F400341

General Info

Members Datasets Scaffolds Average Seq Length
309 207 267 224

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0000001|Ga0466959_0000001_272191_272871
Length 226
Sequence MSFNKTKTDPVLGQEIHKHLLSLGIETPTIDNGLTIKQKVSKIEKHFKSIMETLGLDLTDDSLSETPLRVAKMYCSEIFWGLDPENFPKCTTVDNKMLYNQMLVEEDITIKSFCEHHALPIIGVATVAYIPNQKVLGLSKLNRICEYFSRRPQIQERLTEQIFHALKHILGTDNVAVMIDGAHTCVSMRGVEDETSRTTTSKLGGDFKENPMVRAEFMQIATRIRK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
12 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
13 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
14 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
15 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
16 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
17 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
18 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2738541284 Pedobacter sp. YR016 Isolate Unclassified
21 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
22 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
23 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
24 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
25 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
26 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
27 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
28 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
29 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
30 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
31 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
32 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
33 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
34 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
35 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
36 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
37 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
38 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
39 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
40 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
41 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
42 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
43 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
44 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
45 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
46 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
182 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
191 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
192 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.14
Metatranscriptomes 1.94
Isolates 13.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 7.44
Nodule 0.32
Rhizoplane 0.65
Rhizosphere 76.05
Stem 0
Stem Tuber 0
Unclassified 14.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1043338 2162886007 Bacteria 1768
2 SwRhRL2b_contig_1218049 2162886007 Bacteria 1721
3 SwRhRL2b_contig_493616 2162886007 Bacteria 15810
4 JGI24741J21665_1002211 3300001915 Bacteria 5163
5 JGI24741J21665_1017277 3300001915 Bacteria 1167
6 JGI25162J39368_1000173 3300002737 Bacteria 69607
7 JGI25162J39368_1000929 3300002737 Bacteria 18819
8 JGI25164J39214_1001715 3300002772 Bacteria 4417
9 JGI25165J46597_1002022 3300003214 Bacteria 7721
10 rootH1_10008383 3300003316 Bacteria 4246
11 rootH1_10008383 3300003323 Bacteria 2245
12 rootH2_10016497 3300003320 Bacteria 15383
13 rootH2_10039028 3300003320 Bacteria 3118
14 rootH2_10078616 3300003320 Bacteria 1934
15 rootL2_10039178 3300003322 Bacteria 4477
16 rootL2_10282992 3300003322 Bacteria 1260
17 rootH1_10018051 3300003323 Bacteria 8284
18 rootH1_10032442 3300003323 Bacteria 6027
19 rootH1_10037343 3300003323 Bacteria 2008
20 rootH1_10067883 3300003323 Bacteria 2395
21 rootH1_10067884 3300003323 Bacteria 1114
22 rootH1_10143935 3300003323 Bacteria 1379
23 Ga0055534_1026535 3300003784 Bacteria 920
24 Ga0058863_10147782 3300004799 Bacteria 2081
25 Ga0058862_10014128 3300004803 Bacteria 1444
26 Ga0065165_1001338 3300005262 Bacteria 27345
27 Ga0065714_10064455 3300005288 Bacteria 72722
28 Ga0065714_10067323 3300005288 Bacteria 5655
29 Ga0065714_10073029 3300005288 Bacteria 3256
30 Ga0065704_10000193 3300005289 Bacteria 203271
31 Ga0065704_10079841 3300005289 Bacteria 4051
32 Ga0065704_10116621 3300005289 Bacteria 1850
33 Ga0070658_10061151 3300005327 Bacteria 3068
34 Ga0070658_10194722 3300005327 Bacteria 1709
