F400138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 212 | 303 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300006177|Ga0075362_10043221|Ga0075362_100432212 |
| Length | 365 |
| Sequence | LSPPVALITGVTGQDGAYLAELLIRKGYVVHGIKRRSSSFNTSRVDDLLDRQLKSGVPFHLHYGDLTDSMSLVRLVQSIQPTEIYNLGAQSHVMVSFETPEYTANADGTGALRLLDALRILGIEKRVRFYQASTSELYGSTPPPQSETTPFHPRSPYAVAKLYAYWIVVNYREAYGVHASNGILFNHESPLRGETFVTRKITRAVASIVRGEQKELCLGNLDARRDWGHAADYVEGMWMMLQRDVPDDFVLATGEAHSVREFVELAFQEVGVDIVWQGKGMDEIGVDARTGSALVRVDARYFRPTEVDYLLGDASKARRLLGWQHQISFKSLVSEMVQVDLALGENGHSVVGPKGVARRLSEVAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 4 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 5 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 137 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 143 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 144 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 145 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 146 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 147 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 180 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 181 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 182 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 183 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 184 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 188 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 189 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 190 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 191 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 192 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 193 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 194 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 195 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 196 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 199 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 200 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 201 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 203 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 205 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 206 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 209 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 210 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 212 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.38 |
| Metatranscriptomes | 0 |
| Isolates | 1.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.86 |
| Nodule | 0.65 |
| Rhizoplane | 2.91 |
| Rhizosphere | 66.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 2 | JGI25156J39149_1000811 | 3300002705 | Bacteria | 15972 |
| 3 | JGI25154J39366_1000524 | 3300002738 | Bacteria | 19275 |
| 4 | JGI25157J39369_1000230 | 3300002741 | Bacteria | 43900 |
| 5 | Ga0055539_1001560 | 3300003752 | Bacteria | 4154 |
| 6 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 7 | Ga0055535_1000079 | 3300003761 | Bacteria | 109482 |
| 8 | Ga0055529_1000773 | 3300003763 | Bacteria | 20076 |
| 9 | Ga0055526_1001313 | 3300003771 | Bacteria | 17819 |
| 10 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 11 | Ga0055531_10000048 | 3300003794 | Bacteria | 131142 |
| 12 | Ga0055543_1005315 | 3300004625 | Bacteria | 3307 |
| 13 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 14 | Ga0065165_1000814 | 3300005262 | Bacteria | 41379 |
| 15 | Ga0065165_1002843 | 3300005262 | Bacteria | 13478 |
| 16 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 17 | Ga0065715_10099473 | 3300005293 | Bacteria | 3386 |
| 18 | Ga0070658_10199691 | 3300005327 | Bacteria | 1687 |
| 19 | Ga0070690_100002055 | 3300005330 | Bacteria | 10742 |
| 20 | Ga0070677_10043441 | 3300005333 | Bacteria | 1784 |
| 21 | Ga0068869_100006082 | 3300005334 | Bacteria | 7630 |
| 22 | Ga0070680_100007181 | 3300005336 | Bacteria | 8490 |
| 23 | Ga0070660_100021905 | 3300005339 | Bacteria | 4720 |
| 24 | Ga0070660_100037904 | 3300005339 | Bacteria | 3656 |
| 25 | Ga0070673_100098348 | 3300005364 | Bacteria | 2405 |
| 26 | Ga0070659_100011611 | 3300005366 | Bacteria | 6519 |
| 27 | Ga0070659_100040675 | 3300005366 | Bacteria | 3633 |
| 28 | Ga0070667_100000606 | 3300005367 | Bacteria | 34995 |
| 29 | Ga0070667_100013211 | 3300005367 | Bacteria | 6824 |
| 30 | Ga0070678_100006212 | 3300005456 | Bacteria | 6987 |
| 31 | Ga0070681_10323871 | 3300005458 | Bacteria | 1451 |
| 32 | Ga0070679_100005390 | 3300005530 | Bacteria | 11848 |
| 33 | Ga0070679_100050147 | 3300005530 | Bacteria | 4158 |
| 34 | Ga0068853_100023735 | 3300005539 | Bacteria | 5138 |
| 35 | Ga0070672_100005989 | 3300005543 | Bacteria | 8115 |
| 36 | Ga0070665_100188715 | 3300005548 | Bacteria | 2062 |
| 37 | Ga0070665_100275562 | 3300005548 | Bacteria | 1684 |
| 38 | Ga0068855_100001049 | 3300005563 | Bacteria | 34293 |
| 39 | Ga0068855_100001983 | 3300005563 | Bacteria | 25432 |
| 40 | Ga0068855_100011513 | 3300005563 | Bacteria | 10689 |
| 41 | Ga0068855_100150903 | 3300005563 | Bacteria | 2643 |
