F400637

General Info

Members Datasets Scaffolds Average Seq Length
310 181 620 108

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100354491|Ga0068863_1003544914
Length 117
Sequence MKLAIVSGAVALLGVASAAQAQVTQPAMAAPTSFDRAAYVTCREAHIMPPESRKQLAVFLANHAASYHGVVIPDDDRGAQLAHLVRGGCTLAPDAYLFTVIDRAIIAEIAKLPKRAQ

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
180 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.13
Nodule 0
Rhizoplane 0.32
Rhizosphere 73.23
Stem 0
Stem Tuber 0
Unclassified 9.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100354491 3300005841 Bacteria 1429
2 JGI25406J46586_10263654 3300003203 Bacteria 508
3 Ga0058862_12171428 3300004803 Bacteria 649
4 Ga0070676_11113748 3300005328 Bacteria 597
5 Ga0070683_100436909 3300005329 Bacteria 1249
6 Ga0070690_101178859 3300005330 Bacteria 610
7 Ga0070670_101782149 3300005331 Bacteria 567
8 Ga0070666_10675771 3300005335 Unclassified 756
9 Ga0070680_101611426 3300005336 Bacteria 562
10 Ga0070660_100578819 3300005339 Bacteria 938
11 Ga0070689_100312327 3300005340 Bacteria 1311
12 Ga0070689_100518115 3300005340 Bacteria 1023
13 Ga0070687_100758904 3300005343 Bacteria 683
14 Ga0070668_100551055 3300005347 Bacteria 1004
15 Ga0070669_100486403 3300005353 Bacteria 1022
16 Ga0070675_100955941 3300005354 Bacteria 786
17 Ga0070674_100521525 3300005356 Bacteria 993
18 Ga0070673_100502142 3300005364 Bacteria 1097
19 Ga0070688_100196104 3300005365 Bacteria 1410
20 Ga0070713_100060219 3300005436 Bacteria 3173
21 Ga0070710_10128348 3300005437 Bacteria 1543
22 Ga0070708_100050374 3300005445 Bacteria 3687
23 Ga0070678_100070703 3300005456 Bacteria 2610
24 Ga0070678_100427291 3300005456 Unclassified 1156
25 Ga0070662_100384308 3300005457 Bacteria 1156
26 Ga0070681_10675989 3300005458 Bacteria 948
27 Ga0070681_12029346 3300005458 Bacteria 503
28 Ga0070698_100383223 3300005471 Bacteria 1339
29 Ga0070679_100919704 3300005530 Bacteria 818
30 Ga0070684_100029592 3300005535 Bacteria 4643
31 Ga0070697_100065884 3300005536 Bacteria 2961
32 Ga0068853_100983049 3300005539 Unclassified 812
33 Ga0070672_100213278 3300005543 Bacteria 1617
34 Ga0070672_100566947 3300005543 Bacteria 987
35 Ga0070686_100532225 3300005544 Bacteria 917
36 Ga0070695_100966977 3300005545 Bacteria 691
37 Ga0070665_100006866 3300005548 Bacteria 11572
38 Ga0070665_100014957 3300005548 Bacteria 7789
39 Ga0070665_100022376 3300005548 Bacteria 6361
40 Ga0070665_100053706 3300005548 Bacteria 4040
41 Ga0070665_100372082 3300005548 Bacteria 1436
42 Ga0070665_100433944 3300005548 Bacteria 1323
43 Ga0068855_100099492 3300005563 Bacteria 3349
44 Ga0068855_101657536 3300005563 Bacteria 653
45 Ga0068855_102561941 3300005563 Unclassified 506
46 Ga0070664_100034668 3300005564 Bacteria 4234
47 Ga0068857_100038919 3300005577 Bacteria 4210
48 Ga0068857_100057803 3300005577 Bacteria 3443
49 Ga0068856_100060817 3300005614 Unclassified 3731
50 Ga0068856_100326756 3300005614 Bacteria 1551
51 Ga0068852_100016808 3300005616 Bacteria 5720
52 Ga0068859_101103244 3300005617 Bacteria 873