35 Ga0070658_10222987 3300005327 Bacteria 1595
36 Ga0070683_100004016 3300005329 Bacteria 12045
37 Ga0070680_100046359 3300005336 Bacteria 3536
38 Ga0070682_100001276 3300005337 Bacteria 14283
39 Ga0070660_100063853 3300005339 Bacteria 2863
40 Ga0070668_100049616 3300005347 Bacteria 3229
41 Ga0070668_100131167 3300005347 Bacteria 2012
42 Ga0070669_100110056 3300005353 Bacteria 2089
43 Ga0070673_100818798 3300005364 Unclassified 860
44 Ga0070713_100030371 3300005436 Bacteria 4291
45 Ga0070663_100019282 3300005455 Bacteria 4492
46 Ga0070663_100264426 3300005455 Bacteria 1365
47 Ga0070681_10038297 3300005458 Bacteria 4808
48 Ga0070684_100004401 3300005535 Bacteria 10717
49 Ga0068854_100247371 3300005578 Unclassified 1422
50 Ga0068856_100004615 3300005614 Bacteria 13688
51 Ga0068856_100007721 3300005614 Bacteria 10502
52 Ga0068856_100044610 3300005614 Bacteria 4364
53 Ga0068856_100045503 3300005614 Bacteria 4322
54 Ga0068852_100223866 3300005616 Unclassified 1790
55 Ga0068859_100025296 3300005617 Bacteria 5955
56 Ga0068862_100010249 3300005844 Bacteria 7733
57 Ga0070717_10272589 3300006028 Bacteria 1499
58 Ga0075428_100035633 3300006844 Bacteria 5485
59 Ga0097620_100025296 3300006931 Bacteria 5955
60 Ga0105244_10000160 3300009036 Bacteria 69914
61 Ga0105250_10041406 3300009092 Bacteria 1847
62 Ga0105240_10000221 3300009093 Bacteria 114656
63 Ga0105240_10080239 3300009093 Bacteria 4013
64 Ga0105240_10376296 3300009093 Bacteria 1604
65 Ga0111539_10029175 3300009094 Bacteria 6725
66 Ga0111539_10242343 3300009094 Bacteria 2099
67 Ga0105243_10000734 3300009148 Bacteria 31383
68 Ga0105243_10106215 3300009148 Bacteria 2340
69 Ga0105241_10007010 3300009174 Bacteria 8291
70 Ga0105237_10000227 3300009545 Bacteria 79785
71 Ga0105237_10002671 3300009545 Bacteria 21891
72 Ga0105238_10082106 3300009551 Unclassified 3213
73 Ga0105249_11473712 3300009553 Bacteria 753
74 Ga0105239_10002046 3300010375 Bacteria 26161
75 Ga0105239_10004316 3300010375 Bacteria 17046
76 Ga0157373_10000006 3300013100 Bacteria 261768
77 Ga0157373_10000136 3300013100 Bacteria 57912
78 Ga0157373_10610257 3300013100 Bacteria 795
79 Ga0157371_10001805 3300013102 Bacteria 21630
80 Ga0157371_10010674 3300013102 Bacteria 7133
81 Ga0157371_10078651 3300013102 Bacteria 2336
82 Ga0157371_10100353 3300013102 Bacteria 2053
83 Ga0157370_10002846 3300013104 Bacteria 20668
84 Ga0157370_10009886 3300013104 Bacteria 10110
85 Ga0157370_10012813 3300013104 Bacteria 8668
86 Ga0157370_10033056 3300013104 Bacteria 5045
87 Ga0157370_10050905 3300013104 Bacteria 3957
88 Ga0157370_10085812 3300013104 Bacteria 2958
89 Ga0157370_10093408 3300013104 Bacteria 2823
90 Ga0157370_10119303 3300013104 Bacteria 2463
91 Ga0157370_10607933 3300013104 Bacteria 1001
92 Ga0157369_10000224 3300013105 Bacteria 78178
93 Ga0157369_10002231 3300013105 Bacteria 23333
94 Ga0157369_10036682 3300013105 Bacteria 5370
95 Ga0163162_10000285 3300013306 Bacteria 46149
96 Ga0163162_10602532 3300013306 Bacteria 1225
97 Ga0157372_10000037 3300013307 Bacteria 172444
98 Ga0157372_10000410 3300013307 Bacteria 47006
99 Ga0157372_10132576 3300013307 Bacteria 2868
100 Ga0157372_10219941 3300013307 Bacteria 2201
101 Ga0157375_10000209 3300013308 Bacteria 54570
102 Ga0163163_10846402 3300014325 Unclassified 978
103 Ga0157380_10007778 3300014326 Bacteria 7628
104 Ga0182008_10000003 3300014497 Bacteria 456880
105 Ga0182008_10000018 3300014497 Bacteria 230609
106 Ga0182006_1000001 3300015261 Bacteria 1091090
107 Ga0182006_1009979 3300015261 Bacteria 4242
108 Ga0163161_10008390 3300017792 Bacteria 7151
109 Ga0207427_100043 3300025231 Bacteria 249595
110 Ga0209437_100170 3300025233 Bacteria 142489
111 Ga0209437_100299 3300025233 Bacteria 69659
112 Ga0209026_1005989 3300025250 Bacteria 3106
113 Ga0209233_1000349 3300025261 Bacteria 43702
114 Ga0209455_1004533 3300025272 Bacteria 4514
115 Ga0209455_1006724 3300025272 Bacteria 3356
116 Ga0209675_1003045 3300025291 Bacteria 8225
117 Ga0209676_1000495 3300025292 Bacteria 63184
118 Ga0207696_1025593 3300025711 Bacteria 1837
119 Ga0207655_1000016 3300025728 Bacteria 551476
120 Ga0207705_10142773 3300025909 Bacteria 1789
121 Ga0207705_10167965 3300025909 Bacteria 1651
122 Ga0207707_10016063 3300025912 Bacteria 6529
123 Ga0207695_10000189 3300025913 Bacteria 177142
124 Ga0207695_10259556 3300025913 Bacteria 1635
125 Ga0207671_10000515 3300025914 Bacteria 52421