| 42 | Ga0070664_100057054 | 3300005564 | Bacteria | 3319 |
| 43 | Ga0068857_100008945 | 3300005577 | Bacteria | 8676 |
| 44 | Ga0068854_100009912 | 3300005578 | Bacteria | 6164 |
| 45 | Ga0068856_100005509 | 3300005614 | Bacteria | 12463 |
| 46 | Ga0068856_100045680 | 3300005614 | Bacteria | 4314 |
| 47 | Ga0068861_100066504 | 3300005719 | Bacteria | 2779 |
| 48 | Ga0068851_10000093 | 3300005834 | Bacteria | 49691 |
| 49 | Ga0068863_100000449 | 3300005841 | Bacteria | 41845 |
| 50 | Ga0068863_100032922 | 3300005841 | Bacteria | 4938 |
| 51 | Ga0068863_100081598 | 3300005841 | Bacteria | 3063 |
| 52 | Ga0068858_100000112 | 3300005842 | Bacteria | 86034 |
| 53 | Ga0068860_100071887 | 3300005843 | Bacteria | 3287 |
| 54 | Ga0068860_100137983 | 3300005843 | Bacteria | 2343 |
| 55 | Ga0068862_100075394 | 3300005844 | Bacteria | 2918 |
| 56 | Ga0068862_100255795 | 3300005844 | Bacteria | 1597 |
| 57 | Ga0081455_10053681 | 3300005937 | Bacteria | 3441 |
| 58 | Ga0075364_10205583 | 3300006051 | Bacteria | 1335 |
| 59 | Ga0075362_10005250 | 3300006177 | Bacteria | 4725 |
| 60 | Ga0075362_10043221 | 3300006177 | Bacteria | 1995 |
| 61 | Ga0075369_10002972 | 3300006186 | Bacteria | 6126 |
| 62 | Ga0075366_10055732 | 3300006195 | Bacteria | 2347 |
| 63 | Ga0075366_10067842 | 3300006195 | Bacteria | 2123 |
| 64 | Ga0097621_100006001 | 3300006237 | Bacteria | 8588 |
| 65 | Ga0097621_100059978 | 3300006237 | Bacteria | 3117 |
| 66 | Ga0068871_100007124 | 3300006358 | Bacteria | 7972 |
| 67 | Ga0068871_100022570 | 3300006358 | Bacteria | 4854 |
| 68 | Ga0068871_100097140 | 3300006358 | Bacteria | 2462 |
| 69 | Ga0068871_100281168 | 3300006358 | Bacteria | 1456 |
| 70 | Ga0075433_10133691 | 3300006852 | Bacteria | 2204 |
| 71 | Ga0075434_100148080 | 3300006871 | Bacteria | 2368 |
| 72 | Ga0068865_100074531 | 3300006881 | Bacteria | 2417 |
| 73 | Ga0097620_100012023 | 3300006931 | Bacteria | 8696 |
| 74 | Ga0075435_100080006 | 3300007076 | Bacteria | 2683 |
| 75 | Ga0105250_10000032 | 3300009092 | Bacteria | 159642 |
| 76 | Ga0105250_10008060 | 3300009092 | Bacteria | 4491 |
| 77 | Ga0105240_10334700 | 3300009093 | Bacteria | 1721 |
| 78 | Ga0105245_10002027 | 3300009098 | Bacteria | 18376 |
| 79 | Ga0105245_10063712 | 3300009098 | Bacteria | 3330 |
| 80 | Ga0105245_10114522 | 3300009098 | Bacteria | 2512 |
| 81 | Ga0105245_10183685 | 3300009098 | Bacteria | 2000 |
| 82 | Ga0105245_10284950 | 3300009098 | Bacteria | 1616 |
| 83 | Ga0105243_10261635 | 3300009148 | Bacteria | 1549 |
| 84 | Ga0105241_10025665 | 3300009174 | Bacteria | 4380 |
| 85 | Ga0105242_10000158 | 3300009176 | Bacteria | 50486 |
| 86 | Ga0105248_10004076 | 3300009177 | Bacteria | 16151 |
| 87 | Ga0105237_10000448 | 3300009545 | Bacteria | 58618 |
| 88 | Ga0105238_10014768 | 3300009551 | Bacteria | 7897 |
| 89 | Ga0105249_10002034 | 3300009553 | Bacteria | 17542 |
| 90 | Ga0099796_10034344 | 3300010159 | Bacteria | 1674 |
| 91 | Ga0157371_10001648 | 3300013102 | Bacteria | 22775 |
| 92 | Ga0157371_10002057 | 3300013102 | Bacteria | 19748 |
| 93 | Ga0157371_10002793 | 3300013102 | Bacteria | 16372 |
| 94 | Ga0157371_10012091 | 3300013102 | Bacteria | 6612 |
| 95 | Ga0157371_10043180 | 3300013102 | Bacteria | 3212 |
| 96 | Ga0157371_10101674 | 3300013102 | Bacteria | 2039 |
| 97 | Ga0157370_10000510 | 3300013104 | Bacteria | 48462 |
| 98 | Ga0157370_10277921 | 3300013104 | Bacteria | 1547 |
| 99 | Ga0157369_10010080 | 3300013105 | Bacteria | 10791 |
| 100 | Ga0157369_10047930 | 3300013105 | Bacteria | 4637 |
| 101 | Ga0157374_10028020 | 3300013296 | Bacteria | 5088 |
| 102 | Ga0157374_10148298 | 3300013296 | Bacteria | 2280 |
| 103 | Ga0157378_10041078 | 3300013297 | Bacteria | 4102 |
| 104 | Ga0157378_10064211 | 3300013297 | Bacteria | 3283 |
| 105 | Ga0157378_10161482 | 3300013297 | Bacteria | 2096 |
| 106 | Ga0157378_10185515 | 3300013297 | Bacteria | 1959 |
| 107 | Ga0163162_10000845 | 3300013306 | Bacteria | 28442 |
| 108 | Ga0163162_10096864 | 3300013306 | Bacteria | 3038 |
| 109 | Ga0163162_10269087 | 3300013306 | Bacteria | 1836 |
| 110 | Ga0157372_10000818 | 3300013307 | Bacteria | 33704 |
| 111 | Ga0157372_10002511 | 3300013307 | Bacteria | 19897 |
| 112 | Ga0157372_10011169 | 3300013307 | Bacteria | 9550 |
| 113 | Ga0157372_10112690 | 3300013307 | Bacteria | 3117 |
| 114 | Ga0157372_10161326 | 3300013307 | Bacteria | 2591 |
| 115 | Ga0157372_10178854 | 3300013307 | Bacteria | 2455 |
| 116 | Ga0157372_10225795 | 3300013307 | Bacteria | 2171 |
| 117 | Ga0157375_10001840 | 3300013308 | Bacteria | 18237 |
| 118 | Ga0157375_10101121 | 3300013308 | Bacteria | 2965 |
| 119 | Ga0157379_10000004 | 3300014968 | Bacteria | 173351 |
| 120 | Ga0157376_10005761 | 3300014969 | Bacteria | 8679 |
| 121 | Ga0157376_10011325 | 3300014969 | Bacteria | 6570 |
| 122 | Ga0213872_10000093 | 3300021361 | Bacteria | 83513 |
| 123 | Ga0213872_10007291 | 3300021361 | Bacteria | 5458 |
| 124 | Ga0213872_10011019 | 3300021361 | Bacteria | 4287 |
