F400836

General Info

Members Datasets Scaffolds Average Seq Length
310 217 620 281

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0046562|Ga0466961_0046562_848_1795
Length 315
Sequence VADARPDLAPAASGLAPAAARGHLLTSQCKTHVSQMTADLPVAPAAGHDELRFEFGRNWAAYLRTLSEPQIAEAEASLREMLDVDDLRGRRFLDAGSGSGLFSLAARRLGAEVHSFDYDPQSVACTRRLRERFFPDDRGWTVEQGSVLDEGYLESLGGFDVVYSWGVLHHTGDMWRGMELVSRRVAPGGQFFVAIYNDQGANSRRWAWIKRTYNRLPRGLRFLVLWPVLAQRWGLRTVRDVVYLRPGETWRNYRRNRGMSPWWDLVDWVGGYPFEVATPDAVFEFLKARGFRMERLCTCGGGLGCNQFVFSRPAA

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.32
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 0
Rhizoplane 0
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 19.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0046562 3300044693 Bacteria 2773
2 MBSR1b_contig_3656454 2162886012 Bacteria 2691
3 JGI25162J39368_1008787 3300002737 Bacteria 1413
4 JGI25164J39214_1007759 3300002772 Unclassified 1083
5 Ga0032354_1043019 3300003693 Unclassified 1930
6 Ga0055542_1000283 3300003762 Bacteria 56912
7 Ga0070683_100014413 3300005329 Bacteria 6914
8 Ga0068868_100038085 3300005338 Unclassified 3732
9 Ga0070660_100001855 3300005339 Bacteria 14542
10 Ga0070661_100006853 3300005344 Bacteria 7857
11 Ga0070671_100018953 3300005355 Bacteria 5595
12 Ga0070714_100000144 3300005435 Bacteria 57133
13 Ga0070713_100303314 3300005436 Bacteria 1471
14 Ga0070705_100032611 3300005440 Unclassified 2895
15 Ga0070694_100034133 3300005444 Bacteria 3353
16 Ga0070708_100001254 3300005445 Bacteria 19508
17 Ga0070681_10022661 3300005458 Bacteria 6309
18 Ga0070681_10591488 3300005458 Bacteria 1024
19 Ga0068867_100069787 3300005459 Unclassified 2625
20 Ga0068867_100234030 3300005459 Bacteria 1486
21 Ga0070707_100205555 3300005468 Bacteria 1919
22 Ga0070707_100231114 3300005468 Unclassified 1800
23 Ga0070698_100025135 3300005471 Bacteria 6208
24 Ga0070699_100000562 3300005518 Bacteria 35043
25 Ga0070679_100121756 3300005530 Unclassified 2593
26 Ga0070684_100000674 3300005535 Bacteria 23584
27 Ga0070697_100243346 3300005536 Bacteria 1537
28 Ga0068853_100421703 3300005539 Bacteria 1251
29 Ga0070696_100104559 3300005546 Bacteria 2033
30 Ga0070665_100001241 3300005548 Bacteria 30925
31 Ga0068855_100007703 3300005563 Bacteria 13004
32 Ga0068855_100107390 3300005563 Unclassified 3207
33 Ga0068855_100659132 3300005563 Unclassified 1123
34 Ga0070664_100071974 3300005564 Bacteria 2964
35 Ga0070664_100348637 3300005564 Bacteria 1346
36 Ga0068857_100021674 3300005577 Bacteria 5654
37 Ga0068857_100353141 3300005577 Bacteria 1362
38 Ga0068854_100234546 3300005578 Bacteria 1458
39 Ga0068856_100232103 3300005614 Unclassified 1860
40 Ga0070702_100218672 3300005615 Bacteria 1272
41 Ga0068859_100271727 3300005617 Unclassified 1787
42 Ga0068859_100357552 3300005617 Unclassified 1555
43 Ga0068864_100020463 3300005618 Bacteria 5536
44 Ga0068864_100066749 3300005618 Bacteria 3123
45 Ga0068864_100073908 3300005618 Bacteria 2973
46 Ga0068864_100318527 3300005618 Unclassified 1460
47 Ga0068861_100455605 3300005719 Bacteria 1147
48 Ga0068863_100015287 3300005841 Bacteria 7376
49 Ga0068863_100131152 3300005841 Bacteria 2393
50 Ga0068858_100088266 3300005842 Bacteria 2885
51 Ga0068860_100179575 3300005843 Bacteria 2046
52 Ga0068862_100017449 3300005844 Bacteria 5978