126 Ga0207671_10002083 3300025914 Bacteria 21886
127 Ga0207660_10033747 3300025917 Bacteria 3543
128 Ga0207652_10007595 3300025921 Bacteria 8730
129 Ga0207700_10008148 3300025928 Bacteria 6471
130 Ga0207709_10000355 3300025935 Bacteria 46675
131 Ga0207709_10174324 3300025935 Bacteria 1512
132 Ga0207661_10053096 3300025944 Bacteria 3241
133 Ga0207667_10492967 3300025949 Bacteria 1243
134 Ga0207712_10038133 3300025961 Bacteria 3284
135 Ga0207668_10095824 3300025972 Bacteria 2191
136 Ga0207668_10096611 3300025972 Bacteria 2184
137 Ga0207678_10047465 3300026067 Bacteria 3714
138 Ga0207678_10432893 3300026067 Bacteria 1142
139 Ga0207702_10057375 3300026078 Bacteria 3309
140 Ga0207698_10191560 3300026142 Unclassified 1822
141 Ga0268265_10011287 3300028380 Bacteria 6039
142 Ga0307515_10037470 3300028794 Bacteria 7798
143 Ga0265338_10082101 3300028800 Bacteria 2700
144 Ga0265324_10111918 3300029957 Bacteria 927
145 Ga0265327_10001894 3300031251 Bacteria 24216
146 Ga0265327_10019753 3300031251 Bacteria 4130
147 Ga0307509_10143410 3300031507 Unclassified 2319
148 Ga0316576_10181659 3300031727 Bacteria 1587
149 Ga0307516_10251447 3300031730 Bacteria 1462
150 Ga0307412_10000036 3300031911 Bacteria 192270
151 Ga0307412_10000077 3300031911 Bacteria 96375
152 Ga0307412_10009055 3300031911 Bacteria 5704
153 Ga0307412_10197665 3300031911 Bacteria 1525
154 Ga0307416_100000006 3300032002 Bacteria 466074
155 Ga0307416_100364409 3300032002 Bacteria 1469
156 Ga0307414_10000043 3300032004 Bacteria 137764
157 Ga0307414_10009225 3300032004 Bacteria 5654
158 Ga0307414_10037854 3300032004 Bacteria 3234
159 Ga0307414_10098717 3300032004 Bacteria 2192
160 Ga0307414_10124647 3300032004 Bacteria 1988
161 Ga0307414_10160365 3300032004 Bacteria 1785
162 Ga0307414_10797517 3300032004 Bacteria 861
163 Ga0316585_10036182 3300032137 Bacteria 1565
164 Ga0316574_0368167 3300035398 Bacteria 908
165 Ga0316584_0021498 3300036712 Bacteria 4690
166 Ga0316584_0187221 3300036712 Bacteria 1531
167 Ga0316584_0306038 3300036712 Unclassified 1150
168 Ga0395899_0000180 3300037312 Bacteria 92701
169 Ga0395899_0052222 3300037312 Bacteria 3031
170 Ga0395900_0000122 3300037418 Bacteria 133423
171 Ga0395900_0008411 3300037418 Bacteria 10619
172 Ga0395900_0721173 3300037418 Bacteria 929
173 Ga0395898_0059552 3300037466 Bacteria 3714
174 Ga0395905_0001611 3300037471 Bacteria 26826
175 Ga0395905_0021935 3300037471 Bacteria 6040
176 Ga0395901_0001566 3300038443 Bacteria 23712
177 Ga0395901_0134334 3300038443 Bacteria 2600
178 Ga0439466_0013706 3300041411 Bacteria 2964
179 Ga0451797_0615602 3300041453 Bacteria 1041
180 Ga0439445_0003202 3300042004 Bacteria 3670
181 Ga0439445_0059475 3300042004 Bacteria 1043
182 Ga0466982_0155050 3300044672 Bacteria 1399
183 Ga0453683_0011789 3300044673 Bacteria 5756
184 Ga0466966_0019426 3300044684 Bacteria 4469
185 Ga0466961_0000001 3300044693 Bacteria 290322
186 Ga0466961_0083334 3300044693 Bacteria 2022
187 Ga0453684_0003191 3300044712 Bacteria 37570
188 Ga0453684_0017716 3300044712 Bacteria 11003
189 Ga0453684_0256283 3300044712 Unclassified 2006
190 Ga0453684_0351065 3300044712 Unclassified 1663
191 Ga0466959_0000001 3300045049 Bacteria 523572
192 Ga0466959_0063611 3300045049 Bacteria 2679
193 Ga0451576_0009056 3300045051 Bacteria 11591
194 Ga0451576_0053481 3300045051 Bacteria 4230
195 Ga0451576_0178596 3300045051 Bacteria 2216
196 Ga0495627_000081 3300046453 Bacteria 116262
197 Ga0495596_0002543 3300046500 Bacteria 9747
198 Ga0495606_0003773 3300046507 Bacteria 15747
199 Ga0495606_0050953 3300046507 Bacteria 2703
200 Ga0495606_0115180 3300046507 Bacteria 1616
201 Ga0495606_0337708 3300046507 Bacteria 804
202 Ga0495610_0000005 3300046512 Bacteria 924111
203 Ga0495610_0040907 3300046512 Bacteria 2331
204 Ga0495631_0075174 3300046518 Bacteria 1458
205 Ga0495632_0002129 3300046519 Bacteria 15416
206 Ga0495643_0004112 3300046522 Bacteria 10346
207 Ga0495644_0019481 3300046523 Bacteria 2591
208 Ga0495663_0000680 3300046525 Bacteria 11726
209 Ga0495663_0005383 3300046525 Bacteria 3552
210 Ga0495654_0000003 3300046530 Bacteria 863485
211 Ga0495609_0000311 3300046538 Bacteria 43792
212 Ga0495633_0000114 3300046558 Bacteria 108708
213 Ga0495633_0031288 3300046558 Bacteria 2582
214 Ga0495625_0002476 3300046660 Bacteria 19910
215 Ga0495661_0002083 3300046665 Bacteria 15695
216 Ga0495661_0191485 3300046665 Bacteria 1077
217 Ga0495677_0018237 3300047445 Bacteria 2544