| 125 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 126 | Ga0209258_100544 | 3300025242 | Bacteria | 34176 |
| 127 | Ga0209646_1000198 | 3300025246 | Bacteria | 72654 |
| 128 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 129 | Ga0209677_100079 | 3300025253 | Bacteria | 121137 |
| 130 | Ga0209148_1002662 | 3300025254 | Bacteria | 5753 |
| 131 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 132 | Ga0209759_1004148 | 3300025256 | Bacteria | 5522 |
| 133 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 134 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 135 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 136 | Ga0209673_1004826 | 3300025273 | Bacteria | 7065 |
| 137 | Ga0209673_1005299 | 3300025273 | Bacteria | 6540 |
| 138 | Ga0209676_1002048 | 3300025292 | Bacteria | 15760 |
| 139 | Ga0209025_1001439 | 3300025294 | Bacteria | 31300 |
| 140 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 141 | Ga0209256_1001226 | 3300025299 | Bacteria | 28557 |
| 142 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 143 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 144 | Ga0209257_1001785 | 3300025304 | Bacteria | 23687 |
| 145 | Ga0207697_10005892 | 3300025315 | Bacteria | 5628 |
| 146 | Ga0207656_10000036 | 3300025321 | Bacteria | 61410 |
| 147 | Ga0207696_1000198 | 3300025711 | Bacteria | 92750 |
| 148 | Ga0207682_10002186 | 3300025893 | Bacteria | 8835 |
| 149 | Ga0207695_10018954 | 3300025913 | Bacteria | 7937 |
| 150 | Ga0207671_10000006 | 3300025914 | Bacteria | 836809 |
| 151 | Ga0207671_10011020 | 3300025914 | Bacteria | 7402 |
| 152 | Ga0207652_10004720 | 3300025921 | Bacteria | 11046 |
| 153 | Ga0207650_10002944 | 3300025925 | Bacteria | 11746 |
| 154 | Ga0207659_10034840 | 3300025926 | Bacteria | 3475 |
| 155 | Ga0207687_10008637 | 3300025927 | Bacteria | 6658 |
| 156 | Ga0207687_10068495 | 3300025927 | Bacteria | 2528 |
| 157 | Ga0207644_10018721 | 3300025931 | Bacteria | 4688 |
| 158 | Ga0207686_10007470 | 3300025934 | Bacteria | 5883 |
| 159 | Ga0207709_10170042 | 3300025935 | Bacteria | 1528 |
| 160 | Ga0207704_10029414 | 3300025938 | Bacteria | 3064 |
| 161 | Ga0207691_10000964 | 3300025940 | Bacteria | 28552 |
| 162 | Ga0207711_10062253 | 3300025941 | Bacteria | 3218 |
| 163 | Ga0207689_10037507 | 3300025942 | Bacteria | 4020 |
| 164 | Ga0207689_10084514 | 3300025942 | Bacteria | 2609 |
| 165 | Ga0207689_10164214 | 3300025942 | Bacteria | 1830 |
| 166 | Ga0207651_10001048 | 3300025960 | Bacteria | 12244 |
| 167 | Ga0207640_10011688 | 3300025981 | Bacteria | 4977 |
| 168 | Ga0207658_10001958 | 3300025986 | Bacteria | 15365 |
| 169 | Ga0207703_10001786 | 3300026035 | Bacteria | 19182 |
| 170 | Ga0207678_10044139 | 3300026067 | Bacteria | 3856 |
| 171 | Ga0207702_10001467 | 3300026078 | Bacteria | 23409 |
| 172 | Ga0207641_10000111 | 3300026088 | Bacteria | 120527 |
| 173 | Ga0207641_10024191 | 3300026088 | Bacteria | 5006 |
| 174 | Ga0207648_10016260 | 3300026089 | Bacteria | 6806 |
| 175 | Ga0207675_100012149 | 3300026118 | Bacteria | 8043 |
| 176 | Ga0207675_100090375 | 3300026118 | Bacteria | 2879 |
| 177 | Ga0207675_100094178 | 3300026118 | Bacteria | 2818 |
| 178 | Ga0207683_10009394 | 3300026121 | Bacteria | 8332 |
| 179 | Ga0207698_10127288 | 3300026142 | Bacteria | 2169 |
| 180 | Ga0209588_1024608 | 3300027671 | Bacteria | 1901 |
| 181 | Ga0209588_1034894 | 3300027671 | Bacteria | 1616 |
| 182 | Ga0268266_10154739 | 3300028379 | Bacteria | 2070 |
| 183 | Ga0268265_10083192 | 3300028380 | Bacteria | 2533 |
| 184 | Ga0268264_10053365 | 3300028381 | Bacteria | 3372 |
| 185 | Ga0268264_10080551 | 3300028381 | Bacteria | 2781 |
| 186 | Ga0268264_10388548 | 3300028381 | Bacteria | 1338 |
| 187 | Ga0307517_10045002 | 3300028786 | Bacteria | 4650 |
| 188 | Ga0307515_10002251 | 3300028794 | Bacteria | 42303 |
| 189 | Ga0307515_10004349 | 3300028794 | Bacteria | 29393 |
| 190 | Ga0307515_10188353 | 3300028794 | Bacteria | 1984 |
| 191 | Ga0265338_10015135 | 3300028800 | Bacteria | 8508 |
| 192 | Ga0307511_10058082 | 3300030521 | Bacteria | 2996 |
| 193 | Ga0307513_10007146 | 3300031456 | Bacteria | 14517 |
| 194 | Ga0307513_10008378 | 3300031456 | Bacteria | 13239 |
| 195 | Ga0307513_10024220 | 3300031456 | Bacteria | 7067 |
| 196 | Ga0307509_10019267 | 3300031507 | Bacteria | 7790 |
| 197 | Ga0307508_10000760 | 3300031616 | Bacteria | 38152 |
| 198 | Ga0307508_10070546 | 3300031616 | Bacteria | 3067 |
| 199 | Ga0307516_10000461 | 3300031730 | Bacteria | 53797 |
| 200 | Ga0307516_10000984 | 3300031730 | Bacteria | 39418 |
| 201 | Ga0307516_10023814 | 3300031730 | Bacteria | 6265 |
| 202 | Ga0307413_10017195 | 3300031824 | Bacteria | 3761 |
| 203 | Ga0307406_10068586 | 3300031901 | Bacteria | 2316 |
| 204 | Ga0307510_10211922 | 3300033180 | Bacteria | 1458 |
| 205 | Ga0316574_0090042 | 3300035398 | Bacteria | 1955 |
| 206 | Ga0373927_0013341 | 3300035695 | Bacteria | 5463 |
| 207 | Ga0373937_0153683 | 3300036401 | Bacteria | 2156 |
| 208 | Ga0316584_0042213 | 3300036712 | Bacteria | 3401 |
| 209 | Ga0395905_0001972 | 3300037471 | Bacteria | 23457 |