53 Ga0070717_10028956 3300006028 Bacteria 4438
54 Ga0075368_10004979 3300006042 Bacteria 4539
55 Ga0075432_10051348 3300006058 Bacteria 1455
56 Ga0075367_10001643 3300006178 Bacteria 9731
57 Ga0097621_100094732 3300006237 Unclassified 2503
58 Ga0068871_100003337 3300006358 Bacteria 11021
59 Ga0075428_100000767 3300006844 Bacteria 33407
60 Ga0075428_100022543 3300006844 Bacteria 6971
61 Ga0075428_100107597 3300006844 Bacteria 3039
62 Ga0075428_100175771 3300006844 Unclassified 2319
63 Ga0075430_100004805 3300006846 Bacteria 11368
64 Ga0075430_100124191 3300006846 Bacteria 2152
65 Ga0075431_100005668 3300006847 Bacteria 12344
66 Ga0075431_100010718 3300006847 Bacteria 9211
67 Ga0075433_10079802 3300006852 Bacteria 2884
68 Ga0075434_100320967 3300006871 Unclassified 1569
69 Ga0075429_100001079 3300006880 Bacteria 21882
70 Ga0075429_100031006 3300006880 Bacteria 4647
71 Ga0068865_100015503 3300006881 Bacteria 4862
72 Ga0068865_100030573 3300006881 Unclassified 3583
73 Ga0097620_100271732 3300006931 Unclassified 1787
74 Ga0097620_100357550 3300006931 Unclassified 1555
75 Ga0105240_10057642 3300009093 Unclassified 4851
76 Ga0105240_10270978 3300009093 Bacteria 1954
77 Ga0111539_10000251 3300009094 Bacteria 64371
78 Ga0105245_10003495 3300009098 Bacteria 14062
79 Ga0114129_10001823 3300009147 Bacteria 29008
80 Ga0114129_10028644 3300009147 Bacteria 7891
81 Ga0114129_10129983 3300009147 Bacteria 3460
82 Ga0114129_10180755 3300009147 Bacteria 2870
83 Ga0114129_10284687 3300009147 Bacteria 2208
84 Ga0114129_10353836 3300009147 Bacteria 1945
85 Ga0105243_10323685 3300009148 Bacteria 1406
86 Ga0105241_10044493 3300009174 Unclassified 3365
87 Ga0105242_10000408 3300009176 Bacteria 34230
88 Ga0105242_10003709 3300009176 Bacteria 11879
89 Ga0105242_10026185 3300009176 Bacteria 4622
90 Ga0105248_10022897 3300009177 Bacteria 6937
91 Ga0105248_10094332 3300009177 Bacteria 3370
92 Ga0105248_10373279 3300009177 Unclassified 1606
93 Ga0105248_10625334 3300009177 Unclassified 1215
94 Ga0105237_10082349 3300009545 Unclassified 3209
95 Ga0105238_10002066 3300009551 Bacteria 20267
96 Ga0105238_10521776 3300009551 Bacteria 1190
97 Ga0105249_10004675 3300009553 Bacteria 11822
98 Ga0105249_10026599 3300009553 Bacteria 5216
99 Ga0105239_10007114 3300010375 Bacteria 12875
100 Ga0105239_10007133 3300010375 Bacteria 12855
101 Ga0105246_10002474 3300011119 Bacteria 11155
102 Ga0157371_10025799 3300013102 Bacteria 4278
103 Ga0157370_10001957 3300013104 Bacteria 25376
104 Ga0157369_10000233 3300013105 Bacteria 76995
105 Ga0157369_10607848 3300013105 Bacteria 1128
106 Ga0157374_10003888 3300013296 Bacteria 12540
107 Ga0157378_10002405 3300013297 Bacteria 16637
108 Ga0163162_10311998 3300013306 Unclassified 1705
109 Ga0163162_10343390 3300013306 Unclassified 1625
110 Ga0163162_10348860 3300013306 Unclassified 1613
111 Ga0157372_10088382 3300013307 Bacteria 3518
112 Ga0157372_10136137 3300013307 Bacteria 2828
113 Ga0157372_10522877 3300013307 Bacteria 1383
114 Ga0163163_10159693 3300014325 Unclassified 2299
115 Ga0163163_10162196 3300014325 Unclassified 2281
116 Ga0157379_10228905 3300014968 Bacteria 1685
117 Ga0157379_10248668 3300014968 Bacteria 1614
118 Ga0157376_10139663 3300014969 Unclassified 2172
119 Ga0213876_10009067 3300021384 Bacteria 5357
120 Ga0213876_10141119 3300021384 Unclassified 1281
