192 3300003781 Ga0055536_1004959 Ga0055536_10049592 521
193 3300003791 Ga0055530_10002975 Ga0055530_100029752 521
194 3300003791 Ga0055530_10004909 Ga0055530_100049092 521
195 3300003794 Ga0055531_10006497 Ga0055531_100064972 521
196 3300003794 Ga0055531_10010320 Ga0055531_100103203 521
197 3300005548 Ga0070665_100045164 Ga0070665_1000451643 521
198 3300013100 Ga0157373_10100722 Ga0157373_101007221 521
199 3300013102 Ga0157371_10000337 Ga0157371_1000033725 521
200 3300013102 Ga0157371_10019239 Ga0157371_100192393 521
201 3300013104 Ga0157370_10021892 Ga0157370_100218923 521
202 3300013104 Ga0157370_10061408 Ga0157370_100614081 521
203 3300013105 Ga0157369_10197253 Ga0157369_101972531 521
204 3300014497 Ga0182008_10000115 Ga0182008_1000011530 521
205 3300015261 Ga0182006_1013417 Ga0182006_10134173 521
206 3300015262 Ga0182007_10000103 Ga0182007_1000010326 521
207 3300015265 Ga0182005_1000251 Ga0182005_100025111 521
208 3300017792 Ga0163161_10029834 Ga0163161_100298342 521
209 3300017792 Ga0163161_10031141 Ga0163161_100311412 521
210 3300017792 Ga0163161_10048719 Ga0163161_100487191 521
211 3300025228 Ga0209672_100045 Ga0209672_10004560 521
212 3300025231 Ga0207427_100139 Ga0207427_1001399 521
213 3300025233 Ga0209437_100462 Ga0209437_10046224 521
214 3300025242 Ga0209258_100200 Ga0209258_10020062 521
215 3300025246 Ga0209646_1000431 Ga0209646_10004312 521
216 3300025250 Ga0209026_1000737 Ga0209026_100073714 521
217 3300025254 Ga0209148_1000045 Ga0209148_1000045345 521
218 3300025256 Ga0209759_1000247 Ga0209759_100024762 521
219 3300025261 Ga0209233_1000251 Ga0209233_10002519 521
220 3300025272 Ga0209455_1000035 Ga0209455_1000035346 521
221 3300025284 Ga0209130_1004802 Ga0209130_10048023 521
222 3300025292 Ga0209676_1000079 Ga0209676_1000079284 521
223 3300025292 Ga0209676_1001686 Ga0209676_100168614 521
224 3300025298 Ga0209050_1000689 Ga0209050_100068925 521
225 3300025298 Ga0209050_1006230 Ga0209050_10062302 521
226 3300025303 Ga0209051_1006051 Ga0209051_10060513 521
227 3300025304 Ga0209257_1000081 Ga0209257_1000081294 521
228 3300025304 Ga0209257_1006196 Ga0209257_10061963 521
229 3300025935 Ga0207709_10002852 Ga0207709_100028522 521
230 3300027682 Ga0209971_1000868 Ga0209971_10008688 521
231 3300031911 Ga0307412_10035295 Ga0307412_100352953 521
232 3300032004 Ga0307414_10006364 Ga0307414_100063641 521
233 3300038705 Ga0237819_02445 Ga0237819_02445_818_2383 521
234 3300042115 Ga0450911_000201 Ga0450911_000201_20417_21982 521
235 3300044663 Ga0466989_0047582 Ga0466989_0047582_197_1762 521
236 3300044684 Ga0466966_0003802 Ga0466966_0003802_6994_8559 521
237 3300044693 Ga0466961_0026381 Ga0466961_0026381_772_2337 521
238 3300044719 Ga0466971_0016463 Ga0466971_0016463_1629_3194 521
239 3300045049 Ga0466959_0003832 Ga0466959_0003832_5443_7008 521
240 3300046453 Ga0495627_002650 Ga0495627_002650_5351_6916 521
241 3300046460 Ga0495638_0002984 Ga0495638_0002984_1985_3550 521
242 3300046460 Ga0495638_0042287 Ga0495638_0042287_248_1813 521
243 3300046512 Ga0495610_0004353 Ga0495610_0004353_1533_3098 521
244 3300046512 Ga0495610_0054043 Ga0495610_0054043_355_1920 521
245 3300046518 Ga0495631_0012989 Ga0495631_0012989_1145_2710 521
246 3300046522 Ga0495643_0005007 Ga0495643_0005007_1177_2742 521
247 3300046525 Ga0495663_0000667 Ga0495663_0000667_8260_9825 521
248 3300046525 Ga0495663_0002186 Ga0495663_0002186_3442_5010 521
249 3300046525 Ga0495663_0009512 Ga0495663_0009512_700_2265 521
250 3300046558 Ga0495633_0002737 Ga0495633_0002737_6100_7668 521
251 3300046558 Ga0495633_0008750 Ga0495633_0008750_1046_2611 521
252 3300046558 Ga0495633_0021283 Ga0495633_0021283_883_2451 521
253 3300046558 Ga0495633_0026251 Ga0495633_0026251_314_1879 521
