F400397

General Info

Members Datasets Scaffolds Average Seq Length
309 180 292 277

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0027013|Ga0496125_0027013_2860_3762
Length 300
Sequence MELDTRVLDDAFARAAACIAEADALLVASGAGMGVDSGLPDFRGRQGFWRAYPALGRAGIDFHAAASPAAFRRDPVQAWGFYGHRLALYRRTRPHAGFALLQDWGQRMPGGWAVFTSNVDGHFQQAGTVPAALHECHGSIHHLQCLDDCRGAIWAAGDFVPEIDGQHCRLLGALPCCPHCGALARPNILMFGDGDWNPQREQVQAGRLQDWLDGLARRRARLVVVEIGAGTAVPSVRHFVQGLQRSLKARLVRINPGEPQVRGAHDVAVPAGALQALQGIGARIAAAAHQPGWPDLPQQP

Samples

Sample ID Description Type Environment
1 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541357 Duganella sp. GV053 Isolate Unclassified
8 2738543003 Duganella sp. GV066 Isolate Unclassified
9 2738543026 Duganella sp. GV089 Isolate Unclassified
10 2738543029 Duganella sp. GV039 Isolate Unclassified
11 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
12 2857553236 Duganella sp. R-74557 Isolate Unclassified
13 2857564685 Duganella sp. R-74599 Isolate Unclassified
14 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
15 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
16 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
17 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
18 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
80 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.86
Nodule 1.29
Rhizoplane 0.65
Rhizosphere 62.78
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001417 3300002739 Bacteria 4205
2 JGI25152J39213_1000052 3300002773 Bacteria 77690
3 JGI25150J39212_1003176 3300002774 Bacteria 3902
4 JGI25150J39212_1007949 3300002774 Bacteria 2102
5 JGI25159J45721_1002819 3300002987 Bacteria 6396
6 JGI25159J45721_1006442 3300002987 Bacteria 3511
7 rootH2_10025735 3300003320 Bacteria 8655
8 rootH1_10053425 3300003323 Bacteria 8209
9 rootH1_10182131 3300003323 Bacteria 1050
10 JGI25160J50197_1004044 3300003354 Bacteria 6396
11 JGI25161J50226_1000781 3300003374 Bacteria 12063
12 Ga0055532_1000314 3300003758 Bacteria 29382
13 Ga0055527_1000055 3300003760 Bacteria 97952
14 Ga0055535_1000083 3300003761 Bacteria 104680
15 Ga0055542_1001915 3300003762 Bacteria 8203
16 Ga0055529_1001228 3300003763 Bacteria 9732
17 Ga0055526_1000066 3300003771 Bacteria 101329
18 Ga0055526_1001340 3300003771 Bacteria 17636
19 Ga0055526_1002714 3300003771 Bacteria 11757
20 Ga0055526_1036919 3300003771 Bacteria 1287
21 Ga0055537_1000041 3300003773 Bacteria 91422
22 Ga0055537_1007927 3300003773 Bacteria 2499
23 Ga0055537_1009392 3300003773 Bacteria 2163
24 Ga0055524_1000153 3300003775 Bacteria 82019
25 Ga0055524_1000458 3300003775 Bacteria 33324
26 Ga0055524_1001007 3300003775 Bacteria 17516
27 Ga0055524_1001498 3300003775 Bacteria 13281
28 Ga0055524_1006565 3300003775 Bacteria 5030
29 Ga0055534_1000250 3300003784 Bacteria 37595
30 Ga0055534_1000279 3300003784 Bacteria 34956
31 Ga0055534_1002951 3300003784 Bacteria 5635
32 Ga0055528_1000089 3300003790 Bacteria 72690
33 Ga0055528_1001000 3300003790 Bacteria 18788
34 Ga0055530_10001254 3300003791 Bacteria 19279
35 Ga0055530_10001714 3300003791 Bacteria 15442
36 Ga0055531_10002167 3300003794 Bacteria 13418
37 Ga0055531_10007262 3300003794 Bacteria 6085
38 Ga0055543_1000266 3300004625 Bacteria 38914
39 Ga0065165_1000404 3300005262 Bacteria 69447
40 Ga0065165_1000877 3300005262 Bacteria 38914
41 Ga0070666_10153856 3300005335 Bacteria 1605
42 Ga0070682_100043662 3300005337 Bacteria 2773
43 Ga0070701_10002407 3300005438 Bacteria 7203
44 Ga0070694_100001593 3300005444 Bacteria 13333
45 Ga0070686_100000417 3300005544 Bacteria 26842
46 Ga0070704_100015185 3300005549 Bacteria 4832
47 Ga0068859_100163481 3300005617 Unclassified 2305
48 Ga0068865_100379881 3300006881 Bacteria 1152
49 Ga0097620_100163481 3300006931 Unclassified 2305
50 Ga0099826_10000001 3300006948 Bacteria 1155201
51 Ga0105244_10007325 3300009036 Bacteria 7020
52 Ga0105242_10348335 3300009176 Bacteria 1367
53 Ga0105248_10373450 3300009177 Bacteria 1605
54 Ga0105238_10585449 3300009551 Bacteria 1123
55 Ga0157371_10258518 3300013102 Bacteria 1255
56 Ga0209436_100552 3300025208 Bacteria 16215
57 Ga0209436_100706 3300025208 Bacteria 13981
58 Ga0209672_100040 3300025228 Bacteria 278858
59 Ga0209147_100048 3300025229 Bacteria 278858
60 Ga0207427_100530 3300025231 Bacteria 19851
61 Ga0209258_100070 3300025242 Bacteria 278858
62 Ga0207425_1000001 3300025245 Bacteria 2525432
63 Ga0207425_1000225 3300025245 Bacteria 44347
64 Ga0207425_1000992 3300025245 Bacteria 13326