121 Ga0213875_10003960 3300021388 Bacteria 8267
122 Ga0213875_10059166 3300021388 Unclassified 1793
123 Ga0207427_101412 3300025231 Bacteria 8775
124 Ga0209437_100385 3300025233 Bacteria 43317
125 Ga0209148_1000055 3300025254 Bacteria 367500
126 Ga0209233_1019548 3300025261 Bacteria 1799
127 Ga0209758_1011803 3300025297 Bacteria 4994
128 Ga0207684_10005939 3300025910 Bacteria 11175
129 Ga0207707_10116386 3300025912 Bacteria 2336
130 Ga0207707_10219277 3300025912 Unclassified 1656
131 Ga0207695_10004590 3300025913 Bacteria 18760
132 Ga0207695_10082485 3300025913 Bacteria 3250
133 Ga0207695_10131349 3300025913 Unclassified 2462
134 Ga0207671_10022057 3300025914 Unclassified 4821
135 Ga0207657_10035336 3300025919 Bacteria 4482
136 Ga0207649_10003089 3300025920 Bacteria 9139
137 Ga0207646_10134694 3300025922 Bacteria 2224
138 Ga0207694_10001933 3300025924 Bacteria 17156
139 Ga0207687_10386515 3300025927 Unclassified 1148
140 Ga0207700_10265613 3300025928 Bacteria 1471
141 Ga0207664_10000651 3300025929 Bacteria 24029
142 Ga0207644_10007169 3300025931 Bacteria 7262
143 Ga0207706_10328254 3300025933 Bacteria 1331
144 Ga0207706_10363383 3300025933 Unclassified 1257
145 Ga0207686_10009560 3300025934 Bacteria 5259
146 Ga0207686_10023265 3300025934 Bacteria 3576
147 Ga0207686_10101760 3300025934 Bacteria 1920
148 Ga0207686_10281365 3300025934 Unclassified 1228
149 Ga0207704_10041751 3300025938 Unclassified 2693
150 Ga0207711_10107001 3300025941 Bacteria 2482
151 Ga0207711_10452504 3300025941 Unclassified 1195
152 Ga0207711_10501226 3300025941 Unclassified 1132
153 Ga0207661_10010114 3300025944 Bacteria 6779
154 Ga0207679_10318145 3300025945 Bacteria 1347
155 Ga0207679_10699242 3300025945 Unclassified 920
156 Ga0207651_10012025 3300025960 Bacteria 4875
157 Ga0207677_10034415 3300026023 Unclassified 3280
158 Ga0207678_10084505 3300026067 Bacteria 2714
159 Ga0207702_10295928 3300026078 Bacteria 1535
160 Ga0207641_10009557 3300026088 Bacteria 7988
161 Ga0207641_10134295 3300026088 Unclassified 2226
162 Ga0207648_10102415 3300026089 Unclassified 2510
163 Ga0207648_10409632 3300026089 Unclassified 1229
164 Ga0207676_10053120 3300026095 Bacteria 3170
165 Ga0207676_10103817 3300026095 Bacteria 2363
166 Ga0207674_10020572 3300026116 Bacteria 7125
167 Ga0207674_10109565 3300026116 Bacteria 2737
168 Ga0207674_10186027 3300026116 Bacteria 2028
169 Ga0207675_100027660 3300026118 Bacteria 5281
170 Ga0207675_100399381 3300026118 Bacteria 1354
171 Ga0207428_10001490 3300027907 Bacteria 24463
172 Ga0207428_10374772 3300027907 Bacteria 1045
173 Ga0268266_10000004 3300028379 Bacteria 1495817
174 Ga0268265_10076851 3300028380 Bacteria 2621
175 Ga0268264_10064097 3300028381 Bacteria 3092
176 Ga0307517_10197819 3300028786 Unclassified 1262
177 Ga0307515_10002324 3300028794 Bacteria 41515
178 Ga0265338_10005992 3300028800 Bacteria 15637
179 Ga0307512_10004752 3300030522 Bacteria 14636
180 Ga0265325_10001764 3300031241 Bacteria 14988
181 Ga0265329_10003046 3300031242 Bacteria 7433
182 Ga0265339_10000781 3300031249 Bacteria 24630
183 Ga0265331_10000014 3300031250 Bacteria 294002
184 Ga0265327_10009817 3300031251 Bacteria 6840
185 Ga0307513_10003185 3300031456 Bacteria 22407
186 Ga0307509_10408687 3300031507 Bacteria 1062
187 Ga0307408_100025062 3300031548 Bacteria 4081