218 Ga0495686_0000133 3300047472 Bacteria 151597
219 Ga0495686_0062493 3300047472 Bacteria 2310
220 Ga0496102_0106409 3300048905 Bacteria 2610
221 Ga0496116_0000029 3300048919 Bacteria 422187
222 Ga0496117_0000007 3300048920 Bacteria 720505
223 Ga0496118_0015187 3300048921 Bacteria 7150
224 Ga0496119_0000007 3300048922 Bacteria 475920
225 Ga0496121_0174253 3300048924 Bacteria 1559
226 Ga0496122_0000946 3300048925 Bacteria 52631
227 Ga0496122_0001893 3300048925 Bacteria 31687
228 Ga0496122_0001900 3300048925 Bacteria 31591
229 Ga0496122_0001976 3300048925 Bacteria 30631
230 Ga0496122_0002061 3300048925 Bacteria 29808
231 Ga0496123_0001726 3300048926 Bacteria 29009
232 Ga0496123_0039399 3300048926 Bacteria 3306
233 Ga0496124_0001116 3300048927 Bacteria 42242
234 Ga0496124_0120543 3300048927 Bacteria 2096
235 Ga0496125_0001777 3300048928 Bacteria 29790
236 Ga0496125_0017671 3300048928 Bacteria 6790
237 Ga0496125_0038759 3300048928 Bacteria 4116
238 Ga0496126_0004748 3300048929 Bacteria 16022
239 Ga0501305_008734 3300049161 Bacteria 1317
240 Ga0501300_009399 3300049523 Bacteria 1426
241 Ga0501315_003985 3300049531 Bacteria 1514
242 Ga0501315_007848 3300049531 Bacteria 1226
243 Ga0501034_0154333 3300049571 Bacteria 2270
244 Ga0501202_022956 3300049652 Bacteria 1256
245 Ga0501209_019465 3300049656 Bacteria 1585
246 Ga0501217_030659 3300049661 Bacteria 1321
247 Ga0501222_004839 3300049662 Bacteria 1830
248 Ga0501223_000517 3300049663 Bacteria 9302
249 Ga0501235_015576 3300049669 Bacteria 1677
250 Ga0501239_007681 3300049672 Bacteria 1135
251 Ga0501242_016748 3300049674 Bacteria 920
252 Ga0501247_018774 3300049677 Bacteria 885
253 Ga0501257_001930 3300049686 Bacteria 4317
254 Ga0501225_0024089 3300049705 Bacteria 1676
255 Ga0501241_005117 3300049758 Bacteria 2449
256 nmdc:mga0k408_309871_c1 3300050493 Unclassified 942
257 nmdc:mga0qj67_43513_c1 3300050509 Bacteria 3536
258 Ga0500647_0042598 3300053091 Bacteria 2180
259 Ga0500651_0000218 3300053093 Bacteria 35905
260 Ga0500618_005975 3300053125 Bacteria 3630
261 Ga0500568_0039819 3300053139 Bacteria 1895
262 Ga0500604_0002020 3300053151 Bacteria 5607
263 Ga0500622_0000003 3300053156 Bacteria 613483
264 Ga0500622_0000062 3300053156 Bacteria 130392
265 Ga0500645_097602 3300053730 Bacteria 830
266 Ga0587062_007733 3300059639 Bacteria 1263
267 Ga0466962_0284155 3300061719 Bacteria 817

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0154333 Ga0501034_0154333_23_634 197
2 3300045051 Ga0451576_0178596 Ga0451576_0178596_51_653 200
3 3300036712 Ga0316584_0187221 Ga0316584_0187221_704_1309 201
4 3300028794 Ga0307515_10037470 Ga0307515_100374708 203
5 iso_pu_bacteria 8036736890 8036738239 207
6 3300032002 Ga0307416_100364409 Ga0307416_1003644091 210
7 3300044672 Ga0466982_0155050 Ga0466982_0155050_106_738 210
8 iso_pu_bacteria 2511231000 2511231034 210
9 iso_pu_bacteria 2523533629 2524005402 210
10 iso_pu_bacteria 2582581278 2585143661 210
11 iso_pu_bacteria 2582581281 2585156498 210
12 iso_pu_bacteria 2582581282 2585160851 210
13 iso_pu_bacteria 2585428045 2587680049 210
14 iso_pu_bacteria 2585428060 2587748705 210
15 iso_pu_bacteria 2585428115 2587945382 210
16 iso_pu_bacteria 2585428182 2588211564 210
17 iso_pu_bacteria 2585428183 2588215948 210
18 iso_pu_bacteria 2585428184 2588219370 210
19 iso_pu_bacteria 2585428185 2588224852 210
20 iso_pu_bacteria 2585428187 2588234684 210
21 iso_pu_bacteria 2588253712 2588447639 210
22 iso_pu_bacteria 2588254255 2590603269 210
23 iso_pu_bacteria 2588254257 2590610282 210
24 iso_pu_bacteria 2728369107 2729200688 210
25 iso_pu_bacteria 2739367874 2740060502 210
26 iso_pu_bacteria 2751185877 2753674272 210
27 iso_pu_bacteria 2765235839 2765575760 210
28 iso_pu_bacteria 2772190705 2772606101 210
29 iso_pu_bacteria 2816332188 2816875599 210
30 iso_pu_bacteria 2842083920 2842086328 210
31 iso_pu_bacteria 2871720351 2871723680 210
32 iso_pu_bacteria 2889290771 2889293744 210
33 iso_pu_bacteria 2905999023 2906001109 210
34 iso_pu_bacteria 2919399522 2919403121 210
35 iso_pu_bacteria 2945924605 2945924729 210
36 iso_pu_bacteria 2946019816 2946024155 210
37 iso_pu_bacteria 2977243572 2977247681 210
38 iso_pu_bacteria 2984572630 2984574516 210
39 iso_pu_bacteria 2984606641 2984607967 210
40 iso_pu_bacteria 2993372514 2993375023 210
41 iso_pu_bacteria 2993480792 2993481887 210
42 iso_pu_bacteria 2857627736 2857628564 211