| 210 | Ga0395905_0027937 | 3300037471 | Bacteria | 5320 |
| 211 | Ga0395905_0067273 | 3300037471 | Bacteria | 3356 |
| 212 | Ga0400488_08713 | 3300038741 | Bacteria | 1919 |
| 213 | Ga0400483_028180 | 3300039062 | Bacteria | 30548 |
| 214 | Ga0400487_01073 | 3300039110 | Bacteria | 19698 |
| 215 | Ga0436361_0024534 | 3300039447 | Bacteria | 2953 |
| 216 | Ga0436361_0135223 | 3300039447 | Bacteria | 18748 |
| 217 | Ga0436361_0403975 | 3300039447 | Bacteria | 2039 |
| 218 | Ga0436361_0507639 | 3300039447 | Bacteria | 35242 |
| 219 | Ga0439449_0029056 | 3300042007 | Bacteria | 2060 |
| 220 | Ga0439459_0005902 | 3300042438 | Bacteria | 2026 |
| 221 | Ga0466969_0001057 | 3300044656 | Bacteria | 14871 |
| 222 | Ga0466972_0000138 | 3300044658 | Bacteria | 59590 |
| 223 | Ga0466961_0000714 | 3300044693 | Bacteria | 20956 |
| 224 | Ga0453684_0000584 | 3300044712 | Bacteria | 135892 |
| 225 | Ga0453684_0001723 | 3300044712 | Bacteria | 58623 |
| 226 | Ga0466968_0012561 | 3300044735 | Bacteria | 3318 |
| 227 | Ga0466959_0000604 | 3300045049 | Bacteria | 20935 |
| 228 | Ga0451576_0004854 | 3300045051 | Bacteria | 17225 |
| 229 | Ga0495592_0036995 | 3300046454 | Bacteria | 3675 |
| 230 | Ga0495638_0000228 | 3300046460 | Bacteria | 76924 |
| 231 | Ga0495638_0002175 | 3300046460 | Bacteria | 16437 |
| 232 | Ga0495580_0112295 | 3300046472 | Bacteria | 1893 |
| 233 | Ga0495583_0000173 | 3300046506 | Bacteria | 109405 |
| 234 | Ga0495583_0006628 | 3300046506 | Bacteria | 7519 |
| 235 | Ga0495606_0004328 | 3300046507 | Bacteria | 14279 |
| 236 | Ga0495630_0049068 | 3300046517 | Bacteria | 3159 |
| 237 | Ga0495632_0015654 | 3300046519 | Bacteria | 4241 |
| 238 | Ga0495648_0000591 | 3300046524 | Bacteria | 38811 |
| 239 | Ga0495663_0014091 | 3300046525 | Bacteria | 2239 |
| 240 | Ga0495668_0023960 | 3300046616 | Bacteria | 3474 |
| 241 | Ga0495668_0033833 | 3300046616 | Bacteria | 2870 |
| 242 | Ga0495625_0000054 | 3300046660 | Bacteria | 187599 |
| 243 | Ga0495625_0016096 | 3300046660 | Bacteria | 5893 |
| 244 | Ga0495670_0004714 | 3300046691 | Bacteria | 6695 |
| 245 | Ga0495670_0010022 | 3300046691 | Bacteria | 4660 |
| 246 | Ga0495649_0000136 | 3300046694 | Bacteria | 64021 |
| 247 | Ga0495589_0002439 | 3300046794 | Bacteria | 10439 |
| 248 | Ga0495687_000811 | 3300047443 | Bacteria | 33635 |
| 249 | Ga0496100_0032709 | 3300048903 | Bacteria | 3247 |
| 250 | Ga0496108_0169241 | 3300048911 | Bacteria | 1890 |
| 251 | Ga0496109_0127513 | 3300048912 | Bacteria | 2373 |
| 252 | Ga0496109_0214113 | 3300048912 | Bacteria | 1812 |
| 253 | Ga0496111_0057171 | 3300048914 | Bacteria | 2824 |
| 254 | Ga0496113_0093085 | 3300048916 | Bacteria | 2326 |
| 255 | Ga0496114_0000294 | 3300048917 | Bacteria | 36628 |
| 256 | Ga0496114_0233628 | 3300048917 | Bacteria | 1616 |
| 257 | Ga0496115_0196676 | 3300048918 | Bacteria | 1666 |
| 258 | Ga0496116_0046836 | 3300048919 | Bacteria | 2915 |
| 259 | Ga0496117_0024213 | 3300048920 | Bacteria | 4809 |
| 260 | Ga0496119_0021175 | 3300048922 | Bacteria | 4710 |
| 261 | Ga0496120_0032269 | 3300048923 | Bacteria | 3160 |
| 262 | Ga0496121_0008741 | 3300048924 | Bacteria | 11815 |
| 263 | Ga0496121_0058099 | 3300048924 | Bacteria | 3201 |
| 264 | Ga0496122_0020968 | 3300048925 | Bacteria | 5872 |
| 265 | Ga0496122_0022290 | 3300048925 | Bacteria | 5636 |
| 266 | Ga0496123_0065952 | 3300048926 | Bacteria | 2297 |
| 267 | Ga0496124_0000487 | 3300048927 | Bacteria | 68031 |
| 268 | Ga0496124_0013995 | 3300048927 | Bacteria | 7786 |
| 269 | Ga0496125_0000145 | 3300048928 | Bacteria | 156267 |
| 270 | Ga0496125_0046709 | 3300048928 | Bacteria | 3629 |
| 271 | Ga0496125_0054498 | 3300048928 | Bacteria | 3267 |
| 272 | Ga0496126_0003992 | 3300048929 | Bacteria | 18025 |
| 273 | Ga0501300_004011 | 3300049523 | Bacteria | 2189 |
| 274 | Ga0501301_000927 | 3300049524 | Bacteria | 1825 |
| 275 | Ga0501223_000345 | 3300049663 | Bacteria | 11469 |
| 276 | Ga0501223_003766 | 3300049663 | Bacteria | 3276 |
| 277 | Ga0501227_004934 | 3300049665 | Bacteria | 2862 |
| 278 | Ga0501233_001807 | 3300049668 | Bacteria | 3706 |
| 279 | Ga0501235_000214 | 3300049669 | Bacteria | 10394 |
| 280 | Ga0501236_000838 | 3300049670 | Bacteria | 3441 |
| 281 | Ga0501221_000039 | 3300049704 | Bacteria | 12978 |
| 282 | Ga0501229_000016 | 3300049706 | Bacteria | 20611 |
| 283 | Ga0501229_004060 | 3300049706 | Bacteria | 1772 |
| 284 | Ga0501267_000010 | 3300049764 | Bacteria | 13676 |
| 285 | Ga0501044_0109197 | 3300049823 | Bacteria | 2776 |
| 286 | Ga0501226_001569 | 3300049853 | Bacteria | 2901 |
| 287 | nmdc:mga0k408_15219_c1 | 3300050493 | Bacteria | 2738 |
| 288 | nmdc:mga0k408_153569_c1 | 3300050493 | Bacteria | 1371 |
| 289 | nmdc:mga0k408_210889_c1 | 3300050493 | Bacteria | 1160 |
| 290 | nmdc:mga07m45_1324_c1 | 3300050496 | Bacteria | 11280 |
| 291 | nmdc:mga07m45_2734_c1 | 3300050496 | Bacteria | 8314 |
| 292 | nmdc:mga0n895_194177_c1 | 3300050512 | Bacteria | 2061 |
| 293 | nmdc:mga0sz30_2265_c1 | 3300050516 | Bacteria | 4489 |