188 Ga0307408_100054621 3300031548 Bacteria 2888
189 Ga0265313_10000047 3300031595 Bacteria 113587
190 Ga0307508_10060486 3300031616 Bacteria 3349
191 Ga0265314_10000100 3300031711 Bacteria 131357
192 Ga0265342_10011281 3300031712 Bacteria 6126
193 Ga0307405_10283465 3300031731 Bacteria 1248
194 Ga0307413_10059457 3300031824 Bacteria 2348
195 Ga0307518_10014719 3300031838 Bacteria 5594
196 Ga0307406_10025153 3300031901 Bacteria 3562
197 Ga0307406_10089818 3300031901 Unclassified 2065
198 Ga0307412_10073224 3300031911 Bacteria 2343
199 Ga0307409_100049647 3300031995 Bacteria 3200
200 Ga0307409_100212401 3300031995 Bacteria 1740
201 Ga0307416_100004262 3300032002 Bacteria 8589
202 Ga0307411_10024621 3300032005 Bacteria 3591
203 Ga0307411_10166087 3300032005 Bacteria 1659
204 Ga0373926_0060177 3300035083 Bacteria 1383
205 Ga0373927_0001446 3300035695 Bacteria 17921
206 Ga0373933_0261835 3300035724 Bacteria 1115
207 Ga0373947_0004380 3300035725 Bacteria 8280
208 Ga0373925_0000166 3300037068 Bacteria 71445
209 Ga0373925_0135658 3300037068 Bacteria 1923
210 Ga0395899_0019303 3300037312 Bacteria 5180
211 Ga0395900_0056969 3300037418 Bacteria 4023
212 Ga0395898_0001362 3300037466 Bacteria 35179
213 Ga0395898_0002144 3300037466 Bacteria 24310
214 Ga0395898_0002964 3300037466 Bacteria 19294
215 Ga0395898_0338749 3300037466 Bacteria 1434
216 Ga0395905_0033763 3300037471 Bacteria 4805
217 Ga0395905_0092720 3300037471 Bacteria 2833
218 Ga0436364_0210812 3300037853 Bacteria 37062
219 Ga0436364_0395999 3300037853 Bacteria 7321
220 Ga0436364_1302161 3300037853 Unclassified 1380
221 Ga0395901_0000441 3300038443 Bacteria 48497
222 Ga0395901_0001082 3300038443 Bacteria 29097
223 Ga0395901_0001906 3300038443 Bacteria 21514
224 Ga0395901_0006773 3300038443 Bacteria 11575
225 Ga0395901_0079167 3300038443 Bacteria 3431
226 Ga0395901_0388219 3300038443 Bacteria 1436
227 Ga0395901_0491138 3300038443 Bacteria 1251
228 Ga0436365_1692388 3300039437 Bacteria 5693
229 Ga0436365_1798940 3300039437 Bacteria 5421
230 Ga0436363_1188361 3300039450 Bacteria 1045
231 Ga0436362_1107468 3300039453 Bacteria 1600
232 Ga0439464_0007735 3300042439 Unclassified 2812
233 Ga0439460_0010249 3300042461 Unclassified 2395
234 Ga0466969_0010704 3300044656 Bacteria 4859
235 Ga0466969_0112976 3300044656 Bacteria 1270
236 Ga0466966_0074329 3300044684 Bacteria 2124
237 Ga0466966_0361873 3300044684 Bacteria 871
238 Ga0466961_0018904 3300044693 Bacteria 4433
239 Ga0466963_0092148 3300044694 Bacteria 2065
240 Ga0453684_0111241 3300044712 Bacteria 3327
241 Ga0466971_0006678 3300044719 Bacteria 5020
242 Ga0466971_0050187 3300044719 Bacteria 1877
243 Ga0466970_0047643 3300044765 Bacteria 2285
244 Ga0466957_0131315 3300044842 Bacteria 1605
245 Ga0466958_0123841 3300045836 Bacteria 1620
246 Ga0466967_0265529 3300045976 Bacteria 1643
247 Ga0495629_0000006 3300046459 Bacteria 389181
248 Ga0495580_0302841 3300046472 Unclassified 1088
249 Ga0495582_0043288 3300046473 Bacteria 2480
250 Ga0495639_0003213 3300046475 Bacteria 7106
251 Ga0495662_0113324 3300046476 Bacteria 1329
252 Ga0495594_0010352 3300046499 Bacteria 4836
253 Ga0495632_0101637 3300046519 Unclassified 1355
254 Ga0495640_0059544 3300046533 Bacteria 2601
255 Ga0495586_0007937 3300046535 Bacteria 5660
256 Ga0495634_0032762 3300046642 Bacteria 3572