65 Ga0207425_1003556 3300025245 Bacteria 4949
66 Ga0209148_1000284 3300025254 Bacteria 77768
67 Ga0209759_1001239 3300025256 Bacteria 15516
68 Ga0209759_1013080 3300025256 Bacteria 2263
69 Ga0209129_1000001 3300025258 Bacteria 1452436
70 Ga0209129_1001784 3300025258 Bacteria 11480
71 Ga0209565_1000009 3300025263 Bacteria 751701
72 Ga0209565_1000525 3300025263 Bacteria 27168
73 Ga0209565_1000769 3300025263 Bacteria 18725
74 Ga0209565_1003286 3300025263 Bacteria 5315
75 Ga0209455_1000178 3300025272 Bacteria 104960
76 Ga0209673_1000019 3300025273 Bacteria 449094
77 Ga0209130_1000179 3300025284 Bacteria 90126
78 Ga0209130_1000365 3300025284 Bacteria 51263
79 Ga0209130_1001610 3300025284 Bacteria 14009
80 Ga0209130_1002369 3300025284 Bacteria 9556
81 Ga0209675_1000028 3300025291 Bacteria 281253
82 Ga0209675_1001170 3300025291 Bacteria 15921
83 Ga0209675_1002613 3300025291 Bacteria 9124
84 Ga0209025_1002077 3300025294 Bacteria 22739
85 Ga0209564_1000009 3300025295 Bacteria 950196
86 Ga0209564_1000045 3300025295 Bacteria 376549
87 Ga0209564_1000058 3300025295 Bacteria 332955
88 Ga0209564_1000376 3300025295 Bacteria 82120
89 Ga0209564_1002236 3300025295 Bacteria 15948
90 Ga0209758_1000489 3300025297 Bacteria 64758
91 Ga0209050_1000446 3300025298 Bacteria 74770
92 Ga0209050_1000611 3300025298 Bacteria 56265
93 Ga0209050_1008018 3300025298 Bacteria 5757
94 Ga0209256_1000005 3300025299 Bacteria 1315082
95 Ga0209256_1000052 3300025299 Bacteria 299374
96 Ga0209256_1000350 3300025299 Bacteria 74944
97 Ga0209256_1000872 3300025299 Bacteria 37384
98 Ga0209256_1000972 3300025299 Bacteria 34469
99 Ga0207426_1001676 3300025302 Bacteria 17140
100 Ga0209257_1000021 3300025304 Bacteria 771986
101 Ga0209257_1000107 3300025304 Bacteria 240937
102 Ga0209282_1000001 3300027666 Bacteria 2450367
103 Ga0265338_10000075 3300028800 Bacteria 180334
104 Ga0265338_10000111 3300028800 Bacteria 151469
105 Ga0265324_10002115 3300029957 Bacteria 10468
106 Ga0265324_10009146 3300029957 Unclassified 3886
107 Ga0316177_1035268 3300030731 Bacteria 1666
108 Ga0316182_1110678 3300030745 Bacteria 2676
109 Ga0265332_10000004 3300031238 Bacteria 426592
110 Ga0265332_10005014 3300031238 Bacteria 6154
111 Ga0265332_10024247 3300031238 Bacteria 2670
112 Ga0265328_10019338 3300031239 Bacteria 2618
113 Ga0265339_10061034 3300031249 Unclassified 2030
114 Ga0265339_10095135 3300031249 Bacteria 1556
115 Ga0265327_10000143 3300031251 Bacteria 156870
116 Ga0265316_10132126 3300031344 Bacteria 1879
117 Ga0265316_10184294 3300031344 Bacteria 1553
118 Ga0307408_100000103 3300031548 Bacteria 93203
119 Ga0307408_100005799 3300031548 Bacteria 8219
120 Ga0307408_100007817 3300031548 Bacteria 7067
121 Ga0307408_100117807 3300031548 Bacteria 2052
122 Ga0316575_10017103 3300031665 Bacteria 2751
123 Ga0265342_10043760 3300031712 Bacteria 2701
124 Ga0307413_10270168 3300031824 Bacteria 1272
125 Ga0307416_100005765 3300032002 Bacteria 7670
126 Ga0395899_0110197 3300037312 Bacteria 1980
127 Ga0395900_0118388 3300037418 Bacteria 2718
128 Ga0395898_0390057 3300037466 Bacteria 1328
129 Ga0395905_0005270 3300037471 Bacteria 13222
130 Ga0395905_0013348 3300037471 Bacteria 7873
131 Ga0395905_0041544 3300037471 Bacteria 4315
132 Ga0395901_0001815 3300038443 Bacteria 22051
133 Ga0395901_0004538 3300038443 Bacteria 14006
134 Ga0395901_0027728 3300038443 Bacteria 5823
135 Ga0400491_20274 3300038727 Bacteria 1369
136 Ga0436361_0647794 3300039447 Bacteria 7023
137 Ga0451577_0049914 3300042876 Bacteria 3735
138 Ga0466982_0055618 3300044672 Bacteria 2430
139 Ga0466961_0000142 3300044693 Bacteria 48238
140 Ga0466963_0049131 3300044694 Plasmid 2789
141 Ga0453684_0079369 3300044712 Bacteria 4103
142 Ga0453684_0355352 3300044712 Bacteria 1651
143 Ga0466971_0013504 3300044719 Plasmid 3588
144 Ga0466957_0043461 3300044842 Plasmid 2721
145 Ga0466957_0145523 3300044842 Bacteria 1529
146 Ga0466959_0000549 3300045049 Bacteria 21812
147 Ga0451576_0090016 3300045051 Bacteria 3192
148 Ga0451576_0238190 3300045051 Bacteria 1901
149 Ga0451576_0240253 3300045051 Bacteria 1892
150 Ga0451576_0324606 3300045051 Bacteria 1611
151 Ga0466958_0010646 3300045836 Bacteria 5157
152 Ga0466958_0042910 3300045836 Bacteria 2723
153 Ga0495617_000052 3300046452 Bacteria 104195
154 Ga0495627_000088 3300046453 Bacteria 110479
155 Ga0495627_004110 3300046453 Bacteria 6184
156 Ga0495590_0056791 3300046457 Bacteria 1368
157 Ga0495591_019909 3300046458 Unclassified 2233