254 3300046660 Ga0495625_0036621 Ga0495625_0036621_1284_2849 521
255 3300047320 Ga0495672_0000596 Ga0495672_0000596_27659_29224 521
256 3300047472 Ga0495686_0051118 Ga0495686_0051118_956_2521 521
257 3300048908 Ga0496105_0021887 Ga0496105_0021887_2345_3910 521
258 3300048916 Ga0496113_0101420 Ga0496113_0101420_150_1715 521
259 3300048919 Ga0496116_0000978 Ga0496116_0000978_23889_25454 521
260 3300048919 Ga0496116_0011500 Ga0496116_0011500_2223_3788 521
261 3300048920 Ga0496117_0000810 Ga0496117_0000810_32453_34018 521
262 3300048920 Ga0496117_0001291 Ga0496117_0001291_10579_12144 521
263 3300048920 Ga0496117_0003022 Ga0496117_0003022_3926_5491 521
264 3300048920 Ga0496117_0017844 Ga0496117_0017844_1153_2718 521
265 3300048921 Ga0496118_0000579 Ga0496118_0000579_30563_32128 521
266 3300048921 Ga0496118_0003511 Ga0496118_0003511_1007_2572 521
267 3300048921 Ga0496118_0005968 Ga0496118_0005968_7961_9526 521
268 3300048921 Ga0496118_0010286 Ga0496118_0010286_6561_8126 521
269 3300048921 Ga0496118_0071065 Ga0496118_0071065_736_2301 521
270 3300048922 Ga0496119_0001017 Ga0496119_0001017_28291_29856 521
271 3300048922 Ga0496119_0066635 Ga0496119_0066635_207_1772 521
272 3300048923 Ga0496120_0000511 Ga0496120_0000511_30249_31814 521
273 3300048924 Ga0496121_0003167 Ga0496121_0003167_21021_22586 521
274 3300048924 Ga0496121_0009571 Ga0496121_0009571_8599_10164 521
275 3300048924 Ga0496121_0044710 Ga0496121_0044710_1035_2600 521
276 3300048925 Ga0496122_0043293 Ga0496122_0043293_1202_2767 521
277 3300048925 Ga0496122_0050522 Ga0496122_0050522_613_2178 521
278 3300048925 Ga0496122_0050523 Ga0496122_0050523_993_2558 521
279 3300048926 Ga0496123_0002081 Ga0496123_0002081_1338_2903 521
280 3300048926 Ga0496123_0006472 Ga0496123_0006472_9414_10979 521
281 3300048926 Ga0496123_0061314 Ga0496123_0061314_42_1607 521
282 3300048927 Ga0496124_0001594 Ga0496124_0001594_24555_26120 521
283 3300048927 Ga0496124_0003368 Ga0496124_0003368_17133_18698 521
284 3300048927 Ga0496124_0005461 Ga0496124_0005461_8987_10552 521
285 3300048927 Ga0496124_0007341 Ga0496124_0007341_9709_11274 521
286 3300048927 Ga0496124_0008353 Ga0496124_0008353_1283_2848 521
287 3300048927 Ga0496124_0070030 Ga0496124_0070030_389_1954 521
288 3300048928 Ga0496125_0001775 Ga0496125_0001775_20071_21636 521
289 3300048928 Ga0496125_0002225 Ga0496125_0002225_14802_16367 521
290 3300048928 Ga0496125_0004974 Ga0496125_0004974_1330_2895 521
291 3300048928 Ga0496125_0013252 Ga0496125_0013252_3791_5356 521
292 3300048929 Ga0496126_0001534 Ga0496126_0001534_27638_29203 521
293 3300048929 Ga0496126_0037935 Ga0496126_0037935_412_1977 521
294 3300048929 Ga0496126_0079192 Ga0496126_0079192_1096_2661 521
295 3300049569 Ga0501032_0091694 Ga0501032_0091694_406_1998 521
296 3300049571 Ga0501034_0040668 Ga0501034_0040668_2435_4027 521
297 3300049572 Ga0501036_0117003 Ga0501036_0117003_488_2080 521
298 3300049573 Ga0501037_0006309 Ga0501037_0006309_504_2096 521
299 3300049574 Ga0501038_0022587 Ga0501038_0022587_1935_3527 521
300 3300049575 Ga0501039_0052905 Ga0501039_0052905_1304_2896 521
301 3300049579 Ga0501043_0099382 Ga0501043_0099382_446_2038 521
302 3300049581 Ga0501047_0160062 Ga0501047_0160062_72_1664 521
303 3300049589 Ga0501073_0049252 Ga0501073_0049252_168_1760 521
304 3300049742 Ga0501080_0093111 Ga0501080_0093111_752_2344 521
305 3300049822 Ga0501035_0006165 Ga0501035_0006165_4051_5643 521
306 3300049823 Ga0501044_0009464 Ga0501044_0009464_7707_9299 521
307 3300050491 nmdc:mga00v17_50924_c1 nmdc:mga00v17_50924_c1_157_1758 521
308 3300053161 Ga0500634_0000171 Ga0500634_0000171_11575_13143 521
309 3300061719 Ga0466962_0010854 Ga0466962_0010854_1806_3371 521
310 iso_pu_bacteria 2919513703 2919514900 521
311 iso_pu_bacteria 2919675420 2919677314 521