257 Ga0495635_0000352 3300046663 Bacteria 29243
258 Ga0495647_0001522 3300046681 Bacteria 7160
259 Ga0495658_0000012 3300046683 Bacteria 103335
260 Ga0495613_0001718 3300046689 Bacteria 16671
261 Ga0495600_0082276 3300046809 Bacteria 2101
262 Ga0495581_0000034 3300047315 Bacteria 50614
263 Ga0495680_0000681 3300047322 Bacteria 37994
264 Ga0495614_0001825 3300048089 Bacteria 9327
265 Ga0496121_0123033 3300048924 Unclassified 1956
266 Ga0496126_0210627 3300048929 Bacteria 1637
267 Ga0501292_016652 3300049515 Unclassified 1158
268 Ga0501034_0011128 3300049571 Bacteria 9338
269 Ga0501036_0001479 3300049572 Bacteria 18088
270 Ga0501038_0001841 3300049574 Bacteria 19618
271 Ga0501041_0084793 3300049577 Bacteria 1953
272 Ga0501042_0011480 3300049578 Bacteria 5980
273 Ga0501043_0002309 3300049579 Bacteria 16149
274 Ga0501047_0006892 3300049581 Bacteria 10677
275 Ga0501048_0004564 3300049582 Bacteria 10540
276 Ga0501069_0092474 3300049585 Bacteria 1711
277 Ga0501071_0195194 3300049587 Unclassified 1519
278 Ga0501074_0010605 3300049590 Bacteria 6688
279 Ga0501075_0251276 3300049591 Bacteria 1348
280 Ga0501076_0214759 3300049592 Unclassified 1572
281 Ga0501233_008214 3300049668 Unclassified 2007
282 Ga0501080_0369705 3300049742 Bacteria 1293
283 Ga0501283_022110 3300049779 Unclassified 1024
284 Ga0501044_0050156 3300049823 Bacteria 4308
285 nmdc:mga04h51_22463_c1 3300050495 Bacteria 1909
286 nmdc:mga05p37_153274_c1 3300050507 Bacteria 2817
287 nmdc:mga05p37_20577_c1 3300050507 Bacteria 7983
288 nmdc:mga05p37_263353_c1 3300050507 Bacteria 2062
289 nmdc:mga05p37_4232_c1 3300050507 Bacteria 16763
290 nmdc:mga05p37_526558_c1 3300050507 Bacteria 1351
291 nmdc:mga05p37_8915_c1 3300050507 Bacteria 11855
292 nmdc:mga09592_118393_c1 3300050508 Bacteria 2273
293 nmdc:mga09592_28023_c1 3300050508 Bacteria 4677
294 nmdc:mga09592_30465_c1 3300050508 Bacteria 4489
295 nmdc:mga09592_39016_c1 3300050508 Bacteria 3988
296 nmdc:mga0qj67_39262_c1 3300050509 Bacteria 3717
297 nmdc:mga0qj67_40977_c2 3300050509 Bacteria 2220
298 nmdc:mga06r32_15721_c1 3300050510 Bacteria 6876
299 nmdc:mga06r32_6018_c1 3300050510 Bacteria 10915
300 nmdc:mga08y16_12622_c1 3300050511 Bacteria 8888
301 nmdc:mga0n895_498658_c1 3300050512 Unclassified 1227
302 Ga0495619_0001367 3300053085 Bacteria 16044
303 Ga0500644_0021808 3300053088 Bacteria 1924
304 Ga0500569_062913 3300053109 Unclassified 1150
305 Ga0500652_045334 3300053131 Bacteria 1782
306 Ga0500616_0029290 3300053153 Bacteria 3031
307 Ga0501084_0227527 3300054114 Bacteria 1574
308 Ga0466962_0004571 3300061719 Bacteria 6642
309 Ga0466962_0005259 3300061719 Bacteria 6217
310 2811843163 2808606982 Bacteria 7791042
311 Ga0466961_0046562
312 MBSR1b_contig_3656454
313 JGI25162J39368_1008787
314 JGI25164J39214_1007759
315 Ga0032354_1043019
316 Ga0055542_1000283
317 Ga0070683_100014413
318 Ga0068868_100038085
319 Ga0070660_100001855
320 Ga0070661_100006853
321 Ga0070671_100018953
322 Ga0070714_100000144
323 Ga0070713_100303314
324 Ga0070705_100032611
325 Ga0070694_100034133
326 Ga0070708_100001254
327 Ga0070681_10022661
328 Ga0070681_10591488
329 Ga0068867_100069787
330 Ga0068867_100234030
331 Ga0070707_100205555
332 Ga0070707_100231114
333 Ga0070698_100025135
334 Ga0070699_100000562
335 Ga0070679_100121756
336 Ga0070684_100000674