43 3300031507 Ga0307509_10143410 Ga0307509_101434101 213
44 iso_pu_bacteria 2739367866 2740031268 213
45 2162886007 SwRhRL2b_contig_1218049 SwRhRL2b_0182.00004930 214
46 3300001915 JGI24741J21665_1002211 JGI24741J21665_10022115 214
47 3300003320 rootH2_10078616 rootH2_100786162 214
48 3300003322 rootL2_10282992 rootL2_102829921 214
49 3300003784 Ga0055534_1026535 Ga0055534_10265351 214
50 3300005288 Ga0065714_10067323 Ga0065714_100673234 214
51 3300005289 Ga0065704_10079841 Ga0065704_100798414 214
52 3300005327 Ga0070658_10061151 Ga0070658_100611512 214
53 3300005329 Ga0070683_100004016 Ga0070683_1000040165 214
54 3300005337 Ga0070682_100001276 Ga0070682_1000012763 214
55 3300005339 Ga0070660_100063853 Ga0070660_1000638532 214
56 3300005347 Ga0070668_100049616 Ga0070668_1000496162 214
57 3300005347 Ga0070668_100131167 Ga0070668_1001311673 214
58 3300005353 Ga0070669_100110056 Ga0070669_1001100563 214
59 3300005455 Ga0070663_100264426 Ga0070663_1002644262 214
60 3300005535 Ga0070684_100004401 Ga0070684_1000044014 214
61 3300009036 Ga0105244_10000160 Ga0105244_1000016067 214
62 3300009092 Ga0105250_10041406 Ga0105250_100414062 214
63 3300009148 Ga0105243_10000734 Ga0105243_1000073425 214
64 3300009148 Ga0105243_10106215 Ga0105243_101062153 214
65 3300013100 Ga0157373_10000006 Ga0157373_1000000660 214
66 3300013100 Ga0157373_10610257 Ga0157373_106102571 214
67 3300013102 Ga0157371_10001805 Ga0157371_100018057 214
68 3300013104 Ga0157370_10002846 Ga0157370_1000284611 214
69 3300013104 Ga0157370_10033056 Ga0157370_100330564 214
70 3300013104 Ga0157370_10050905 Ga0157370_100509053 214
71 3300013104 Ga0157370_10085812 Ga0157370_100858122 214
72 3300013104 Ga0157370_10119303 Ga0157370_101193032 214
73 3300013105 Ga0157369_10000224 Ga0157369_1000022452 214
74 3300013105 Ga0157369_10002231 Ga0157369_100022315 214
75 3300013105 Ga0157369_10036682 Ga0157369_100366822 214
76 3300013307 Ga0157372_10000037 Ga0157372_1000003784 214
77 3300015261 Ga0182006_1000001 Ga0182006_1000001924 214
78 3300017792 Ga0163161_10008390 Ga0163161_100083903 214
79 3300025291 Ga0209675_1003045 Ga0209675_10030454 214
80 3300025711 Ga0207696_1025593 Ga0207696_10255931 214
81 3300025728 Ga0207655_1000016 Ga0207655_1000016512 214
82 3300025935 Ga0207709_10000355 Ga0207709_100003553 214
83 3300025935 Ga0207709_10174324 Ga0207709_101743241 214
84 3300025944 Ga0207661_10053096 Ga0207661_100530962 214
85 3300025949 Ga0207667_10492967 Ga0207667_104929671 214
86 3300025961 Ga0207712_10038133 Ga0207712_100381331 214
87 3300025972 Ga0207668_10095824 Ga0207668_100958243 214
88 3300025972 Ga0207668_10096611 Ga0207668_100966112 214
89 3300026067 Ga0207678_10432893 Ga0207678_104328931 214
90 3300031911 Ga0307412_10000036 Ga0307412_10000036136 214
91 3300031911 Ga0307412_10197665 Ga0307412_101976652 214
92 3300032002 Ga0307416_100000006 Ga0307416_10000000618 214
93 3300032004 Ga0307414_10000043 Ga0307414_1000004338 214
94 3300032004 Ga0307414_10037854 Ga0307414_100378542 214
95 3300032004 Ga0307414_10124647 Ga0307414_101246472 214
96 3300032004 Ga0307414_10160365 Ga0307414_101603652 214
97 3300041411 Ga0439466_0013706 Ga0439466_0013706_1301_1969 214
98 3300045049 Ga0466959_0063611 Ga0466959_0063611_1495_2139 214
99 3300046453 Ga0495627_000081 Ga0495627_000081_1276_1944 214
100 3300046500 Ga0495596_0002543 Ga0495596_0002543_5860_6528 214
101 3300046507 Ga0495606_0050953 Ga0495606_0050953_1823_2488 214
102 3300046507 Ga0495606_0115180 Ga0495606_0115180_326_994 214
103 3300046512 Ga0495610_0000005 Ga0495610_0000005_122746_123414 214
104 3300046519 Ga0495632_0002129 Ga0495632_0002129_1756_2424 214
105 3300046522 Ga0495643_0004112 Ga0495643_0004112_7703_8371 214
106 3300046525 Ga0495663_0000680 Ga0495663_0000680_8239_8907 214
107 3300046525 Ga0495663_0005383 Ga0495663_0005383_2600_3265 214
108 3300046530 Ga0495654_0000003 Ga0495654_0000003_753857_754525 214
109 3300046538 Ga0495609_0000311 Ga0495609_0000311_8322_8990 214
110 3300046558 Ga0495633_0000114 Ga0495633_0000114_1314_1982 214
111 3300046558 Ga0495633_0031288 Ga0495633_0031288_41_709 214
112 3300046660 Ga0495625_0002476 Ga0495625_0002476_10465_11133 214
113 3300047472 Ga0495686_0000133 Ga0495686_0000133_67136_67804 214
114 3300047472 Ga0495686_0062493 Ga0495686_0062493_325_993 214
115 3300048905 Ga0496102_0106409 Ga0496102_0106409_749_1417 214
116 3300048919 Ga0496116_0000029 Ga0496116_0000029_3155_3823 214