53 Ga0068859_102292385 3300005617 Unclassified 595
54 Ga0068863_100580956 3300005841 Bacteria 1108
55 Ga0068863_101478544 3300005841 Bacteria 688
56 Ga0068860_100141950 3300005843 Bacteria 2309
57 Ga0068862_101747718 3300005844 Bacteria 631
58 Ga0068862_101884707 3300005844 Bacteria 608
59 Ga0081455_10001485 3300005937 Bacteria 29029
60 Ga0081455_10005066 3300005937 Bacteria 14545
61 Ga0081455_10007462 3300005937 Bacteria 11516
62 Ga0081455_10015269 3300005937 Bacteria 7469
63 Ga0081455_10020763 3300005937 Bacteria 6174
64 Ga0081455_10090967 3300005937 Bacteria 2472
65 Ga0081538_10027063 3300005981 Bacteria 3986
66 Ga0081538_10151459 3300005981 Unclassified 1049
67 Ga0081539_10001996 3300005985 Bacteria 30979
68 Ga0075365_10103382 3300006038 Bacteria 1952
69 Ga0075365_10356981 3300006038 Bacteria 1030
70 Ga0075365_10368978 3300006038 Bacteria 1012
71 Ga0075365_10381859 3300006038 Bacteria 994
72 Ga0075365_10833150 3300006038 Bacteria 651
73 Ga0075368_10041846 3300006042 Unclassified 1801
74 Ga0075363_100069094 3300006048 Bacteria 1916
75 Ga0075363_100173794 3300006048 Bacteria 1224
76 Ga0075363_100419643 3300006048 Bacteria 788
77 Ga0075364_10049260 3300006051 Bacteria 2747
78 Ga0075364_10342214 3300006051 Bacteria 1019
79 Ga0075364_10588074 3300006051 Bacteria 761
80 Ga0075364_10734187 3300006051 Bacteria 674
81 Ga0075432_10039141 3300006058 Bacteria 1653
82 Ga0070715_10300874 3300006163 Bacteria 858
83 Ga0070716_101140879 3300006173 Bacteria 623
84 Ga0070712_100026802 3300006175 Bacteria 3844
85 Ga0075362_10003094 3300006177 Bacteria 5736
86 Ga0075362_10003444 3300006177 Bacteria 5528
87 Ga0075362_10066942 3300006177 Bacteria 1633
88 Ga0075362_10073618 3300006177 Bacteria 1564
89 Ga0075362_10094728 3300006177 Bacteria 1389
90 Ga0075362_10104348 3300006177 Bacteria 1328
91 Ga0075362_10220407 3300006177 Bacteria 927
92 Ga0075367_10007186 3300006178 Bacteria 5685
93 Ga0075367_10013529 3300006178 Bacteria 4390
94 Ga0075367_10039306 3300006178 Bacteria 2758
95 Ga0075367_10170405 3300006178 Bacteria 1356
96 Ga0075367_10299074 3300006178 Bacteria 1013
97 Ga0075367_10986758 3300006178 Unclassified 538
98 Ga0075369_10021124 3300006186 Bacteria 2672
99 Ga0075369_10039887 3300006186 Bacteria 2006
100 Ga0075369_10047619 3300006186 Bacteria 1849
101 Ga0075366_10331717 3300006195 Bacteria 932
102 Ga0075366_10954246 3300006195 Bacteria 535
103 Ga0097621_101070457 3300006237 Bacteria 756
104 Ga0075370_10158662 3300006353 Bacteria 1327
105 Ga0075370_10518799 3300006353 Unclassified 720
106 Ga0075370_10682625 3300006353 Bacteria 624
107 Ga0075370_10958645 3300006353 Bacteria 524
108 Ga0068871_101308633 3300006358 Bacteria 682
109 Ga0068871_101632037 3300006358 Unclassified 611
110 Ga0097620_101103125 3300006931 Bacteria 873
111 Ga0097620_102293650 3300006931 Unclassified 595
112 Ga0075435_100740089 3300007076 Bacteria 855
113 Ga0099794_10028726 3300007265 Bacteria 2588
114 Ga0099795_10306652 3300007788 Bacteria 700
115 Ga0105240_12012278 3300009093 Bacteria 600
116 Ga0111539_10750392 3300009094 Bacteria 1136