158 Ga0495629_0000086 3300046459 Bacteria 82447
159 Ga0495653_0000013 3300046463 Bacteria 250453
160 Ga0495653_0000135 3300046463 Bacteria 61394
161 Ga0495653_0016100 3300046463 Bacteria 6092
162 Ga0495650_0000272 3300046471 Bacteria 98846
163 Ga0495650_0002473 3300046471 Bacteria 14869
164 Ga0495580_0000034 3300046472 Bacteria 74811
165 Ga0495580_0000177 3300046472 Bacteria 47715
166 Ga0495605_0005879 3300046474 Bacteria 7089
167 Ga0495664_0143440 3300046477 Bacteria 1448
168 Ga0495584_0037503 3300046491 Bacteria 2450
169 Ga0495584_0112118 3300046491 Bacteria 1380
170 Ga0495585_0000005 3300046492 Bacteria 328103
171 Ga0495585_0000218 3300046492 Bacteria 59582
172 Ga0495585_0000221 3300046492 Bacteria 59316
173 Ga0495607_0005960 3300046501 Bacteria 8643
174 Ga0495607_0013194 3300046501 Bacteria 5425
175 Ga0495607_0155225 3300046501 Bacteria 1168
176 Ga0495583_0004869 3300046506 Bacteria 9375
177 Ga0495583_0013127 3300046506 Bacteria 4641
178 Ga0495606_0000141 3300046507 Bacteria 123586
179 Ga0495606_0000266 3300046507 Bacteria 92444
180 Ga0495606_0000461 3300046507 Bacteria 66807
181 Ga0495606_0005855 3300046507 Bacteria 11588
182 Ga0495606_0201737 3300046507 Bacteria 1133
183 Ga0495610_0006518 3300046512 Bacteria 8008
184 Ga0495616_0008874 3300046513 Bacteria 5915
185 Ga0495616_0181390 3300046513 Bacteria 935
186 Ga0495628_0000222 3300046516 Bacteria 49830
187 Ga0495628_0021775 3300046516 Bacteria 5267
188 Ga0495628_0034720 3300046516 Bacteria 4056
189 Ga0495628_0189191 3300046516 Bacteria 1555
190 Ga0495628_0198198 3300046516 Bacteria 1514
191 Ga0495637_0004821 3300046520 Bacteria 6956
192 Ga0495643_0000287 3300046522 Bacteria 72080
193 Ga0495648_0000033 3300046524 Bacteria 199184
194 Ga0495648_0000058 3300046524 Bacteria 156717
195 Ga0495648_0006083 3300046524 Bacteria 9903
196 Ga0495648_0082071 3300046524 Bacteria 1831
197 Ga0495642_0000223 3300046528 Bacteria 32585
198 Ga0495642_0003194 3300046528 Bacteria 6491
199 Ga0495642_0005376 3300046528 Bacteria 4913
200 Ga0495642_0016539 3300046528 Bacteria 2876
201 Ga0495642_0069913 3300046528 Bacteria 1467
202 Ga0495654_0000074 3300046530 Bacteria 114325
203 Ga0495654_0011589 3300046530 Bacteria 4766
204 Ga0495609_0002007 3300046538 Bacteria 12864
205 Ga0495597_0000242 3300046542 Bacteria 49561
206 Ga0495597_0074454 3300046542 Bacteria 1458
207 Ga0495656_0170193 3300046615 Bacteria 1064
208 Ga0495668_0000063 3300046616 Bacteria 184563
209 Ga0495668_0000290 3300046616 Bacteria 68805
210 Ga0495668_0000383 3300046616 Bacteria 58324
211 Ga0495668_0005086 3300046616 Bacteria 9046
212 Ga0495668_0070594 3300046616 Bacteria 1920
213 Ga0495625_0000139 3300046660 Bacteria 112271
214 Ga0495625_0007209 3300046660 Bacteria 9734
215 Ga0495625_0048542 3300046660 Bacteria 3056
216 Ga0495625_0089979 3300046660 Bacteria 2124
217 Ga0495659_0113913 3300046664 Bacteria 1058
218 Ga0495661_0000084 3300046665 Bacteria 114797
219 Ga0495661_0000534 3300046665 Bacteria 39177
220 Ga0495661_0008207 3300046665 Bacteria 7232
221 Ga0495661_0023583 3300046665 Bacteria 3992
222 Ga0495661_0030787 3300046665 Bacteria 3414
223 Ga0495599_0000111 3300046678 Bacteria 54600
224 Ga0495599_0031915 3300046678 Bacteria 3306
225 Ga0495599_0063866 3300046678 Bacteria 2300
226 Ga0495623_0007825 3300046679 Bacteria 6950
227 Ga0495646_0000123 3300046680 Bacteria 38714
228 Ga0495646_0159727 3300046680 Bacteria 1249
229 Ga0495669_0005902 3300046684 Bacteria 5104
230 Ga0495613_0141006 3300046689 Bacteria 1722
231 Ga0495624_0000041 3300046690 Bacteria 81845
232 Ga0495671_0021139 3300046692 Bacteria 3422
233 Ga0495649_0009883 3300046694 Bacteria 5646
234 Ga0495589_0091850 3300046794 Bacteria 1474
235 Ga0495589_0164269 3300046794 Bacteria 1057
236 Ga0495660_0000607 3300046810 Bacteria 28251
237 Ga0495660_0001200 3300046810 Bacteria 18152
238 Ga0495660_0003765 3300046810 Bacteria 9305
239 Ga0495660_0023124 3300046810 Bacteria 3548
240 Ga0495660_0044752 3300046810 Bacteria 2433
241 Ga0495604_0018142 3300047317 Bacteria 5633
242 Ga0495674_0000090 3300047319 Bacteria 64955
243 Ga0495674_0000309 3300047319 Bacteria 42573
244 Ga0495674_0038528 3300047319 Bacteria 4289
245 Ga0495674_0161847 3300047319 Bacteria 1872
246 Ga0495672_0001537 3300047320 Bacteria 22567
247 Ga0495672_0006771 3300047320 Bacteria 8783
248 Ga0495672_0058210 3300047320 Bacteria 2241
249 Ga0495680_0060965 3300047322 Bacteria 2904
250 Ga0495687_000813 3300047443 Bacteria 33479
251 Ga0495687_005118 3300047443 Bacteria 8491