337 Ga0070697_100243346
338 Ga0068853_100421703
339 Ga0070696_100104559
340 Ga0070665_100001241
341 Ga0068855_100007703
342 Ga0068855_100107390
343 Ga0068855_100659132
344 Ga0070664_100071974
345 Ga0070664_100348637
346 Ga0068857_100021674
347 Ga0068857_100353141
348 Ga0068854_100234546
349 Ga0068856_100232103
350 Ga0070702_100218672
351 Ga0068859_100271727
352 Ga0068859_100357552
353 Ga0068864_100020463
354 Ga0068864_100066749
355 Ga0068864_100073908
356 Ga0068864_100318527
357 Ga0068861_100455605
358 Ga0068863_100015287
359 Ga0068863_100131152
360 Ga0068858_100088266
361 Ga0068860_100179575
362 Ga0068862_100017449
363 Ga0070717_10028956
364 Ga0075368_10004979
365 Ga0075432_10051348
366 Ga0075367_10001643
367 Ga0097621_100094732
368 Ga0068871_100003337
369 Ga0075428_100000767
370 Ga0075428_100022543
371 Ga0075428_100107597
372 Ga0075428_100175771
373 Ga0075430_100004805
374 Ga0075430_100124191
375 Ga0075431_100005668
376 Ga0075431_100010718
377 Ga0075433_10079802
378 Ga0075434_100320967
379 Ga0075429_100001079
380 Ga0075429_100031006
381 Ga0068865_100015503
382 Ga0068865_100030573
383 Ga0097620_100271732
384 Ga0097620_100357550
385 Ga0105240_10057642
386 Ga0105240_10270978
387 Ga0111539_10000251
388 Ga0105245_10003495
389 Ga0114129_10001823
390 Ga0114129_10028644
391 Ga0114129_10129983
392 Ga0114129_10180755
393 Ga0114129_10284687
394 Ga0114129_10353836
395 Ga0105243_10323685
396 Ga0105241_10044493
397 Ga0105242_10000408
398 Ga0105242_10003709
399 Ga0105242_10026185
400 Ga0105248_10022897
401 Ga0105248_10094332
402 Ga0105248_10373279
403 Ga0105248_10625334
404 Ga0105237_10082349
405 Ga0105238_10002066
406 Ga0105238_10521776
407 Ga0105249_10004675
408 Ga0105249_10026599
409 Ga0105239_10007114
410 Ga0105239_10007133
411 Ga0105246_10002474
412 Ga0157371_10025799
413 Ga0157370_10001957
414 Ga0157369_10000233
415 Ga0157369_10607848
416 Ga0157374_10003888
417 Ga0157378_10002405
418 Ga0163162_10311998
419 Ga0163162_10343390
420 Ga0163162_10348860
421 Ga0157372_10088382
422 Ga0157372_10136137
423 Ga0157372_10522877
424 Ga0163163_10159693
425 Ga0163163_10162196
426 Ga0157379_10228905
427 Ga0157379_10248668
428 Ga0157376_10139663
429 Ga0213876_10009067
430 Ga0213876_10141119
431 Ga0213875_10003960
432 Ga0213875_10059166
433 Ga0207427_101412
434 Ga0209437_100385
435 Ga0209148_1000055
436 Ga0209233_1019548
437 Ga0209758_1011803
438 Ga0207684_10005939
439 Ga0207707_10116386
440 Ga0207707_10219277
441 Ga0207695_10004590
442 Ga0207695_10082485
443 Ga0207695_10131349
444 Ga0207671_10022057
445 Ga0207657_10035336
446 Ga0207649_10003089
447 Ga0207646_10134694
448 Ga0207694_10001933
449 Ga0207687_10386515
450 Ga0207700_10265613
451 Ga0207664_10000651
452 Ga0207644_10007169
453 Ga0207706_10328254
454 Ga0207706_10363383
455 Ga0207686_10009560
456 Ga0207686_10023265
457 Ga0207686_10101760
458 Ga0207686_10281365
459 Ga0207704_10041751
460 Ga0207711_10107001
461 Ga0207711_10452504
462 Ga0207711_10501226
463 Ga0207661_10010114
464 Ga0207679_10318145
465 Ga0207679_10699242
466 Ga0207651_10012025
467 Ga0207677_10034415
468 Ga0207678_10084505
469 Ga0207702_10295928
470 Ga0207641_10009557
471 Ga0207641_10134295
472 Ga0207648_10102415
473 Ga0207648_10409632
474 Ga0207676_10053120
475 Ga0207676_10103817
476 Ga0207674_10020572
477 Ga0207674_10109565
478 Ga0207674_10186027