117 Ga0111539_11291353 3300009094 Unclassified 847
118 Ga0111539_11334356 3300009094 Bacteria 832
119 Ga0105241_10276343 3300009174 Bacteria 1433
120 Ga0105248_11298201 3300009177 Bacteria 823
121 Ga0105237_10162242 3300009545 Bacteria 2234
122 Ga0105238_10113682 3300009551 Bacteria 2687
123 Ga0105239_10048742 3300010375 Bacteria 4644
124 Ga0157370_10029073 3300013104 Bacteria 5430
125 Ga0157370_10107899 3300013104 Bacteria 2604
126 Ga0157370_10719163 3300013104 Bacteria 911
127 Ga0157369_10447351 3300013105 Bacteria 1338
128 Ga0157372_10296648 3300013307 Bacteria 1880
129 Ga0163163_12506003 3300014325 Unclassified 574
130 Ga0157380_10127846 3300014326 Bacteria 2163
131 Ga0157376_11516117 3300014969 Bacteria 703
132 Ga0157376_12024917 3300014969 Bacteria 614
133 Ga0206352_10845362 3300020078 Bacteria 941
134 Ga0206354_10342606 3300020081 Bacteria 1062
135 Ga0206353_11517089 3300020082 Bacteria 1189
136 Ga0207692_10397669 3300025898 Bacteria 858
137 Ga0207645_11199695 3300025907 Bacteria 509
138 Ga0207643_10681438 3300025908 Bacteria 664
139 Ga0207654_10220239 3300025911 Bacteria 1259
140 Ga0207695_11021422 3300025913 Bacteria 706
141 Ga0207671_10169439 3300025914 Bacteria 1695
142 Ga0207693_10352011 3300025915 Bacteria 1152
143 Ga0207660_11661391 3300025917 Bacteria 514
144 Ga0207662_10806523 3300025918 Bacteria 662
145 Ga0207649_10463831 3300025920 Unclassified 958
146 Ga0207649_10715716 3300025920 Bacteria 777
147 Ga0207681_10321153 3300025923 Bacteria 1231
148 Ga0207694_10171904 3300025924 Bacteria 1755
149 Ga0207659_10744310 3300025926 Bacteria 841
150 Ga0207664_10742315 3300025929 Bacteria 883
151 Ga0207644_10461982 3300025931 Bacteria 1044
152 Ga0207690_10340910 3300025932 Bacteria 1183
153 Ga0207706_10260508 3300025933 Bacteria 1514
154 Ga0207670_10177154 3300025936 Bacteria 1603
155 Ga0207670_10340013 3300025936 Bacteria 1186
156 Ga0207669_10192038 3300025937 Bacteria 1474
157 Ga0207669_11022644 3300025937 Bacteria 695
158 Ga0207691_10192411 3300025940 Bacteria 1779
159 Ga0207691_10499346 3300025940 Bacteria 1033
160 Ga0207661_10374822 3300025944 Bacteria 1287
161 Ga0207679_10083348 3300025945 Bacteria 2450
162 Ga0207667_10289642 3300025949 Bacteria 1673
163 Ga0207651_10526232 3300025960 Bacteria 1025
164 Ga0207651_10799481 3300025960 Bacteria 836
165 Ga0207712_10326227 3300025961 Bacteria 1268
166 Ga0207703_10958041 3300026035 Bacteria 820
167 Ga0207639_10410678 3300026041 Bacteria 1222
168 Ga0207639_11178327 3300026041 Unclassified 719
169 Ga0207702_10108952 3300026078 Bacteria 2458
170 Ga0207641_10409269 3300026088 Bacteria 1304
171 Ga0207648_11117984 3300026089 Bacteria 739
172 Ga0207674_10019244 3300026116 Bacteria 7401
173 Ga0207674_10048660 3300026116 Bacteria 4339
174 Ga0207675_100836444 3300026118 Bacteria 935
175 Ga0207683_10085543 3300026121 Bacteria 2803
176 Ga0207683_10470200 3300026121 Unclassified 1160
177 Ga0207683_12114815 3300026121 Bacteria 511
178 Ga0207428_10573495 3300027907 Bacteria 815
179 Ga0207428_11142541 3300027907 Bacteria 543