252 Ga0495687_011795 3300047443 Bacteria 4669
253 Ga0495687_013937 3300047443 Bacteria 4164
254 Ga0495675_0009318 3300047444 Bacteria 6108
255 Ga0495679_015446 3300047446 Bacteria 2792
256 Ga0495685_000925 3300047447 Bacteria 8900
257 Ga0495673_0000049 3300047469 Bacteria 265878
258 Ga0495681_0000637 3300047470 Bacteria 26780
259 Ga0495681_0013591 3300047470 Bacteria 4713
260 Ga0495686_0001279 3300047472 Bacteria 28449
261 Ga0495686_0036709 3300047472 Bacteria 3144
262 Ga0495686_0050527 3300047472 Bacteria 2612
263 Ga0495593_0000169 3300047673 Bacteria 33637
264 Ga0495602_0000292 3300048088 Bacteria 46012
265 Ga0495602_0012189 3300048088 Bacteria 8852
266 Ga0495614_0091961 3300048089 Bacteria 1320
267 Ga0495626_0000362 3300048091 Bacteria 47538
268 Ga0495626_0000630 3300048091 Bacteria 34239
269 Ga0495626_0000775 3300048091 Bacteria 29175
270 Ga0496108_0152852 3300048911 Bacteria 1992
271 Ga0496114_0003374 3300048917 Bacteria 12258
272 Ga0496119_0204501 3300048922 Bacteria 1020
273 Ga0496123_0001987 3300048926 Bacteria 26451
274 Ga0496124_0027868 3300048927 Bacteria 5060
275 Ga0496124_0093805 3300048927 Bacteria 2442
276 Ga0496124_0130512 3300048927 Bacteria 1997
277 Ga0496125_0027013 3300048928 Bacteria 5212
278 Ga0495678_000155 3300049459 Bacteria 81324
279 Ga0495678_002242 3300049459 Bacteria 13473
280 Ga0495678_097347 3300049459 Bacteria 1025
281 Ga0495682_0020753 3300049460 Bacteria 2465
282 Ga0501031_0399847 3300049568 Bacteria 888
283 Ga0501034_0004765 3300049571 Bacteria 15013
284 Ga0501046_0508193 3300049580 Bacteria 862
285 Ga0501227_011839 3300049665 Bacteria 1905
286 Ga0501079_0229813 3300049741 Bacteria 1449
287 Ga0501080_0075385 3300049742 Bacteria 3138
288 Ga0501083_0196208 3300049744 Bacteria 1317
289 Ga0501266_007463 3300049763 Bacteria 1370
290 Ga0500618_000104 3300053125 Bacteria 68104
291 Ga0500618_026527 3300053125 Bacteria 1383
292 Ga0466962_0011023 3300061719 Plasmid 4351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046680 Ga0495646_0159727 Ga0495646_0159727_38_730 224
2 3300038443 Ga0395901_0027728 Ga0395901_0027728_4845_5552 231
3 3300049568 Ga0501031_0399847 Ga0501031_0399847_138_878 243
4 3300031238 Ga0265332_10024247 Ga0265332_100242474 245
5 3300031249 Ga0265339_10095135 Ga0265339_100951351 245
6 3300031344 Ga0265316_10132126 Ga0265316_101321262 245
7 3300031712 Ga0265342_10043760 Ga0265342_100437603 245
8 3300049744 Ga0501083_0196208 Ga0501083_0196208_504_1256 245
9 3300031665 Ga0316575_10017103 Ga0316575_100171032 248
10 3300046513 Ga0495616_0181390 Ga0495616_0181390_19_774 248
11 3300025256 Ga0209759_1013080 Ga0209759_10130802 252
12 3300005335 Ga0070666_10153856 Ga0070666_101538561 253
13 3300046463 Ga0495653_0016100 Ga0495653_0016100_779_1630 255
14 3300031251 Ga0265327_10000143 Ga0265327_1000014376 259
15 3300003323 rootH1_10053425 rootH1_100534252 262
16 3300049741 Ga0501079_0229813 Ga0501079_0229813_525_1352 262
17 3300025299 Ga0209256_1000350 Ga0209256_100035050 263
18 3300046458 Ga0495591_019909 Ga0495591_019909_1119_1991 263
19 3300049763 Ga0501266_007463 Ga0501266_007463_513_1316 263
20 3300009176 Ga0105242_10348335 Ga0105242_103483352 264
21 iso_pu_bacteria 2547132512 2548848164 266
22 3300009177 Ga0105248_10373450 Ga0105248_103734502 267
23 3300039447 Ga0436361_0647794 Ga0436361_0647794_5656_6474 267
24 3300046516 Ga0495628_0198198 Ga0495628_0198198_169_981 267
25 3300046678 Ga0495599_0063866 Ga0495599_0063866_1295_2107 267
26 3300049571 Ga0501034_0004765 Ga0501034_0004765_5967_6788 268
27 iso_pu_bacteria 2515154122 2515681251 268
28 iso_pu_bacteria 2643221645 2644252422 268
29 iso_pu_bacteria 2894510363 2894511058 268
30 iso_pu_bacteria 2902682994 2902686303 268
31 iso_pu_bacteria 2990703756 2990704377 268
32 3300003758 Ga0055532_1000314 Ga0055532_100031423 269
33 3300003760 Ga0055527_1000055 Ga0055527_100005560 269
34 3300003761 Ga0055535_1000083 Ga0055535_100008360 269
35 3300003762 Ga0055542_1001915 Ga0055542_10019158 269
36 3300003763 Ga0055529_1001228 Ga0055529_10012282 269
37 3300025228 Ga0209672_100040 Ga0209672_10004059 269
38 3300025229 Ga0209147_100048 Ga0209147_10004859 269
39 3300025242 Ga0209258_100070 Ga0209258_10007059 269
40 3300025254 Ga0209148_1000284 Ga0209148_100028423 269
41 3300025256 Ga0209759_1001239 Ga0209759_100123910 269
42 3300025272 Ga0209455_1000178 Ga0209455_100017829 269
43 3300031824 Ga0307413_10270168 Ga0307413_102701682 269
44 3300044842 Ga0466957_0145523 Ga0466957_0145523_372_1196 269