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02696

SelO

Protein adenylyltransferase SelO

21

477

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9255 5 506
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9236 5 506
6k20-assembly1.cif.gz_A structure of apo ydiu 0.9227 5 506
6k20-assembly1.cif.gz_A structure of apo ydiu 0.9208 5 506
6lna-assembly2.cif.gz_B ydiu complex with ampnpp and mn2+ 0.9167 5 506
ID Description Score Start End Superfamily
af_A8WFT6_1_122_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5342 107 198 3.30.200.20
af_Q2FW70_430_654_1.10.510.40 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.5217 239 376 1.10.510.40
af_Q54B07_491_726_1.10.510.40 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.4439 220 388 1.10.510.40
af_A0A1D6FR55_119_251_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4416 235 380 1.10.510.10
af_A0A1D6FR55_119_251_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4309 235 380 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A7X5SC73-F1-model_v4 Selenoprotein O 0.9585 118 227 GO:0005524
GO:0046872
GO:0070733
AF-A0A3S0DP80-F1-model_v4 Selenoprotein O 0.9488 3 283 GO:0005524
GO:0046872
GO:0070733
AF-A0A351RBP6-F1-model_v4 Selenoprotein O 0.9455 391 521 GO:0005524
GO:0046872
GO:0070733
AF-A0A3S0DP80-F1-model_v4 Selenoprotein O 0.9455 3 283 GO:0005524
GO:0046872
GO:0070733
AF-A0A4Q6G632-F1-model_v4 YdiU family protein 0.9448 58 521 GO:0005524
GO:0046872
GO:0070733

Feature Viewer

pLDDT pTM Quality
86.68 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map