180 Ga0268266_10004709 3300028379 Bacteria 12983
181 Ga0268266_10008986 3300028379 Bacteria 8841
182 Ga0268266_10040891 3300028379 Bacteria 3953
183 Ga0268266_10055684 3300028379 Bacteria 3400
184 Ga0268266_10087039 3300028379 Bacteria 2732
185 Ga0268266_10230044 3300028379 Bacteria 1707
186 Ga0268266_10277884 3300028379 Bacteria 1556
187 Ga0268266_10389416 3300028379 Bacteria 1316
188 Ga0268265_10211043 3300028380 Bacteria 1692
189 Ga0268265_11726941 3300028380 Bacteria 632
190 Ga0268264_10733753 3300028381 Bacteria 983
191 Ga0265334_10275661 3300028573 Bacteria 577
192 Ga0265332_10101617 3300031238 Bacteria 1212
193 Ga0265325_10062749 3300031241 Bacteria 1882
194 Ga0265340_10180837 3300031247 Bacteria 953
195 Ga0265339_10236760 3300031249 Bacteria 888
196 Ga0265331_10174116 3300031250 Unclassified 973
197 Ga0265316_10144348 3300031344 Bacteria 1786
198 Ga0265316_10964537 3300031344 Bacteria 594
199 Ga0265314_10335815 3300031711 Bacteria 836
200 Ga0373928_0278553 3300035084 Unclassified 506
201 Ga0373936_0274971 3300035113 Bacteria 756
202 Ga0373941_0386349 3300035115 Bacteria 576
203 Ga0373931_0368852 3300035691 Bacteria 902
204 Ga0373935_0978365 3300035692 Bacteria 628
205 Ga0373927_0198158 3300035695 Bacteria 1318
206 Ga0373937_0164404 3300036401 Bacteria 2081
207 Ga0373925_1470095 3300037068 Unclassified 558
208 Ga0395899_0007298 3300037312 Bacteria 8549
209 Ga0395899_0012527 3300037312 Bacteria 6499
210 Ga0395899_0029226 3300037312 Bacteria 4146
211 Ga0395900_0028457 3300037418 Bacteria 5724
212 Ga0395900_0059253 3300037418 Bacteria 3941
213 Ga0395900_0100396 3300037418 Bacteria 2973
214 Ga0395898_0010779 3300037466 Bacteria 9548
215 Ga0395898_0241763 3300037466 Bacteria 1722
216 Ga0395898_0242027 3300037466 Bacteria 1721
217 Ga0395901_0003753 3300038443 Bacteria 15301
218 Ga0395901_0009336 3300038443 Bacteria 9945
219 Ga0395901_0012450 3300038443 Bacteria 8633
220 Ga0395901_0498806 3300038443 Bacteria 1239
221 Ga0395901_0914255 3300038443 Bacteria 858
222 Ga0436360_0371085 3300039438 Bacteria 523
223 Ga0436361_0062241 3300039447 Bacteria 758
224 Ga0439448_0046924 3300042005 Bacteria 1408
225 Ga0466963_0048375 3300044694 Bacteria 2810
226 Ga0466957_0422715 3300044842 Bacteria 914
227 Ga0466958_0260583 3300045836 Bacteria 1110
228 Ga0466967_0222179 3300045976 Bacteria 1795
229 Ga0495586_0433043 3300046535 Bacteria 758
230 Ga0496112_1860441 3300048915 Unclassified 514
231 Ga0496126_0019783 3300048929 Bacteria 6624
232 Ga0501032_0583575 3300049569 Bacteria 712
233 Ga0501033_0511220 3300049570 Bacteria 830
234 Ga0501034_0003048 3300049571 Bacteria 19368
235 Ga0501034_0013256 3300049571 Bacteria 8491
236 Ga0501034_0031878 3300049571 Bacteria 5354
237 Ga0501034_0482907 3300049571 Bacteria 1154
238 Ga0501034_0758047 3300049571 Bacteria 866
239 Ga0501036_1474375 3300049572 Bacteria 551
240 Ga0501037_0362852 3300049573 Bacteria 998
241 Ga0501043_0444009 3300049579 Bacteria 976
242 Ga0501043_0695905 3300049579 Bacteria 743
243 Ga0501046_0243054 3300049580 Unclassified 1327
244 Ga0501046_0409001 3300049580 Bacteria 979