45 3300046459 Ga0495629_0000086 Ga0495629_0000086_34728_35546 269
46 3300046463 Ga0495653_0000135 Ga0495653_0000135_28811_29629 269
47 3300046472 Ga0495580_0000177 Ga0495580_0000177_15587_16405 269
48 3300046477 Ga0495664_0143440 Ga0495664_0143440_245_1063 269
49 3300046516 Ga0495628_0000222 Ga0495628_0000222_34127_34945 269
50 3300046516 Ga0495628_0034720 Ga0495628_0034720_975_1811 269
51 3300046516 Ga0495628_0189191 Ga0495628_0189191_699_1535 269
52 3300046678 Ga0495599_0031915 Ga0495599_0031915_64_900 269
53 3300046680 Ga0495646_0000123 Ga0495646_0000123_34721_35539 269
54 3300046689 Ga0495613_0141006 Ga0495613_0141006_76_894 269
55 3300046690 Ga0495624_0000041 Ga0495624_0000041_46302_47120 269
56 3300046794 Ga0495589_0164269 Ga0495589_0164269_137_973 269
57 3300047317 Ga0495604_0018142 Ga0495604_0018142_1383_2219 269
58 3300047319 Ga0495674_0000090 Ga0495674_0000090_34728_35546 269
59 3300047319 Ga0495674_0000309 Ga0495674_0000309_22120_22956 269
60 3300047320 Ga0495672_0001537 Ga0495672_0001537_15186_16013 269
61 3300047673 Ga0495593_0000169 Ga0495593_0000169_31064_31882 269
62 3300048088 Ga0495602_0012189 Ga0495602_0012189_4417_5253 269
63 3300048089 Ga0495614_0091961 Ga0495614_0091961_235_1053 269
64 3300049459 Ga0495678_097347 Ga0495678_097347_179_1006 269
65 iso_pu_bacteria 2738541297 2738829636 269
66 iso_pu_bacteria 2738541357 2739153432 269
67 iso_pu_bacteria 2738543003 2739195352 269
68 iso_pu_bacteria 2738543026 2739321828 269
69 iso_pu_bacteria 2738543029 2739339616 269
70 iso_pu_bacteria 2857564685 2857565135 269
71 3300028800 Ga0265338_10000075 Ga0265338_10000075122 270
72 3300028800 Ga0265338_10000111 Ga0265338_1000011190 270
73 3300029957 Ga0265324_10002115 Ga0265324_100021152 270
74 3300029957 Ga0265324_10009146 Ga0265324_100091462 270
75 3300031238 Ga0265332_10000004 Ga0265332_10000004299 270
76 3300031249 Ga0265339_10061034 Ga0265339_100610342 270
77 3300031344 Ga0265316_10184294 Ga0265316_101842942 270
78 3300044712 Ga0453684_0079369 Ga0453684_0079369_1306_2133 270
79 3300045051 Ga0451576_0090016 Ga0451576_0090016_1833_2660 270
80 3300045051 Ga0451576_0238190 Ga0451576_0238190_441_1286 270
81 3300046524 Ga0495648_0006083 Ga0495648_0006083_4988_5812 270
82 3300047320 Ga0495672_0058210 Ga0495672_0058210_1241_2065 270
83 3300049580 Ga0501046_0508193 Ga0501046_0508193_26_850 270
84 iso_pu_bacteria 2921643360 2921644950 270
85 3300030731 Ga0316177_1035268 Ga0316177_10352681 271
86 3300031238 Ga0265332_10005014 Ga0265332_100050141 271
87 3300042876 Ga0451577_0049914 Ga0451577_0049914_2785_3621 271
88 3300044693 Ga0466961_0000142 Ga0466961_0000142_29894_30736 271
89 3300044694 Ga0466963_0049131 Ga0466963_0049131_857_1699 271
90 3300044719 Ga0466971_0013504 Ga0466971_0013504_2349_3191 271
91 3300044842 Ga0466957_0043461 Ga0466957_0043461_1450_2292 271
92 3300045049 Ga0466959_0000549 Ga0466959_0000549_2148_2990 271
93 3300045836 Ga0466958_0010646 Ga0466958_0010646_674_1516 271
94 3300046516 Ga0495628_0021775 Ga0495628_0021775_464_1306 271
95 3300046678 Ga0495599_0000111 Ga0495599_0000111_44778_45620 271
96 3300046679 Ga0495623_0007825 Ga0495623_0007825_676_1518 271
97 3300047319 Ga0495674_0038528 Ga0495674_0038528_1922_2764 271
98 3300047319 Ga0495674_0161847 Ga0495674_0161847_438_1280 271
99 3300047322 Ga0495680_0060965 Ga0495680_0060965_480_1322 271
100 3300047444 Ga0495675_0009318 Ga0495675_0009318_4585_5427 271
101 3300048088 Ga0495602_0000292 Ga0495602_0000292_24890_25732 271
102 3300049460 Ga0495682_0020753 Ga0495682_0020753_603_1445 271
103 3300061719 Ga0466962_0011023 Ga0466962_0011023_2169_3011 271
104 3300003771 Ga0055526_1002714 Ga0055526_100271410 272
105 3300003773 Ga0055537_1000041 Ga0055537_100004128 272
106 3300003775 Ga0055524_1006565 Ga0055524_10065656 272
107 3300003784 Ga0055534_1000250 Ga0055534_100025035 272
108 3300003784 Ga0055534_1000279 Ga0055534_100027928 272
109 3300003790 Ga0055528_1000089 Ga0055528_100008925 272
110 3300003794 Ga0055531_10007262 Ga0055531_100072622 272
111 3300025263 Ga0209565_1000009 Ga0209565_1000009210 272
112 3300025273 Ga0209673_1000019 Ga0209673_1000019172 272
113 3300025291 Ga0209675_1000028 Ga0209675_1000028184 272
114 3300025295 Ga0209564_1000058 Ga0209564_1000058110 272
115 3300025298 Ga0209050_1008018 Ga0209050_10080183 272
116 3300025299 Ga0209256_1000052 Ga0209256_100005244 272
117 3300025304 Ga0209257_1000021 Ga0209257_1000021532 272
118 3300046453 Ga0495627_004110 Ga0495627_004110_5095_5919 272