| 294 | Ga0495601_0018427 | 3300053077 | Bacteria | 4250 |
| 295 | Ga0500635_0000065 | 3300053080 | Bacteria | 69362 |
| 296 | Ga0500641_0029882 | 3300053096 | Bacteria | 2138 |
| 297 | Ga0500618_000953 | 3300053125 | Bacteria | 14796 |
| 298 | Ga0500658_0000400 | 3300053134 | Bacteria | 18787 |
| 299 | Ga0500559_0020237 | 3300053136 | Bacteria | 2814 |
| 300 | Ga0500559_0034272 | 3300053136 | Bacteria | 2189 |
| 301 | Ga0500568_0048165 | 3300053139 | Bacteria | 1686 |
| 302 | Ga0500627_0020567 | 3300053158 | Bacteria | 2648 |
| 303 | Ga0500587_007026 | 3300053739 | Bacteria | 1476 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221561 | 2643827278 | 316 |
| 2 | iso_pu_bacteria | 2643221696 | 2644533895 | 316 |
| 3 | 3300006051 | Ga0075364_10205583 | Ga0075364_102055832 | 344 |
| 4 | 3300006177 | Ga0075362_10005250 | Ga0075362_100052504 | 344 |
| 5 | 3300046506 | Ga0495583_0006628 | Ga0495583_0006628_1612_2718 | 349 |
| 6 | 3300046616 | Ga0495668_0033833 | Ga0495668_0033833_1470_2576 | 349 |
| 7 | 3300046660 | Ga0495625_0016096 | Ga0495625_0016096_94_1200 | 349 |
| 8 | 3300050516 | nmdc:mga0sz30_2265_c1 | nmdc:mga0sz30_2265_c1_1481_2560 | 349 |
| 9 | 3300025921 | Ga0207652_10004720 | Ga0207652_1000472013 | 351 |
| 10 | 3300025261 | Ga0209233_1000028 | Ga0209233_1000028384 | 352 |
| 11 | 3300048919 | Ga0496116_0046836 | Ga0496116_0046836_706_1857 | 352 |
| 12 | 3300048922 | Ga0496119_0021175 | Ga0496119_0021175_724_1863 | 352 |
| 13 | 3300048923 | Ga0496120_0032269 | Ga0496120_0032269_823_1962 | 352 |
| 14 | 3300048924 | Ga0496121_0058099 | Ga0496121_0058099_1169_2320 | 352 |
| 15 | 3300048925 | Ga0496122_0022290 | Ga0496122_0022290_1928_3079 | 352 |
| 16 | 3300048926 | Ga0496123_0065952 | Ga0496123_0065952_639_1790 | 352 |
| 17 | 3300048929 | Ga0496126_0003992 | Ga0496126_0003992_15595_16746 | 352 |
| 18 | 3300010159 | Ga0099796_10034344 | Ga0099796_100343442 | 353 |
| 19 | 3300027671 | Ga0209588_1024608 | Ga0209588_10246082 | 353 |
| 20 | 3300035695 | Ga0373927_0013341 | Ga0373927_0013341_1752_2846 | 353 |
| 21 | 3300039062 | Ga0400483_028180 | Ga0400483_028180_1710_2864 | 353 |
| 22 | 3300048911 | Ga0496108_0169241 | Ga0496108_0169241_95_1213 | 353 |
| 23 | 3300048912 | Ga0496109_0127513 | Ga0496109_0127513_688_1806 | 353 |
| 24 | 3300006177 | Ga0075362_10043221 | Ga0075362_100432212 | 354 |
| 25 | 3300006186 | Ga0075369_10002972 | Ga0075369_100029725 | 354 |
| 26 | 3300006237 | Ga0097621_100059978 | Ga0097621_1000599783 | 354 |
| 27 | 3300006358 | Ga0068871_100022570 | Ga0068871_1000225704 | 354 |
| 28 | 3300013297 | Ga0157378_10064211 | Ga0157378_100642113 | 354 |
| 29 | 3300005548 | Ga0070665_100275562 | Ga0070665_1002755622 | 355 |
| 30 | 3300005841 | Ga0068863_100081598 | Ga0068863_1000815981 | 355 |
| 31 | 3300048924 | Ga0496121_0008741 | Ga0496121_0008741_9298_10530 | 355 |
| 32 | 3300048928 | Ga0496125_0000145 | Ga0496125_0000145_130813_132018 | 355 |
| 33 | 3300053125 | Ga0500618_000953 | Ga0500618_000953_13150_14247 | 355 |
| 34 | 3300005719 | Ga0068861_100066504 | Ga0068861_1000665042 | 356 |
| 35 | 3300006852 | Ga0075433_10133691 | Ga0075433_101336912 | 356 |
| 36 | 3300006871 | Ga0075434_100148080 | Ga0075434_1001480802 | 356 |
| 37 | 3300007076 | Ga0075435_100080006 | Ga0075435_1000800062 | 356 |
| 38 | 3300009098 | Ga0105245_10183685 | Ga0105245_101836851 | 356 |
| 39 | 3300013308 | Ga0157375_10101121 | Ga0157375_101011212 | 356 |
| 40 | 3300026118 | Ga0207675_100094178 | Ga0207675_1000941782 | 356 |
| 41 | 3300046472 | Ga0495580_0112295 | Ga0495580_0112295_720_1811 | 356 |
| 42 | 3300048912 | Ga0496109_0214113 | Ga0496109_0214113_539_1630 | 356 |
| 43 | 3300048914 | Ga0496111_0057171 | Ga0496111_0057171_1575_2666 | 356 |
| 44 | 3300048916 | Ga0496113_0093085 | Ga0496113_0093085_1177_2268 | 356 |
| 45 | 3300050512 | nmdc:mga0n895_194177_c1 | nmdc:mga0n895_194177_c1_917_2008 | 356 |
| 46 | 3300005937 | Ga0081455_10053681 | Ga0081455_100536812 | 357 |
| 47 | 3300006358 | Ga0068871_100281168 | Ga0068871_1002811681 | 357 |
| 48 | 3300025942 | Ga0207689_10164214 | Ga0207689_101642142 | 357 |
| 49 | 3300049823 | Ga0501044_0109197 | Ga0501044_0109197_752_1858 | 357 |
| 50 | 3300026118 | Ga0207675_100090375 | Ga0207675_1000903752 | 358 |
| 51 | 3300028381 | Ga0268264_10388548 | Ga0268264_103885481 | 358 |
| 52 | 3300031616 | Ga0307508_10070546 | Ga0307508_100705463 | 358 |
| 53 | iso_pu_bacteria | 2791355265 | 2793356584 | 358 |
| 54 | iso_pu_bacteria | 8056382006 | 8056383839 | 358 |
| 55 | 3300004625 | Ga0055543_1005315 | Ga0055543_10053152 | 360 |
| 56 | 3300005262 | Ga0065165_1000016 | Ga0065165_1000016100 | 360 |
| 57 | 3300005336 | Ga0070680_100007181 | Ga0070680_1000071814 | 360 |
| 58 | 3300005339 | Ga0070660_100021905 | Ga0070660_1000219054 | 360 |
| 59 | 3300005339 | Ga0070660_100037904 | Ga0070660_1000379043 | 360 |
| 60 | 3300005366 | Ga0070659_100011611 | Ga0070659_1000116114 | 360 |
| 61 | 3300005366 | Ga0070659_100040675 | Ga0070659_1000406753 | 360 |
| 62 | 3300005458 | Ga0070681_10323871 | Ga0070681_103238711 | 360 |