245 Ga0501047_0084112 3300049581 Bacteria 3058
246 Ga0501047_0087433 3300049581 Bacteria 2994
247 Ga0501047_0627601 3300049581 Unclassified 895
248 Ga0501047_1004882 3300049581 Bacteria 647
249 Ga0501068_0152788 3300049584 Bacteria 1451
250 Ga0501069_0741574 3300049585 Bacteria 594
251 Ga0501070_0246373 3300049586 Bacteria 1462
252 Ga0501070_1013759 3300049586 Bacteria 643
253 Ga0501070_1251971 3300049586 Bacteria 568
254 Ga0501080_0710657 3300049742 Bacteria 886
255 Ga0501035_0490539 3300049822 Bacteria 1012
256 Ga0501035_1387527 3300049822 Bacteria 539
257 Ga0501044_0013632 3300049823 Bacteria 8785
258 Ga0501044_0245817 3300049823 Bacteria 1732
259 Ga0501044_0941864 3300049823 Bacteria 737
260 Ga0501044_1269425 3300049823 Bacteria 603
261 nmdc:mga03683_10027_c1 3300050489 Bacteria 3386
262 nmdc:mga03683_169426_c1 3300050489 Bacteria 992
263 nmdc:mga03683_444940_c1 3300050489 Bacteria 623
264 nmdc:mga03683_59694_c1 3300050489 Bacteria 1609
265 nmdc:mga03n38_24817_c1 3300050490 Bacteria 2455
266 nmdc:mga03n38_334992_c1 3300050490 Bacteria 820
267 nmdc:mga03n38_454650_c1 3300050490 Bacteria 713
268 nmdc:mga00v17_117362_c1 3300050491 Unclassified 1692
269 nmdc:mga00v17_200626_c1 3300050491 Bacteria 1289
270 nmdc:mga00v17_491626_c1 3300050491 Bacteria 796
271 nmdc:mga00v17_840005_c1 3300050491 Bacteria 584
272 nmdc:mga0yw44_13441_c1 3300050492 Bacteria 4311
273 nmdc:mga0yw44_14371_c1 3300050492 Bacteria 4203
274 nmdc:mga0yw44_216719_c1 3300050492 Bacteria 1268
275 nmdc:mga0yw44_219062_c1 3300050492 Bacteria 1261
276 nmdc:mga0yw44_351282_c1 3300050492 Unclassified 993
277 nmdc:mga0yw44_555498_c1 3300050492 Bacteria 780
278 nmdc:mga0yw44_673186_c1 3300050492 Bacteria 703
279 nmdc:mga0k408_189868_c1 3300050493 Bacteria 1226
280 nmdc:mga0k408_202650_c1 3300050493 Bacteria 1184
281 nmdc:mga06z11_140642_c1 3300050494 Unclassified 1364
282 nmdc:mga06z11_32767_c2 3300050494 Bacteria 1050
283 nmdc:mga06z11_48686_c1 3300050494 Bacteria 2159
284 nmdc:mga06z11_50326_c1 3300050494 Bacteria 2129
285 nmdc:mga06z11_74154_c1 3300050494 Bacteria 1808
286 nmdc:mga04h51_145006_c1 3300050495 Bacteria 903
287 nmdc:mga04h51_220257_c1 3300050495 Bacteria 752
288 nmdc:mga07m45_197703_c1 3300050496 Bacteria 1169
289 nmdc:mga07m45_288545_c1 3300050496 Bacteria 954
290 nmdc:mga07m45_315429_c1 3300050496 Bacteria 909
291 nmdc:mga08y16_631302_c1 3300050511 Bacteria 1077
292 nmdc:mga08y16_878114_c1 3300050511 Bacteria 884
293 nmdc:mga0sz30_14568_c1 3300050516 Bacteria 3097
294 nmdc:mga0sz30_413878_c1 3300050516 Unclassified 604
295 nmdc:mga0sz30_433_c1 3300050516 Bacteria 15768
296 nmdc:mga0sz30_5978_c1 3300050516 Bacteria 3448
297 Ga0500644_0058786 3300053088 Bacteria 1347
298 Ga0500646_0139234 3300053090 Bacteria 795
299 Ga0500566_0373507 3300053094 Bacteria 646
300 Ga0500641_0000747 3300053096 Bacteria 11773
301 Ga0500641_0006091 3300053096 Bacteria 4274
302 Ga0500558_262745 3300053106 Unclassified 560
303 Ga0500595_060256 3300053119 Bacteria 1149
304 Ga0500595_182909 3300053119 Bacteria 581