119 3300046528 Ga0495642_0003194 Ga0495642_0003194_2898_3722 272
120 3300049742 Ga0501080_0075385 Ga0501080_0075385_1353_2195 272
121 iso_pu_bacteria 2643221554 2643787400 272
122 3300002774 JGI25150J39212_1003176 JGI25150J39212_10031763 273
123 3300002987 JGI25159J45721_1006442 JGI25159J45721_10064424 273
124 3300003323 rootH1_10182131 rootH1_101821311 273
125 3300003775 Ga0055524_1000153 Ga0055524_100015362 273
126 3300005262 Ga0065165_1000404 Ga0065165_10004043 273
127 3300005337 Ga0070682_100043662 Ga0070682_1000436624 273
128 3300006881 Ga0068865_100379881 Ga0068865_1003798812 273
129 3300006948 Ga0099826_10000001 Ga0099826_100000011099 273
130 3300013102 Ga0157371_10258518 Ga0157371_102585181 273
131 3300025245 Ga0207425_1003556 Ga0207425_10035563 273
132 3300025284 Ga0209130_1000179 Ga0209130_10001792 273
133 3300025294 Ga0209025_1002077 Ga0209025_10020775 273
134 3300025297 Ga0209758_1000489 Ga0209758_100048955 273
135 3300025299 Ga0209256_1000005 Ga0209256_1000005519 273
136 3300027666 Ga0209282_1000001 Ga0209282_10000012223 273
137 3300030745 Ga0316182_1110678 Ga0316182_11106783 273
138 3300037471 Ga0395905_0005270 Ga0395905_0005270_11826_12653 273
139 3300038727 Ga0400491_20274 Ga0400491_20274_418_1260 273
140 3300044712 Ga0453684_0355352 Ga0453684_0355352_566_1405 273
141 3300045051 Ga0451576_0240253 Ga0451576_0240253_155_1042 273
142 3300046463 Ga0495653_0000013 Ga0495653_0000013_198041_198865 273
143 3300046471 Ga0495650_0002473 Ga0495650_0002473_1487_2311 273
144 3300046472 Ga0495580_0000034 Ga0495580_0000034_47566_48414 273
145 3300046474 Ga0495605_0005879 Ga0495605_0005879_1764_2588 273
146 3300046501 Ga0495607_0005960 Ga0495607_0005960_375_1199 273
147 3300046506 Ga0495583_0004869 Ga0495583_0004869_4459_5283 273
148 3300046506 Ga0495583_0013127 Ga0495583_0013127_3513_4361 273
149 3300046507 Ga0495606_0000266 Ga0495606_0000266_66951_67775 273
150 3300046513 Ga0495616_0008874 Ga0495616_0008874_3358_4182 273
151 3300046520 Ga0495637_0004821 Ga0495637_0004821_4817_5641 273
152 3300046524 Ga0495648_0082071 Ga0495648_0082071_788_1612 273
153 3300046528 Ga0495642_0069913 Ga0495642_0069913_119_943 273
154 3300046530 Ga0495654_0000074 Ga0495654_0000074_1328_2152 273
155 3300046530 Ga0495654_0011589 Ga0495654_0011589_1607_2431 273
156 3300046616 Ga0495668_0000063 Ga0495668_0000063_29934_30758 273
157 3300046616 Ga0495668_0000383 Ga0495668_0000383_19337_20161 273
158 3300046616 Ga0495668_0005086 Ga0495668_0005086_4387_5211 273
159 3300046660 Ga0495625_0007209 Ga0495625_0007209_3872_4696 273
160 3300046660 Ga0495625_0048542 Ga0495625_0048542_984_1808 273
161 3300046664 Ga0495659_0113913 Ga0495659_0113913_38_862 273
162 3300046665 Ga0495661_0023583 Ga0495661_0023583_1432_2256 273
163 3300046665 Ga0495661_0030787 Ga0495661_0030787_259_1083 273
164 3300046684 Ga0495669_0005902 Ga0495669_0005902_3419_4243 273
165 3300046692 Ga0495671_0021139 Ga0495671_0021139_1907_2731 273
166 3300046694 Ga0495649_0009883 Ga0495649_0009883_2937_3761 273
167 3300046810 Ga0495660_0044752 Ga0495660_0044752_279_1103 273
168 3300047443 Ga0495687_011795 Ga0495687_011795_3452_4300 273
169 3300047446 Ga0495679_015446 Ga0495679_015446_1804_2628 273
170 3300047447 Ga0495685_000925 Ga0495685_000925_2046_2870 273
171 3300047469 Ga0495673_0000049 Ga0495673_0000049_71320_72144 273
172 3300047470 Ga0495681_0013591 Ga0495681_0013591_3232_4056 273
173 3300047472 Ga0495686_0001279 Ga0495686_0001279_22504_23328 273
174 3300048917 Ga0496114_0003374 Ga0496114_0003374_5033_5878 273
175 3300048922 Ga0496119_0204501 Ga0496119_0204501_64_888 273
176 3300048926 Ga0496123_0001987 Ga0496123_0001987_2097_2921 273
177 3300053125 Ga0500618_000104 Ga0500618_000104_38415_39239 273
178 3300053125 Ga0500618_026527 Ga0500618_026527_84_908 273
179 iso_pu_bacteria 2857553236 2857554098 273
180 3300003771 Ga0055526_1000066 Ga0055526_100006661 274
181 3300005438 Ga0070701_10002407 Ga0070701_100024074 274
182 3300005444 Ga0070694_100001593 Ga0070694_1000015931 274
183 3300005544 Ga0070686_100000417 Ga0070686_10000041716 274
184 3300005549 Ga0070704_100015185 Ga0070704_1000151854 274
185 3300005617 Ga0068859_100163481 Ga0068859_1001634812 274
186 3300006931 Ga0097620_100163481 Ga0097620_1001634812 274
187 3300009036 Ga0105244_10007325 Ga0105244_100073256 274
188 3300025295 Ga0209564_1000009 Ga0209564_1000009581 274
189 3300044672 Ga0466982_0055618 Ga0466982_0055618_1069_1911 274