117 3300048920 Ga0496117_0000007 Ga0496117_0000007_2359_3027 214
118 3300048921 Ga0496118_0015187 Ga0496118_0015187_4118_4786 214
119 3300048922 Ga0496119_0000007 Ga0496119_0000007_2426_3094 214
120 3300048924 Ga0496121_0174253 Ga0496121_0174253_668_1333 214
121 3300048925 Ga0496122_0000946 Ga0496122_0000946_13726_14394 214
122 3300048925 Ga0496122_0001893 Ga0496122_0001893_3191_3856 214
123 3300048925 Ga0496122_0001900 Ga0496122_0001900_3080_3748 214
124 3300048925 Ga0496122_0001976 Ga0496122_0001976_3485_4150 214
125 3300048925 Ga0496122_0002061 Ga0496122_0002061_2426_3094 214
126 3300048926 Ga0496123_0001726 Ga0496123_0001726_25699_26364 214
127 3300048926 Ga0496123_0039399 Ga0496123_0039399_620_1288 214
128 3300048927 Ga0496124_0001116 Ga0496124_0001116_39757_40425 214
129 3300048928 Ga0496125_0001777 Ga0496125_0001777_3015_3680 214
130 3300048928 Ga0496125_0017671 Ga0496125_0017671_2337_3005 214
131 3300048929 Ga0496126_0004748 Ga0496126_0004748_13093_13761 214
132 3300049662 Ga0501222_004839 Ga0501222_004839_789_1448 214
133 3300053125 Ga0500618_005975 Ga0500618_005975_1630_2289 214
134 iso_pu_bacteria 2910245624 2910246750 214
135 iso_pu_bacteria 2919683626 2919687098 214
136 3300013104 Ga0157370_10009886 Ga0157370_100098863 215
137 3300013308 Ga0157375_10000209 Ga0157375_1000020923 216
138 3300025913 Ga0207695_10000189 Ga0207695_1000018998 216
139 3300025914 Ga0207671_10002083 Ga0207671_1000208314 216
140 3300031911 Ga0307412_10009055 Ga0307412_100090554 216
141 3300042004 Ga0439445_0003202 Ga0439445_0003202_1971_2645 216
142 3300048927 Ga0496124_0120543 Ga0496124_0120543_798_1472 216
143 3300048928 Ga0496125_0038759 Ga0496125_0038759_2214_2888 216
144 3300050493 nmdc:mga0k408_309871_c1 nmdc:mga0k408_309871_c1_266_931 216
145 3300044693 Ga0466961_0000001 Ga0466961_0000001_39966_40646 217
146 3300045049 Ga0466959_0000001 Ga0466959_0000001_272191_272871 217
147 3300049523 Ga0501300_009399 Ga0501300_009399_211_879 217
148 3300053156 Ga0500622_0000062 Ga0500622_0000062_105054_105725 217
149 3300049652 Ga0501202_022956 Ga0501202_022956_569_1228 218
150 3300049656 Ga0501209_019465 Ga0501209_019465_192_851 218
151 3300003320 rootH2_10039028 rootH2_100390283 219
152 3300003322 rootL2_10039178 rootL2_100391783 219
153 3300003323 rootH1_10032442 rootH1_100324424 219
154 3300025272 Ga0209455_1004533 Ga0209455_10045332 219
155 3300031727 Ga0316576_10181659 Ga0316576_101816592 219
156 3300032004 Ga0307414_10098717 Ga0307414_100987173 219
157 3300049669 Ga0501235_015576 Ga0501235_015576_204_878 219
158 3300003323 rootH1_10037343 rootH1_100373433 220
159 3300025272 Ga0209455_1006724 Ga0209455_10067244 220
160 3300044712 Ga0453684_0003191 Ga0453684_0003191_11811_12476 220
161 3300045051 Ga0451576_0053481 Ga0451576_0053481_2707_3372 220
162 3300046518 Ga0495631_0075174 Ga0495631_0075174_224_886 220
163 3300046665 Ga0495661_0191485 Ga0495661_0191485_398_1060 220
164 3300004799 Ga0058863_10147782 Ga0058863_101477823 221
165 3300004803 Ga0058862_10014128 Ga0058862_100141282 221
166 3300005327 Ga0070658_10194722 Ga0070658_101947221 221
167 3300005327 Ga0070658_10222987 Ga0070658_102229872 221
168 3300005336 Ga0070680_100046359 Ga0070680_1000463593 221
169 3300005458 Ga0070681_10038297 Ga0070681_100382975 221
170 3300005616 Ga0068852_100223866 Ga0068852_1002238662 221
171 3300009093 Ga0105240_10080239 Ga0105240_100802394 221
172 3300025909 Ga0207705_10142773 Ga0207705_101427733 221
173 3300025909 Ga0207705_10167965 Ga0207705_101679652 221
174 3300025912 Ga0207707_10016063 Ga0207707_100160637 221
175 3300025917 Ga0207660_10033747 Ga0207660_100337473 221
176 3300025921 Ga0207652_10007595 Ga0207652_100075957 221
177 3300026142 Ga0207698_10191560 Ga0207698_101915602 221
178 3300003323 rootH1_10067883 rootH1_100678833 222
179 3300003323 rootH1_10067884 rootH1_100678842 222
180 3300005262 Ga0065165_1001338 Ga0065165_100133816 222
181 3300005578 Ga0068854_100247371 Ga0068854_1002473712 222
182 3300009093 Ga0105240_10000221 Ga0105240_1000022113 222
183 3300009174 Ga0105241_10007010 Ga0105241_100070105 222
184 3300009545 Ga0105237_10002671 Ga0105237_1000267113 222
185 3300010375 Ga0105239_10004316 Ga0105239_1000431611 222
186 3300014497 Ga0182008_10000003 Ga0182008_10000003232 222
187 3300031730 Ga0307516_10251447 Ga0307516_102514473 222
188 iso_pu_bacteria 2522125168 2522551480 222
189 3300005614 Ga0068856_100004615 Ga0068856_10000461511 223