305 Ga0500655_016246 3300053133 Bacteria 1370
306 Ga0500616_0004736 3300053153 Bacteria 9570
307 Ga0500552_000417 3300053733 Bacteria 3924
308 Ga0500552_005576 3300053733 Bacteria 1377
309 Ga0587066_125157 3300059490 Bacteria 612
310 Ga0466962_0627968 3300061719 Bacteria 549
311 Ga0068863_100354491
312 JGI25406J46586_10263654
313 Ga0058862_12171428
314 Ga0070676_11113748
315 Ga0070683_100436909
316 Ga0070690_101178859
317 Ga0070670_101782149
318 Ga0070666_10675771
319 Ga0070680_101611426
320 Ga0070660_100578819
321 Ga0070689_100312327
322 Ga0070689_100518115
323 Ga0070687_100758904
324 Ga0070668_100551055
325 Ga0070669_100486403
326 Ga0070675_100955941
327 Ga0070674_100521525
328 Ga0070673_100502142
329 Ga0070688_100196104
330 Ga0070713_100060219
331 Ga0070710_10128348
332 Ga0070708_100050374
333 Ga0070678_100070703
334 Ga0070678_100427291
335 Ga0070662_100384308
336 Ga0070681_10675989
337 Ga0070681_12029346
338 Ga0070698_100383223
339 Ga0070679_100919704
340 Ga0070684_100029592
341 Ga0070697_100065884
342 Ga0068853_100983049
343 Ga0070672_100213278
344 Ga0070672_100566947
345 Ga0070686_100532225
346 Ga0070695_100966977
347 Ga0070665_100006866
348 Ga0070665_100014957
349 Ga0070665_100022376
350 Ga0070665_100053706
351 Ga0070665_100372082
352 Ga0070665_100433944
353 Ga0068855_100099492
354 Ga0068855_101657536
355 Ga0068855_102561941
356 Ga0070664_100034668
357 Ga0068857_100038919
358 Ga0068857_100057803
359 Ga0068856_100060817
360 Ga0068856_100326756
361 Ga0068852_100016808
362 Ga0068859_101103244
363 Ga0068859_102292385
364 Ga0068863_100580956
365 Ga0068863_101478544
366 Ga0068860_100141950
367 Ga0068862_101747718
368 Ga0068862_101884707
369 Ga0081455_10001485
370 Ga0081455_10005066
371 Ga0081455_10007462
372 Ga0081455_10015269
373 Ga0081455_10020763
374 Ga0081455_10090967
375 Ga0081538_10027063
376 Ga0081538_10151459
377 Ga0081539_10001996
378 Ga0075365_10103382
379 Ga0075365_10356981
380 Ga0075365_10368978
381 Ga0075365_10381859
382 Ga0075365_10833150
383 Ga0075368_10041846
384 Ga0075363_100069094
385 Ga0075363_100173794
386 Ga0075363_100419643
387 Ga0075364_10049260
388 Ga0075364_10342214
389 Ga0075364_10588074
390 Ga0075364_10734187
391 Ga0075432_10039141
392 Ga0070715_10300874
393 Ga0070716_101140879
394 Ga0070712_100026802
395 Ga0075362_10003094
396 Ga0075362_10003444
397 Ga0075362_10066942
398 Ga0075362_10073618
399 Ga0075362_10094728
400 Ga0075362_10104348
401 Ga0075362_10220407
402 Ga0075367_10007186
403 Ga0075367_10013529
404 Ga0075367_10039306
405 Ga0075367_10170405
406 Ga0075367_10299074
407 Ga0075367_10986758
408 Ga0075369_10021124
409 Ga0075369_10039887
410 Ga0075369_10047619
411 Ga0075366_10331717
412 Ga0075366_10954246
413 Ga0097621_101070457
414 Ga0075370_10158662
415 Ga0075370_10518799
416 Ga0075370_10682625
417 Ga0075370_10958645
418 Ga0068871_101308633
419 Ga0068871_101632037
420 Ga0097620_101103125
421 Ga0097620_102293650
422 Ga0075435_100740089
423 Ga0099794_10028726
424 Ga0099795_10306652
425 Ga0105240_12012278
426 Ga0111539_10750392
427 Ga0111539_11291353