| 63 | 3300005530 | Ga0070679_100005390 | Ga0070679_1000053902 | 360 |
| 64 | 3300005530 | Ga0070679_100050147 | Ga0070679_1000501473 | 360 |
| 65 | 3300005539 | Ga0068853_100023735 | Ga0068853_1000237353 | 360 |
| 66 | 3300005563 | Ga0068855_100001049 | Ga0068855_10000104928 | 360 |
| 67 | 3300005563 | Ga0068855_100001983 | Ga0068855_1000019837 | 360 |
| 68 | 3300005563 | Ga0068855_100011513 | Ga0068855_1000115138 | 360 |
| 69 | 3300005563 | Ga0068855_100150903 | Ga0068855_1001509033 | 360 |
| 70 | 3300013102 | Ga0157371_10001648 | Ga0157371_100016482 | 360 |
| 71 | 3300013102 | Ga0157371_10002057 | Ga0157371_1000205716 | 360 |
| 72 | 3300013102 | Ga0157371_10002793 | Ga0157371_1000279310 | 360 |
| 73 | 3300013102 | Ga0157371_10012091 | Ga0157371_100120914 | 360 |
| 74 | 3300013102 | Ga0157371_10043180 | Ga0157371_100431803 | 360 |
| 75 | 3300013104 | Ga0157370_10000510 | Ga0157370_1000051035 | 360 |
| 76 | 3300013104 | Ga0157370_10277921 | Ga0157370_102779211 | 360 |
| 77 | 3300013105 | Ga0157369_10010080 | Ga0157369_100100804 | 360 |
| 78 | 3300013307 | Ga0157372_10000818 | Ga0157372_1000081811 | 360 |
| 79 | 3300013307 | Ga0157372_10002511 | Ga0157372_100025113 | 360 |
| 80 | 3300013307 | Ga0157372_10011169 | Ga0157372_100111694 | 360 |
| 81 | 3300013307 | Ga0157372_10161326 | Ga0157372_101613262 | 360 |
| 82 | 3300044658 | Ga0466972_0000138 | Ga0466972_0000138_43024_44124 | 360 |
| 83 | 3300046454 | Ga0495592_0036995 | Ga0495592_0036995_474_1565 | 360 |
| 84 | 3300046517 | Ga0495630_0049068 | Ga0495630_0049068_1423_2514 | 360 |
| 85 | 3300053077 | Ga0495601_0018427 | Ga0495601_0018427_2855_3946 | 360 |
| 86 | 3300009545 | Ga0105237_10000448 | Ga0105237_1000044829 | 361 |
| 87 | 3300013297 | Ga0157378_10185515 | Ga0157378_101855151 | 361 |
| 88 | 3300013307 | Ga0157372_10112690 | Ga0157372_101126903 | 361 |
| 89 | 3300025914 | Ga0207671_10000006 | Ga0207671_10000006778 | 361 |
| 90 | 3300027671 | Ga0209588_1034894 | Ga0209588_10348942 | 361 |
| 91 | 3300039110 | Ga0400487_01073 | Ga0400487_01073_16823_17923 | 361 |
| 92 | 3300046524 | Ga0495648_0000591 | Ga0495648_0000591_3408_4499 | 361 |
| 93 | 3300048920 | Ga0496117_0024213 | Ga0496117_0024213_2886_3977 | 361 |
| 94 | 3300049663 | Ga0501223_000345 | Ga0501223_000345_6841_7932 | 361 |
| 95 | 3300049853 | Ga0501226_001569 | Ga0501226_001569_1537_2628 | 361 |
| 96 | 3300053158 | Ga0500627_0020567 | Ga0500627_0020567_329_1420 | 361 |
| 97 | 3300003771 | Ga0055526_1001313 | Ga0055526_10013138 | 362 |
| 98 | 3300005327 | Ga0070658_10199691 | Ga0070658_101996912 | 362 |
| 99 | 3300005367 | Ga0070667_100013211 | Ga0070667_1000132115 | 362 |
| 100 | 3300005842 | Ga0068858_100000112 | Ga0068858_10000011269 | 362 |
| 101 | 3300005844 | Ga0068862_100255795 | Ga0068862_1002557951 | 362 |
| 102 | 3300009093 | Ga0105240_10334700 | Ga0105240_103347002 | 362 |
| 103 | 3300009098 | Ga0105245_10002027 | Ga0105245_100020279 | 362 |
| 104 | 3300009098 | Ga0105245_10063712 | Ga0105245_100637122 | 362 |
| 105 | 3300009148 | Ga0105243_10261635 | Ga0105243_102616352 | 362 |
| 106 | 3300013296 | Ga0157374_10028020 | Ga0157374_100280202 | 362 |
| 107 | 3300013296 | Ga0157374_10148298 | Ga0157374_101482982 | 362 |
| 108 | 3300013297 | Ga0157378_10161482 | Ga0157378_101614822 | 362 |
| 109 | 3300021361 | Ga0213872_10007291 | Ga0213872_100072913 | 362 |
| 110 | 3300025261 | Ga0209233_1000026 | Ga0209233_1000026424 | 362 |
| 111 | 3300025273 | Ga0209673_1004826 | Ga0209673_10048262 | 362 |
| 112 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008439 | 362 |
| 113 | 3300025927 | Ga0207687_10008637 | Ga0207687_100086375 | 362 |
| 114 | 3300025927 | Ga0207687_10068495 | Ga0207687_100684952 | 362 |
| 115 | 3300025935 | Ga0207709_10170042 | Ga0207709_101700422 | 362 |
| 116 | 3300026035 | Ga0207703_10001786 | Ga0207703_1000178611 | 362 |
| 117 | 3300031616 | Ga0307508_10000760 | Ga0307508_100007609 | 362 |
| 118 | 3300036401 | Ga0373937_0153683 | Ga0373937_0153683_802_1902 | 362 |
| 119 | 3300038741 | Ga0400488_08713 | Ga0400488_08713_67_1185 | 362 |
| 120 | 3300039447 | Ga0436361_0024534 | Ga0436361_0024534_1805_2908 | 362 |
| 121 | 3300039447 | Ga0436361_0507639 | Ga0436361_0507639_19451_20551 | 362 |
| 122 | 3300046460 | Ga0495638_0000228 | Ga0495638_0000228_75560_76675 | 362 |
| 123 | 3300046525 | Ga0495663_0014091 | Ga0495663_0014091_128_1243 | 362 |
| 124 | 3300046660 | Ga0495625_0000054 | Ga0495625_0000054_181259_182359 | 362 |
| 125 | 3300046691 | Ga0495670_0004714 | Ga0495670_0004714_4609_5709 | 362 |
| 126 | 3300048917 | Ga0496114_0000294 | Ga0496114_0000294_7059_8159 | 362 |
| 127 | 3300048918 | Ga0496115_0196676 | Ga0496115_0196676_28_1128 | 362 |
| 128 | 3300048925 | Ga0496122_0020968 | Ga0496122_0020968_645_1820 | 362 |
| 129 | 3300048928 | Ga0496125_0046709 | Ga0496125_0046709_959_2056 | 362 |
| 130 | 3300053096 | Ga0500641_0029882 | Ga0500641_0029882_773_1888 | 362 |
| 131 | 3300053134 | Ga0500658_0000400 | Ga0500658_0000400_17537_18652 | 362 |