479 Ga0207675_100027660
480 Ga0207675_100399381
481 Ga0207428_10001490
482 Ga0207428_10374772
483 Ga0268266_10000004
484 Ga0268265_10076851
485 Ga0268264_10064097
486 Ga0307517_10197819
487 Ga0307515_10002324
488 Ga0265338_10005992
489 Ga0307512_10004752
490 Ga0265325_10001764
491 Ga0265329_10003046
492 Ga0265339_10000781
493 Ga0265331_10000014
494 Ga0265327_10009817
495 Ga0307513_10003185
496 Ga0307509_10408687
497 Ga0307408_100025062
498 Ga0307408_100054621
499 Ga0265313_10000047
500 Ga0307508_10060486
501 Ga0265314_10000100
502 Ga0265342_10011281
503 Ga0307405_10283465
504 Ga0307413_10059457
505 Ga0307518_10014719
506 Ga0307406_10025153
507 Ga0307406_10089818
508 Ga0307412_10073224
509 Ga0307409_100049647
510 Ga0307409_100212401
511 Ga0307416_100004262
512 Ga0307411_10024621
513 Ga0307411_10166087
514 Ga0373926_0060177
515 Ga0373927_0001446
516 Ga0373933_0261835
517 Ga0373947_0004380
518 Ga0373925_0000166
519 Ga0373925_0135658
520 Ga0395899_0019303
521 Ga0395900_0056969
522 Ga0395898_0001362
523 Ga0395898_0002144
524 Ga0395898_0002964
525 Ga0395898_0338749
526 Ga0395905_0033763
527 Ga0395905_0092720
528 Ga0436364_0210812
529 Ga0436364_0395999
530 Ga0436364_1302161
531 Ga0395901_0000441
532 Ga0395901_0001082
533 Ga0395901_0001906
534 Ga0395901_0006773
535 Ga0395901_0079167
536 Ga0395901_0388219
537 Ga0395901_0491138
538 Ga0436365_1692388
539 Ga0436365_1798940
540 Ga0436363_1188361
541 Ga0436362_1107468
542 Ga0439464_0007735
543 Ga0439460_0010249
544 Ga0466969_0010704
545 Ga0466969_0112976
546 Ga0466966_0074329
547 Ga0466966_0361873
548 Ga0466961_0018904
549 Ga0466963_0092148
550 Ga0453684_0111241
551 Ga0466971_0006678
552 Ga0466971_0050187
553 Ga0466970_0047643
554 Ga0466957_0131315
555 Ga0466958_0123841
556 Ga0466967_0265529
557 Ga0495629_0000006
558 Ga0495580_0302841
559 Ga0495582_0043288
560 Ga0495639_0003213
561 Ga0495662_0113324
562 Ga0495594_0010352
563 Ga0495632_0101637
564 Ga0495640_0059544
565 Ga0495586_0007937
566 Ga0495634_0032762
567 Ga0495635_0000352
568 Ga0495647_0001522
569 Ga0495658_0000012
570 Ga0495613_0001718
571 Ga0495600_0082276
572 Ga0495581_0000034
573 Ga0495680_0000681
574 Ga0495614_0001825
575 Ga0496121_0123033
576 Ga0496126_0210627
577 Ga0501292_016652
578 Ga0501034_0011128
579 Ga0501036_0001479
580 Ga0501038_0001841
581 Ga0501041_0084793
582 Ga0501042_0011480
583 Ga0501043_0002309
584 Ga0501047_0006892
585 Ga0501048_0004564
586 Ga0501069_0092474
587 Ga0501071_0195194
588 Ga0501074_0010605
589 Ga0501075_0251276
590 Ga0501076_0214759
591 Ga0501233_008214
592 Ga0501080_0369705
593 Ga0501283_022110
594 Ga0501044_0050156
595 nmdc:mga04h51_22463_c1
596 nmdc:mga05p37_153274_c1
597 nmdc:mga05p37_20577_c1
598 nmdc:mga05p37_263353_c1
599 nmdc:mga05p37_4232_c1
600 nmdc:mga05p37_526558_c1
601 nmdc:mga05p37_8915_c1
602 nmdc:mga09592_118393_c1
603 nmdc:mga09592_28023_c1
604 nmdc:mga09592_30465_c1
605 nmdc:mga09592_39016_c1
606 nmdc:mga0qj67_39262_c1
607 nmdc:mga0qj67_40977_c2
608 nmdc:mga06r32_15721_c1
609 nmdc:mga06r32_6018_c1
610 nmdc:mga08y16_12622_c1
611 nmdc:mga0n895_498658_c1
612 Ga0495619_0001367
613 Ga0500644_0021808
614 Ga0500569_062913
615 Ga0500652_045334
616 Ga0500616_0029290
617 Ga0501084_0227527
618 Ga0466962_0004571
619 Ga0466962_0005259
620 2811843163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13847