428 Ga0111539_11334356
429 Ga0105241_10276343
430 Ga0105248_11298201
431 Ga0105237_10162242
432 Ga0105238_10113682
433 Ga0105239_10048742
434 Ga0157370_10029073
435 Ga0157370_10107899
436 Ga0157370_10719163
437 Ga0157369_10447351
438 Ga0157372_10296648
439 Ga0163163_12506003
440 Ga0157380_10127846
441 Ga0157376_11516117
442 Ga0157376_12024917
443 Ga0206352_10845362
444 Ga0206354_10342606
445 Ga0206353_11517089
446 Ga0207692_10397669
447 Ga0207645_11199695
448 Ga0207643_10681438
449 Ga0207654_10220239
450 Ga0207695_11021422
451 Ga0207671_10169439
452 Ga0207693_10352011
453 Ga0207660_11661391
454 Ga0207662_10806523
455 Ga0207649_10463831
456 Ga0207649_10715716
457 Ga0207681_10321153
458 Ga0207694_10171904
459 Ga0207659_10744310
460 Ga0207664_10742315
461 Ga0207644_10461982
462 Ga0207690_10340910
463 Ga0207706_10260508
464 Ga0207670_10177154
465 Ga0207670_10340013
466 Ga0207669_10192038
467 Ga0207669_11022644
468 Ga0207691_10192411
469 Ga0207691_10499346
470 Ga0207661_10374822
471 Ga0207679_10083348
472 Ga0207667_10289642
473 Ga0207651_10526232
474 Ga0207651_10799481
475 Ga0207712_10326227
476 Ga0207703_10958041
477 Ga0207639_10410678
478 Ga0207639_11178327
479 Ga0207702_10108952
480 Ga0207641_10409269
481 Ga0207648_11117984
482 Ga0207674_10019244
483 Ga0207674_10048660
484 Ga0207675_100836444
485 Ga0207683_10085543
486 Ga0207683_10470200
487 Ga0207683_12114815
488 Ga0207428_10573495
489 Ga0207428_11142541
490 Ga0268266_10004709
491 Ga0268266_10008986
492 Ga0268266_10040891
493 Ga0268266_10055684
494 Ga0268266_10087039
495 Ga0268266_10230044
496 Ga0268266_10277884
497 Ga0268266_10389416
498 Ga0268265_10211043
499 Ga0268265_11726941
500 Ga0268264_10733753
501 Ga0265334_10275661
502 Ga0265332_10101617
503 Ga0265325_10062749
504 Ga0265340_10180837
505 Ga0265339_10236760
506 Ga0265331_10174116
507 Ga0265316_10144348
508 Ga0265316_10964537
509 Ga0265314_10335815
510 Ga0373928_0278553
511 Ga0373936_0274971
512 Ga0373941_0386349
513 Ga0373931_0368852
514 Ga0373935_0978365
515 Ga0373927_0198158
516 Ga0373937_0164404
517 Ga0373925_1470095
518 Ga0395899_0007298
519 Ga0395899_0012527
520 Ga0395899_0029226
521 Ga0395900_0028457
522 Ga0395900_0059253
523 Ga0395900_0100396
524 Ga0395898_0010779
525 Ga0395898_0241763
526 Ga0395898_0242027
527 Ga0395901_0003753
528 Ga0395901_0009336
529 Ga0395901_0012450
530 Ga0395901_0498806
531 Ga0395901_0914255
532 Ga0436360_0371085
533 Ga0436361_0062241
534 Ga0439448_0046924
535 Ga0466963_0048375
536 Ga0466957_0422715
537 Ga0466958_0260583
538 Ga0466967_0222179
539 Ga0495586_0433043
540 Ga0496112_1860441
541 Ga0496126_0019783
542 Ga0501032_0583575
543 Ga0501033_0511220
544 Ga0501034_0003048
545 Ga0501034_0013256
546 Ga0501034_0031878
547 Ga0501034_0482907
548 Ga0501034_0758047
549 Ga0501036_1474375
550 Ga0501037_0362852
551 Ga0501043_0444009
552 Ga0501043_0695905
553 Ga0501046_0243054
554 Ga0501046_0409001
555 Ga0501047_0084112
556 Ga0501047_0087433
557 Ga0501047_0627601
558 Ga0501047_1004882
559 Ga0501068_0152788
560 Ga0501069_0741574
561 Ga0501070_0246373
562 Ga0501070_1013759