| 132 | 3300053136 | Ga0500559_0020237 | Ga0500559_0020237_608_1708 | 362 |
| 133 | 3300053136 | Ga0500559_0034272 | Ga0500559_0034272_265_1365 | 362 |
| 134 | 3300053139 | Ga0500568_0048165 | Ga0500568_0048165_46_1161 | 362 |
| 135 | 3300053739 | Ga0500587_007026 | Ga0500587_007026_283_1383 | 362 |
| 136 | 3300031730 | Ga0307516_10023814 | Ga0307516_100238145 | 363 |
| 137 | 3300035398 | Ga0316574_0090042 | Ga0316574_0090042_126_1226 | 364 |
| 138 | 3300003794 | Ga0055531_10000007 | Ga0055531_10000007105 | 366 |
| 139 | 3300005548 | Ga0070665_100188715 | Ga0070665_1001887152 | 366 |
| 140 | 3300009092 | Ga0105250_10008060 | Ga0105250_100080603 | 366 |
| 141 | 3300009098 | Ga0105245_10114522 | Ga0105245_101145222 | 366 |
| 142 | 3300009177 | Ga0105248_10004076 | Ga0105248_1000407613 | 366 |
| 143 | 3300013306 | Ga0163162_10000845 | Ga0163162_100008452 | 366 |
| 144 | 3300013308 | Ga0157375_10001840 | Ga0157375_100018406 | 366 |
| 145 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021123 | 366 |
| 146 | 3300025941 | Ga0207711_10062253 | Ga0207711_100622532 | 366 |
| 147 | 3300026067 | Ga0207678_10044139 | Ga0207678_100441395 | 366 |
| 148 | 3300028379 | Ga0268266_10154739 | Ga0268266_101547392 | 366 |
| 149 | 3300028794 | Ga0307515_10188353 | Ga0307515_101883532 | 366 |
| 150 | 3300031456 | Ga0307513_10008378 | Ga0307513_100083785 | 366 |
| 151 | 3300046460 | Ga0495638_0002175 | Ga0495638_0002175_12625_13737 | 366 |
| 152 | 3300046691 | Ga0495670_0010022 | Ga0495670_0010022_226_1338 | 366 |
| 153 | 3300046794 | Ga0495589_0002439 | Ga0495589_0002439_3586_4698 | 366 |
| 154 | 3300048903 | Ga0496100_0032709 | Ga0496100_0032709_1450_2562 | 366 |
| 155 | 3300048917 | Ga0496114_0233628 | Ga0496114_0233628_15_1127 | 366 |
| 156 | 3300002705 | JGI25156J39149_1000811 | JGI25156J39149_100081110 | 367 |
| 157 | 3300002738 | JGI25154J39366_1000524 | JGI25154J39366_100052416 | 367 |
| 158 | 3300002741 | JGI25157J39369_1000230 | JGI25157J39369_100023010 | 367 |
| 159 | 3300003752 | Ga0055539_1001560 | Ga0055539_10015603 | 367 |
| 160 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004439 | 367 |
| 161 | 3300003761 | Ga0055535_1000079 | Ga0055535_100007983 | 367 |
| 162 | 3300003763 | Ga0055529_1000773 | Ga0055529_10007735 | 367 |
| 163 | 3300005262 | Ga0065165_1002843 | Ga0065165_10028433 | 367 |
| 164 | 3300005293 | Ga0065715_10099473 | Ga0065715_100994731 | 367 |
| 165 | 3300005330 | Ga0070690_100002055 | Ga0070690_1000020555 | 367 |
| 166 | 3300005333 | Ga0070677_10043441 | Ga0070677_100434412 | 367 |
| 167 | 3300005334 | Ga0068869_100006082 | Ga0068869_1000060826 | 367 |
| 168 | 3300005364 | Ga0070673_100098348 | Ga0070673_1000983482 | 367 |
| 169 | 3300005367 | Ga0070667_100000606 | Ga0070667_10000060629 | 367 |
| 170 | 3300005456 | Ga0070678_100006212 | Ga0070678_1000062122 | 367 |
| 171 | 3300005543 | Ga0070672_100005989 | Ga0070672_1000059898 | 367 |
| 172 | 3300005564 | Ga0070664_100057054 | Ga0070664_1000570544 | 367 |
| 173 | 3300005577 | Ga0068857_100008945 | Ga0068857_1000089455 | 367 |
| 174 | 3300005578 | Ga0068854_100009912 | Ga0068854_1000099125 | 367 |
| 175 | 3300005614 | Ga0068856_100005509 | Ga0068856_1000055095 | 367 |
| 176 | 3300006195 | Ga0075366_10055732 | Ga0075366_100557323 | 367 |
| 177 | 3300006195 | Ga0075366_10067842 | Ga0075366_100678422 | 367 |
| 178 | 3300006358 | Ga0068871_100007124 | Ga0068871_1000071247 | 367 |
| 179 | 3300006881 | Ga0068865_100074531 | Ga0068865_1000745312 | 367 |
| 180 | 3300009092 | Ga0105250_10000032 | Ga0105250_1000003289 | 367 |
| 181 | 3300009098 | Ga0105245_10284950 | Ga0105245_102849502 | 367 |
| 182 | 3300009174 | Ga0105241_10025665 | Ga0105241_100256652 | 367 |
| 183 | 3300009551 | Ga0105238_10014768 | Ga0105238_100147685 | 367 |
| 184 | 3300013105 | Ga0157369_10047930 | Ga0157369_100479304 | 367 |
| 185 | 3300013297 | Ga0157378_10041078 | Ga0157378_100410782 | 367 |
| 186 | 3300013306 | Ga0163162_10269087 | Ga0163162_102690872 | 367 |
| 187 | 3300014968 | Ga0157379_10000004 | Ga0157379_1000000480 | 367 |
| 188 | 3300014969 | Ga0157376_10011325 | Ga0157376_100113255 | 367 |
| 189 | 3300021361 | Ga0213872_10000093 | Ga0213872_1000009350 | 367 |
| 190 | 3300021361 | Ga0213872_10011019 | Ga0213872_100110194 | 367 |
| 191 | 3300025230 | Ga0209563_100013 | Ga0209563_100013439 | 367 |
| 192 | 3300025230 | Ga0209563_100013 | Ga0209563_100013509 | 367 |
| 193 | 3300025242 | Ga0209258_100544 | Ga0209258_10054412 | 367 |
| 194 | 3300025246 | Ga0209646_1000198 | Ga0209646_100019810 | 367 |
| 195 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004625 | 367 |
| 196 | 3300025253 | Ga0209677_100079 | Ga0209677_10007939 | 367 |
| 197 | 3300025254 | Ga0209148_1002662 | Ga0209148_10026623 | 367 |
| 198 | 3300025256 | Ga0209759_1000003 | Ga0209759_100000399 | 367 |
| 199 | 3300025256 | Ga0209759_1004148 | Ga0209759_10041485 | 367 |
| 200 | 3300025272 | Ga0209455_1000083 | Ga0209455_100008347 | 367 |
| 201 | 3300025273 | Ga0209673_1005299 | Ga0209673_10052995 | 367 |
| 202 | 3300025299 | Ga0209256_1001226 | Ga0209256_100122626 | 367 |