190 3300046453 Ga0495627_000088 Ga0495627_000088_106414_107247 274
191 3300046471 Ga0495650_0000272 Ga0495650_0000272_16217_17047 274
192 3300046492 Ga0495585_0000218 Ga0495585_0000218_13017_13853 274
193 3300046501 Ga0495607_0013194 Ga0495607_0013194_3170_4006 274
194 3300046501 Ga0495607_0155225 Ga0495607_0155225_170_1021 274
195 3300046507 Ga0495606_0000141 Ga0495606_0000141_58642_59496 274
196 3300046507 Ga0495606_0000461 Ga0495606_0000461_34865_35701 274
197 3300046512 Ga0495610_0006518 Ga0495610_0006518_4241_5095 274
198 3300046522 Ga0495643_0000287 Ga0495643_0000287_34764_35600 274
199 3300046524 Ga0495648_0000058 Ga0495648_0000058_113344_114180 274
200 3300046528 Ga0495642_0000223 Ga0495642_0000223_29536_30372 274
201 3300046538 Ga0495609_0002007 Ga0495609_0002007_9616_10449 274
202 3300046542 Ga0495597_0000242 Ga0495597_0000242_6565_7401 274
203 3300046616 Ga0495668_0000290 Ga0495668_0000290_13977_14831 274
204 3300046660 Ga0495625_0000139 Ga0495625_0000139_44690_45520 274
205 3300046660 Ga0495625_0089979 Ga0495625_0089979_1001_1852 274
206 3300046810 Ga0495660_0000607 Ga0495660_0000607_7437_8270 274
207 3300046810 Ga0495660_0001200 Ga0495660_0001200_4976_5809 274
208 3300046810 Ga0495660_0003765 Ga0495660_0003765_3194_4045 274
209 3300047443 Ga0495687_000813 Ga0495687_000813_23176_24012 274
210 3300047470 Ga0495681_0000637 Ga0495681_0000637_3280_4113 274
211 3300047472 Ga0495686_0036709 Ga0495686_0036709_1551_2402 274
212 3300047472 Ga0495686_0050527 Ga0495686_0050527_1056_1910 274
213 3300048927 Ga0496124_0027868 Ga0496124_0027868_3830_4684 274
214 3300048927 Ga0496124_0130512 Ga0496124_0130512_170_1024 274
215 3300049459 Ga0495678_002242 Ga0495678_002242_1253_2089 274
216 iso_pu_bacteria 2643221638 2644214083 274
217 3300002773 JGI25152J39213_1000052 JGI25152J39213_100005252 275
218 3300002774 JGI25150J39212_1007949 JGI25150J39212_10079493 275
219 3300003320 rootH2_10025735 rootH2_100257356 275
220 3300003771 Ga0055526_1001340 Ga0055526_100134018 275
221 3300003773 Ga0055537_1009392 Ga0055537_10093922 275
222 3300003775 Ga0055524_1000458 Ga0055524_10004586 275
223 3300003775 Ga0055524_1001007 Ga0055524_10010077 275
224 3300003791 Ga0055530_10001254 Ga0055530_1000125419 275
225 3300025245 Ga0207425_1000001 Ga0207425_10000011771 275
226 3300025258 Ga0209129_1000001 Ga0209129_1000001948 275
227 3300025263 Ga0209565_1000769 Ga0209565_100076911 275
228 3300025291 Ga0209675_1002613 Ga0209675_10026137 275
229 3300025295 Ga0209564_1000045 Ga0209564_10000457 275
230 3300025295 Ga0209564_1000376 Ga0209564_100037626 275
231 3300025298 Ga0209050_1000611 Ga0209050_100061120 275
232 3300025299 Ga0209256_1000972 Ga0209256_100097230 275
233 3300031239 Ga0265328_10019338 Ga0265328_100193382 275
234 3300031548 Ga0307408_100000103 Ga0307408_10000010357 275
235 3300031548 Ga0307408_100117807 Ga0307408_1001178072 275
236 3300032002 Ga0307416_100005765 Ga0307416_1000057654 275
237 3300037312 Ga0395899_0110197 Ga0395899_0110197_1033_1881 275
238 3300037471 Ga0395905_0013348 Ga0395905_0013348_5610_6455 275
239 3300037471 Ga0395905_0041544 Ga0395905_0041544_1296_2147 275
240 3300038443 Ga0395901_0001815 Ga0395901_0001815_1095_1943 275
241 3300045051 Ga0451576_0324606 Ga0451576_0324606_279_1121 275
242 3300045836 Ga0466958_0042910 Ga0466958_0042910_580_1443 275
243 3300046452 Ga0495617_000052 Ga0495617_000052_26227_27096 275
244 3300046457 Ga0495590_0056791 Ga0495590_0056791_67_957 275
245 3300046491 Ga0495584_0037503 Ga0495584_0037503_136_1008 275
246 3300046492 Ga0495585_0000005 Ga0495585_0000005_187309_188178 275
247 3300046507 Ga0495606_0005855 Ga0495606_0005855_2017_2892 275
248 3300046507 Ga0495606_0201737 Ga0495606_0201737_255_1097 275
249 3300046524 Ga0495648_0000033 Ga0495648_0000033_58394_59263 275
250 3300046528 Ga0495642_0005376 Ga0495642_0005376_1813_2664 275
251 3300046528 Ga0495642_0016539 Ga0495642_0016539_1504_2355 275
252 3300046542 Ga0495597_0074454 Ga0495597_0074454_98_949 275
253 3300046615 Ga0495656_0170193 Ga0495656_0170193_120_959 275
254 3300046616 Ga0495668_0070594 Ga0495668_0070594_452_1303 275
255 3300046665 Ga0495661_0000084 Ga0495661_0000084_23312_24190 275
256 3300046665 Ga0495661_0000534 Ga0495661_0000534_34328_35173 275
257 3300046665 Ga0495661_0008207 Ga0495661_0008207_300_1151 275
258 3300046794 Ga0495589_0091850 Ga0495589_0091850_272_1114 275
259 3300046810 Ga0495660_0023124 Ga0495660_0023124_1547_2416 275
260 3300047320 Ga0495672_0006771 Ga0495672_0006771_2819_3658 275