Methyltransf_31

Methyltransferase domain

86

222

0.9

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

75

134

0.89

PF08241

Methyltransf_11

Methyltransferase domain

93

193

0.88

PF13649

Methyltransf_25

Methyltransferase domain

92

189

0.86

PF08242

Methyltransf_12

Methyltransferase domain

93

191

0.8

PF13489

Methyltransf_23

Methyltransferase domain

59

262

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8393 37 273
5jdz-assembly1.cif.gz_B crystal structure of burkholderia glumae toxa with bound s-adenosylhomocysteine (sah) 0.8308 36 160
4qnx-assembly1.cif.gz_A crystal structure of apo-cmob 0.8281 37 161
2fpo-assembly6.cif.gz_F putative methyltransferase yhhf from escherichia coli. 0.828 37 274
4qnu-assembly8.cif.gz_H crystal structure of cmob bound with cx-sam in p21212 0.8258 42 161
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.901 52 117 3.40.50.150
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.875 48 106 3.40.50.150
af_A0A0R0IWS7_1_176_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8585 48 123 3.40.50.150
af_Q8IHP7_693_845_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.855 48 109 3.40.50.150
af_P9WJZ1_37_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8485 48 154 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6P0QZ89-F1-model_v4 deleted 0.9651 1 89
AF-A0A177RBB4-F1-model_v4 deleted 0.9411 13 273
AF-A0A2N2NG91-F1-model_v4 Class I SAM-dependent methyltransferase 0.9395 11 274 GO:0008757
GO:0016020
GO:0032259
AF-A0A0G0R5F6-F1-model_v4 Methyltransferase type 12 0.939 5 274 GO:0008168
GO:0032259
AF-A0A318DW12-F1-model_v4 2-polyprenyl-6-hydroxyphenyl methylase/3-demethylubiquinone-9 3-methyltransferase 0.9332 13 274 GO:0008168
GO:0032259

Map