563 Ga0501070_1251971
564 Ga0501080_0710657
565 Ga0501035_0490539
566 Ga0501035_1387527
567 Ga0501044_0013632
568 Ga0501044_0245817
569 Ga0501044_0941864
570 Ga0501044_1269425
571 nmdc:mga03683_10027_c1
572 nmdc:mga03683_169426_c1
573 nmdc:mga03683_444940_c1
574 nmdc:mga03683_59694_c1
575 nmdc:mga03n38_24817_c1
576 nmdc:mga03n38_334992_c1
577 nmdc:mga03n38_454650_c1
578 nmdc:mga00v17_117362_c1
579 nmdc:mga00v17_200626_c1
580 nmdc:mga00v17_491626_c1
581 nmdc:mga00v17_840005_c1
582 nmdc:mga0yw44_13441_c1
583 nmdc:mga0yw44_14371_c1
584 nmdc:mga0yw44_216719_c1
585 nmdc:mga0yw44_219062_c1
586 nmdc:mga0yw44_351282_c1
587 nmdc:mga0yw44_555498_c1
588 nmdc:mga0yw44_673186_c1
589 nmdc:mga0k408_189868_c1
590 nmdc:mga0k408_202650_c1
591 nmdc:mga06z11_140642_c1
592 nmdc:mga06z11_32767_c2
593 nmdc:mga06z11_48686_c1
594 nmdc:mga06z11_50326_c1
595 nmdc:mga06z11_74154_c1
596 nmdc:mga04h51_145006_c1
597 nmdc:mga04h51_220257_c1
598 nmdc:mga07m45_197703_c1
599 nmdc:mga07m45_288545_c1
600 nmdc:mga07m45_315429_c1
601 nmdc:mga08y16_631302_c1
602 nmdc:mga08y16_878114_c1
603 nmdc:mga0sz30_14568_c1
604 nmdc:mga0sz30_413878_c1
605 nmdc:mga0sz30_433_c1
606 nmdc:mga0sz30_5978_c1
607 Ga0500644_0058786
608 Ga0500646_0139234
609 Ga0500566_0373507
610 Ga0500641_0000747
611 Ga0500641_0006091
612 Ga0500558_262745
613 Ga0500595_060256
614 Ga0500595_182909
615 Ga0500655_016246
616 Ga0500616_0004736
617 Ga0500552_000417
618 Ga0500552_005576
619 Ga0587066_125157
620 Ga0466962_0627968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xuv-assembly1.cif.gz_A the structure of hdeb 0.7579 30 92
4xvv-assembly1.cif.gz_A crystal structure of an acid stress chaperone hdeb (kpn_03484) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.70 a resolution 0.7114 32 97
2xuv-assembly1.cif.gz_A the structure of hdeb 0.6919 30 92
2lrm-assembly1.cif.gz_B assignment and structure of e coli periplasmic protein ymgd 0.6864 30 103
8p49-assembly1.cif.gz_F uncharacterized q8u0n8 protein from pyrococcus furiosus 0.6674 47 102
ID Description Score Start End Superfamily
3eifA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.853 71 97 3.40.50.200
1dj8D00 Mainly Alpha;Orthogonal Bundle;10k-s Protein, Hypothetical Protein A; Chain A;HNS-dependent expression A 0.6908 26 102 1.10.890.10
1dj8B00 Mainly Alpha;Orthogonal Bundle;10k-s Protein, Hypothetical Protein A; Chain A;HNS-dependent expression A 0.677 26 97 1.10.890.10
2lrmA00 Mainly Alpha;Orthogonal Bundle;10k-s Protein, Hypothetical Protein A; Chain A;YmgD protein 0.6747 31 103 1.10.890.30
1dj8D00 Mainly Alpha;Orthogonal Bundle;10k-s Protein, Hypothetical Protein A; Chain A;HNS-dependent expression A 0.6696 26 102 1.10.890.10
ID Description Score Start End GO Terms
AF-A0A521QS41-F1-model_v4 Uncharacterized protein 1.001 33 108
AF-A0A537MN42-F1-model_v4 Uncharacterized protein 1.001 41 108
AF-A0A521QS41-F1-model_v4 Uncharacterized protein 0.9877 33 108
AF-A0A537MN42-F1-model_v4 Uncharacterized protein 0.9868 41 108
AF-A0A7H1N4K1-F1-model_v4 Uncharacterized protein 0.9622 25 103

Map