261 3300047443 Ga0495687_005118 Ga0495687_005118_4752_5603 275
262 3300047443 Ga0495687_013937 Ga0495687_013937_1587_2438 275
263 3300048091 Ga0495626_0000362 Ga0495626_0000362_42099_42944 275
264 3300048927 Ga0496124_0093805 Ga0496124_0093805_869_1705 275
265 3300049459 Ga0495678_000155 Ga0495678_000155_46946_47785 275
266 iso_pu_bacteria 2808606418 2809146928 275
267 3300009551 Ga0105238_10585449 Ga0105238_105854491 276
268 3300025231 Ga0207427_100530 Ga0207427_10053017 276
269 3300046491 Ga0495584_0112118 Ga0495584_0112118_509_1366 276
270 3300046492 Ga0495585_0000221 Ga0495585_0000221_20038_20895 276
271 3300048911 Ga0496108_0152852 Ga0496108_0152852_923_1777 276
272 3300002739 JGI25158J39367_1001417 JGI25158J39367_10014173 277
273 3300002987 JGI25159J45721_1002819 JGI25159J45721_10028195 277
274 3300003354 JGI25160J50197_1004044 JGI25160J50197_10040445 277
275 3300003374 JGI25161J50226_1000781 JGI25161J50226_100078111 277
276 3300003771 Ga0055526_1036919 Ga0055526_10369192 277
277 3300003773 Ga0055537_1007927 Ga0055537_10079271 277
278 3300003775 Ga0055524_1001498 Ga0055524_100149813 277
279 3300003784 Ga0055534_1002951 Ga0055534_10029512 277
280 3300003790 Ga0055528_1001000 Ga0055528_100100021 277
281 3300003791 Ga0055530_10001714 Ga0055530_1000171416 277
282 3300003794 Ga0055531_10002167 Ga0055531_100021673 277
283 3300004625 Ga0055543_1000266 Ga0055543_100026619 277
284 3300005262 Ga0065165_1000877 Ga0065165_100087719 277
285 3300025208 Ga0209436_100552 Ga0209436_1005527 277
286 3300025208 Ga0209436_100706 Ga0209436_10070620 277
287 3300025245 Ga0207425_1000225 Ga0207425_10002255 277
288 3300025245 Ga0207425_1000992 Ga0207425_10009922 277
289 3300025258 Ga0209129_1001784 Ga0209129_10017845 277
290 3300025263 Ga0209565_1000525 Ga0209565_100052511 277
291 3300025263 Ga0209565_1003286 Ga0209565_10032865 277
292 3300025284 Ga0209130_1000365 Ga0209130_100036520 277
293 3300025284 Ga0209130_1001610 Ga0209130_10016106 277
294 3300025284 Ga0209130_1002369 Ga0209130_10023695 277
295 3300025291 Ga0209675_1001170 Ga0209675_10011702 277
296 3300025295 Ga0209564_1002236 Ga0209564_100223619 277
297 3300025298 Ga0209050_1000446 Ga0209050_100044655 277
298 3300025299 Ga0209256_1000872 Ga0209256_100087212 277
299 3300025302 Ga0207426_1001676 Ga0207426_100167613 277
300 3300025304 Ga0209257_1000107 Ga0209257_100010731 277
301 3300031548 Ga0307408_100005799 Ga0307408_1000057995 277
302 3300031548 Ga0307408_100007817 Ga0307408_1000078172 277
303 3300037418 Ga0395900_0118388 Ga0395900_0118388_1072_1959 277
304 3300037466 Ga0395898_0390057 Ga0395898_0390057_129_1016 277
305 3300038443 Ga0395901_0004538 Ga0395901_0004538_2726_3613 277
306 3300048091 Ga0495626_0000630 Ga0495626_0000630_1265_2152 277
307 3300048091 Ga0495626_0000775 Ga0495626_0000775_8963_9850 277
308 3300048928 Ga0496125_0027013 Ga0496125_0027013_2860_3762 277
309 3300049665 Ga0501227_011839 Ga0501227_011839_111_950 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

30

210

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m2h-assembly1.cif.gz_A sir2 homologue s24a mutant-adp ribose complex 0.847 9 276
1m2j-assembly1.cif.gz_A sir2 homologue h80n mutant-adp ribose complex 0.8466 9 276
1m2k-assembly1.cif.gz_A sir2 homologue f159a mutant-adp ribose complex 0.8456 9 276
1ici-assembly1.cif.gz_A crystal structure of a sir2 homolog-nad complex 0.8302 9 276
1m2h-assembly1.cif.gz_A sir2 homologue s24a mutant-adp ribose complex 0.8132 9 276
ID Description Score Start End Superfamily
af_P9WGG3_3_225_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8335 20 265 3.40.50.1220
af_P9WGG3_3_225_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8201 20 265 3.40.50.1220
af_Q2G148_14_290_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8122 6 267 3.40.50.1220
af_Q9USN7_15_283_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8053 3 275 3.40.50.1220
af_A0A1D8PHV4_293_564_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7863 9 270 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A0Q7X7M4-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 1 1 274 GO:0017136
GO:0046872
GO:0070403
AF-A0A257FQB6-F1-model_v4 deleted 0.9929 5 276
AF-J7J456-F1-model_v4 deleted 0.992 1 220
AF-C4KT11-F1-model_v4 deleted 0.9918 10 209
AF-A0A430HN61-F1-model_v4 NAD-dependent deacetylase 0.9915 4 277 GO:0017136
GO:0046872
GO:0070403

Feature Viewer

pLDDT pTM Quality
95.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map