190 3300005614 Ga0068856_100045503 Ga0068856_1000455032 223
191 3300026078 Ga0207702_10057375 Ga0207702_100573754 223
192 3300036712 Ga0316584_0306038 Ga0316584_0306038_314_988 223
193 3300037312 Ga0395899_0052222 Ga0395899_0052222_873_1544 223
194 3300037418 Ga0395900_0000122 Ga0395900_0000122_14264_14935 223
195 3300037418 Ga0395900_0008411 Ga0395900_0008411_1313_1984 223
196 3300037466 Ga0395898_0059552 Ga0395898_0059552_959_1630 223
197 3300037471 Ga0395905_0001611 Ga0395905_0001611_21935_22606 223
198 3300038443 Ga0395901_0134334 Ga0395901_0134334_290_961 223
199 3300001915 JGI24741J21665_1017277 JGI24741J21665_10172772 224
200 3300003316 rootH1_10008383 rootH1_100083834 224
201 3300003320 rootH2_10016497 rootH2_1001649714 224
202 3300003323 rootH1_10018051 rootH1_100180513 224
203 3300005455 Ga0070663_100019282 Ga0070663_1000192822 224
204 3300006028 Ga0070717_10272589 Ga0070717_102725892 224
205 3300006844 Ga0075428_100035633 Ga0075428_1000356336 224
206 3300009094 Ga0111539_10029175 Ga0111539_100291753 224
207 3300009094 Ga0111539_10242343 Ga0111539_102423431 224
208 3300014326 Ga0157380_10007778 Ga0157380_100077785 224
209 3300026067 Ga0207678_10047465 Ga0207678_100474652 224
210 3300031251 Ga0265327_10019753 Ga0265327_100197533 224
211 3300032137 Ga0316585_10036182 Ga0316585_100361822 224
212 3300035398 Ga0316574_0368167 Ga0316574_0368167_113_811 224
213 3300036712 Ga0316584_0021498 Ga0316584_0021498_3124_3801 224
214 3300037312 Ga0395899_0000180 Ga0395899_0000180_30149_30823 224
215 3300037418 Ga0395900_0721173 Ga0395900_0721173_131_805 224
216 3300041453 Ga0451797_0615602 Ga0451797_0615602_236_928 224
217 3300042004 Ga0439445_0059475 Ga0439445_0059475_154_843 224
218 3300044684 Ga0466966_0019426 Ga0466966_0019426_1286_1960 224
219 3300044693 Ga0466961_0083334 Ga0466961_0083334_974_1648 224
220 3300044712 Ga0453684_0017716 Ga0453684_0017716_5699_6388 224
221 3300049661 Ga0501217_030659 Ga0501217_030659_345_1034 224
222 3300049677 Ga0501247_018774 Ga0501247_018774_147_836 224
223 3300050509 nmdc:mga0qj67_43513_c1 nmdc:mga0qj67_43513_c1_493_1182 224
224 3300053151 Ga0500604_0002020 Ga0500604_0002020_4498_5190 224
225 3300053156 Ga0500622_0000003 Ga0500622_0000003_26407_27099 224
226 3300061719 Ga0466962_0284155 Ga0466962_0284155_43_717 224
227 3300002737 JGI25162J39368_1000173 JGI25162J39368_100017345 225
228 3300009093 Ga0105240_10376296 Ga0105240_103762963 225
229 3300009545 Ga0105237_10000227 Ga0105237_1000022745 225
230 3300009551 Ga0105238_10082106 Ga0105238_100821064 225
231 3300010375 Ga0105239_10002046 Ga0105239_1000204624 225
232 3300013102 Ga0157371_10100353 Ga0157371_101003531 225
233 3300013307 Ga0157372_10000410 Ga0157372_1000041023 225
234 3300025233 Ga0209437_100299 Ga0209437_10029944 225
235 3300025914 Ga0207671_10000515 Ga0207671_1000051517 225
236 3300044673 Ga0453683_0011789 Ga0453683_0011789_2529_3221 225
237 3300044712 Ga0453684_0351065 Ga0453684_0351065_239_931 225
238 3300045051 Ga0451576_0009056 Ga0451576_0009056_1356_2048 225
239 3300049161 Ga0501305_008734 Ga0501305_008734_435_1127 225
240 3300049531 Ga0501315_003985 Ga0501315_003985_359_1051 225
241 3300049531 Ga0501315_007848 Ga0501315_007848_433_1125 225
242 3300049674 Ga0501242_016748 Ga0501242_016748_75_767 225
243 3300049686 Ga0501257_001930 Ga0501257_001930_2308_3000 225
244 3300002737 JGI25162J39368_1000929 JGI25162J39368_10009297 226
245 3300002772 JGI25164J39214_1001715 JGI25164J39214_10017153 226
246 3300003214 JGI25165J46597_1002022 JGI25165J46597_10020227 226
247 3300013104 Ga0157370_10093408 Ga0157370_100934082 226
248 3300013104 Ga0157370_10607933 Ga0157370_106079332 226
249 3300013306 Ga0163162_10000285 Ga0163162_1000028533 226
250 3300025231 Ga0207427_100043 Ga0207427_10004395 226
251 3300025233 Ga0209437_100170 Ga0209437_10017025 226
252 3300025250 Ga0209026_1005989 Ga0209026_10059894 226
253 3300025261 Ga0209233_1000349 Ga0209233_100034940 226
254 3300025292 Ga0209676_1000495 Ga0209676_100049549 226
255 3300032004 Ga0307414_10797517 Ga0307414_107975171 226
256 3300046507 Ga0495606_0003773 Ga0495606_0003773_9710_10393 226
257 3300046507 Ga0495606_0337708 Ga0495606_0337708_77_760 226
258 3300046512 Ga0495610_0040907 Ga0495610_0040907_425_1108 226
259 3300046665 Ga0495661_0002083 Ga0495661_0002083_5898_6581 226
260 3300049663 Ga0501223_000517 Ga0501223_000517_4055_4735 226
261 3300049705 Ga0501225_0024089 Ga0501225_0024089_262_951 226
262 3300053091 Ga0500647_0042598 Ga0500647_0042598_979_1662 226
263 3300005364 Ga0070673_100818798 Ga0070673_1008187981 227
264 3300005617 Ga0068859_100025296 Ga0068859_1000252963 227
265 3300005844 Ga0068862_100010249 Ga0068862_1000102498 227
266 3300006931 Ga0097620_100025296 Ga0097620_1000252963 227
267 3300009553 Ga0105249_11473712 Ga0105249_114737121 227
268 3300013306 Ga0163162_10602532 Ga0163162_106025322 227
269 3300028380 Ga0268265_10011287 Ga0268265_100112876 227
270 3300053730 Ga0500645_097602 Ga0500645_097602_88_771 227
271 3300059639 Ga0587062_007733 Ga0587062_007733_494_1183 227
272 3300046523 Ga0495644_0019481 Ga0495644_0019481_1420_2109 229
273 3300047445 Ga0495677_0018237 Ga0495677_0018237_945_1634 229
274 iso_pu_bacteria 2738541284 2738761015 229
275 iso_pu_bacteria 2775506987 2776613201 229
276 3300005288 Ga0065714_10064455 Ga0065714_1006445558 231
277 3300014497 Ga0182008_10000018 Ga0182008_10000018123 231
278 3300049672 Ga0501239_007681 Ga0501239_007681_404_1099 231
279 3300003323 rootH1_10143935 rootH1_101439352 232
280 3300005614 Ga0068856_100007721 Ga0068856_1000077217 232
281 3300044712 Ga0453684_0256283 Ga0453684_0256283_925_1659 232
282 2162886007 SwRhRL2b_contig_1043338 SwRhRL2b_0778.00000200 233
283 2162886007 SwRhRL2b_contig_493616 SwRhRL2b_0792.00006220 233
284 3300005288 Ga0065714_10073029 Ga0065714_100730295 233
285 3300005289 Ga0065704_10000193 Ga0065704_1000019380 233
286 3300005289 Ga0065704_10116621 Ga0065704_101166213 233
287 3300005436 Ga0070713_100030371 Ga0070713_1000303715 233
288 3300005614 Ga0068856_100044610 Ga0068856_1000446106 233
289 3300013100 Ga0157373_10000136 Ga0157373_1000013631 233
290 3300013102 Ga0157371_10010674 Ga0157371_100106744 233
291 3300013102 Ga0157371_10078651 Ga0157371_100786512 233
292 3300013104 Ga0157370_10012813 Ga0157370_1001281311 233
293 3300013307 Ga0157372_10132576 Ga0157372_101325764 233
294 3300013307 Ga0157372_10219941 Ga0157372_102199415 233
295 3300014325 Ga0163163_10846402 Ga0163163_108464021 233
296 3300015261 Ga0182006_1009979 Ga0182006_10099792 233
297 3300025913 Ga0207695_10259556 Ga0207695_102595563 233
298 3300025928 Ga0207700_10008148 Ga0207700_100081485 233
299 3300028800 Ga0265338_10082101 Ga0265338_100821012 233
300 3300029957 Ga0265324_10111918 Ga0265324_101119181 233
301 3300031251 Ga0265327_10001894 Ga0265327_1000189417 233
302 3300031911 Ga0307412_10000077 Ga0307412_1000007710 233
303 3300032004 Ga0307414_10009225 Ga0307414_100092256 233
304 3300037471 Ga0395905_0021935 Ga0395905_0021935_3329_4030 233
305 3300038443 Ga0395901_0001566 Ga0395901_0001566_692_1411 233
306 3300049758 Ga0501241_005117 Ga0501241_005117_59_760 233
307 3300053093 Ga0500651_0000218 Ga0500651_0000218_21611_22312 233
308 3300053139 Ga0500568_0039819 Ga0500568_0039819_892_1593 233
309 iso_pu_bacteria 2911138879 2911141166 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

43

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9496 101 231
6z85-assembly1.cif.gz_A inhibitory human gtp cyclohydrolase i - gfrp complex 0.942 50 231
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.942 101 231
6z89-assembly1.cif.gz_B-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9385 46 231
6z88-assembly1.cif.gz_J human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9366 46 231
ID Description Score Start End Superfamily
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9704 100 232 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9583 108 232 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9427 100 232 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9258 112 230 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9242 101 221 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A0L8VDE2-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.988 37 230 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A3D1E5D5-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9806 30 180 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A382L1Q8-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9803 58 185 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A4V1ZVP6-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9798 65 232 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A090R0V7-F1-model_v4 deleted 0.9793 113 227

Feature Viewer

pLDDT pTM Quality
86.86 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map