| 203 | 3300025315 | Ga0207697_10005892 | Ga0207697_100058924 | 367 |
| 204 | 3300025711 | Ga0207696_1000198 | Ga0207696_10001987 | 367 |
| 205 | 3300025893 | Ga0207682_10002186 | Ga0207682_100021865 | 367 |
| 206 | 3300025913 | Ga0207695_10018954 | Ga0207695_100189546 | 367 |
| 207 | 3300025914 | Ga0207671_10011020 | Ga0207671_100110205 | 367 |
| 208 | 3300025925 | Ga0207650_10002944 | Ga0207650_100029444 | 367 |
| 209 | 3300025926 | Ga0207659_10034840 | Ga0207659_100348402 | 367 |
| 210 | 3300025931 | Ga0207644_10018721 | Ga0207644_100187214 | 367 |
| 211 | 3300025934 | Ga0207686_10007470 | Ga0207686_100074702 | 367 |
| 212 | 3300025938 | Ga0207704_10029414 | Ga0207704_100294142 | 367 |
| 213 | 3300025940 | Ga0207691_10000964 | Ga0207691_1000096410 | 367 |
| 214 | 3300025942 | Ga0207689_10037507 | Ga0207689_100375073 | 367 |
| 215 | 3300025960 | Ga0207651_10001048 | Ga0207651_100010484 | 367 |
| 216 | 3300025981 | Ga0207640_10011688 | Ga0207640_100116882 | 367 |
| 217 | 3300025986 | Ga0207658_10001958 | Ga0207658_100019583 | 367 |
| 218 | 3300026078 | Ga0207702_10001467 | Ga0207702_1000146716 | 367 |
| 219 | 3300026089 | Ga0207648_10016260 | Ga0207648_100162604 | 367 |
| 220 | 3300026118 | Ga0207675_100012149 | Ga0207675_1000121495 | 367 |
| 221 | 3300026121 | Ga0207683_10009394 | Ga0207683_100093944 | 367 |
| 222 | 3300026142 | Ga0207698_10127288 | Ga0207698_101272882 | 367 |
| 223 | 3300028786 | Ga0307517_10045002 | Ga0307517_100450023 | 367 |
| 224 | 3300028794 | Ga0307515_10002251 | Ga0307515_1000225136 | 367 |
| 225 | 3300028794 | Ga0307515_10004349 | Ga0307515_1000434920 | 367 |
| 226 | 3300030521 | Ga0307511_10058082 | Ga0307511_100580822 | 367 |
| 227 | 3300031456 | Ga0307513_10024220 | Ga0307513_100242204 | 367 |
| 228 | 3300031730 | Ga0307516_10000461 | Ga0307516_100004616 | 367 |
| 229 | 3300031730 | Ga0307516_10000984 | Ga0307516_100009842 | 367 |
| 230 | 3300033180 | Ga0307510_10211922 | Ga0307510_102119222 | 367 |
| 231 | 3300036712 | Ga0316584_0042213 | Ga0316584_0042213_119_1273 | 367 |
| 232 | 3300037471 | Ga0395905_0001972 | Ga0395905_0001972_18172_19296 | 367 |
| 233 | 3300037471 | Ga0395905_0027937 | Ga0395905_0027937_2870_3991 | 367 |
| 234 | 3300037471 | Ga0395905_0067273 | Ga0395905_0067273_850_1974 | 367 |
| 235 | 3300039447 | Ga0436361_0135223 | Ga0436361_0135223_14158_15282 | 367 |
| 236 | 3300039447 | Ga0436361_0403975 | Ga0436361_0403975_639_1760 | 367 |
| 237 | 3300042438 | Ga0439459_0005902 | Ga0439459_0005902_465_1589 | 367 |
| 238 | 3300044656 | Ga0466969_0001057 | Ga0466969_0001057_10562_11683 | 367 |
| 239 | 3300044693 | Ga0466961_0000714 | Ga0466961_0000714_4059_5180 | 367 |
| 240 | 3300044735 | Ga0466968_0012561 | Ga0466968_0012561_1351_2481 | 367 |
| 241 | 3300045049 | Ga0466959_0000604 | Ga0466959_0000604_4059_5180 | 367 |
| 242 | 3300046506 | Ga0495583_0000173 | Ga0495583_0000173_94909_96030 | 367 |
| 243 | 3300046507 | Ga0495606_0004328 | Ga0495606_0004328_12808_13929 | 367 |
| 244 | 3300046519 | Ga0495632_0015654 | Ga0495632_0015654_2635_3756 | 367 |
| 245 | 3300046616 | Ga0495668_0023960 | Ga0495668_0023960_979_2100 | 367 |
| 246 | 3300046694 | Ga0495649_0000136 | Ga0495649_0000136_49985_51106 | 367 |
| 247 | 3300047443 | Ga0495687_000811 | Ga0495687_000811_9929_11053 | 367 |
| 248 | 3300048927 | Ga0496124_0013995 | Ga0496124_0013995_6650_7774 | 367 |
| 249 | 3300049523 | Ga0501300_004011 | Ga0501300_004011_471_1595 | 367 |
| 250 | 3300049524 | Ga0501301_000927 | Ga0501301_000927_471_1595 | 367 |
| 251 | 3300049663 | Ga0501223_003766 | Ga0501223_003766_368_1492 | 367 |
| 252 | 3300049668 | Ga0501233_001807 | Ga0501233_001807_1165_2280 | 367 |
| 253 | 3300049669 | Ga0501235_000214 | Ga0501235_000214_4496_5620 | 367 |
| 254 | 3300049670 | Ga0501236_000838 | Ga0501236_000838_543_1658 | 367 |
| 255 | 3300049704 | Ga0501221_000039 | Ga0501221_000039_6925_8049 | 367 |
| 256 | 3300049706 | Ga0501229_000016 | Ga0501229_000016_4942_6066 | 367 |
| 257 | 3300049706 | Ga0501229_004060 | Ga0501229_004060_409_1524 | 367 |
| 258 | 3300049764 | Ga0501267_000010 | Ga0501267_000010_1944_3059 | 367 |
| 259 | 3300050493 | nmdc:mga0k408_15219_c1 | nmdc:mga0k408_15219_c1_1023_2147 | 367 |
| 260 | 3300050493 | nmdc:mga0k408_153569_c1 | nmdc:mga0k408_153569_c1_199_1332 | 367 |
| 261 | 3300050496 | nmdc:mga07m45_1324_c1 | nmdc:mga07m45_1324_c1_5724_6881 | 367 |
| 262 | 3300050496 | nmdc:mga07m45_2734_c1 | nmdc:mga07m45_2734_c1_2277_3401 | 367 |
| 263 | 3300053080 | Ga0500635_0000065 | Ga0500635_0000065_11547_12668 | 367 |
| 264 | iso_pu_bacteria | 2643221544 | 2643745006 | 367 |
| 265 | 3300003794 | Ga0055531_10000048 | Ga0055531_1000004814 | 368 |
| 266 | 3300005262 | Ga0065165_1000814 | Ga0065165_100081435 | 368 |
| 267 | 3300005614 | Ga0068856_100045680 | Ga0068856_1000456803 | 368 |
| 268 | 3300005834 | Ga0068851_10000093 | Ga0068851_1000009313 | 368 |
| 269 | 3300005843 | Ga0068860_100071887 | Ga0068860_1000718872 | 368 |
| 270 | 3300013307 | Ga0157372_10178854 | Ga0157372_101788542 | 368 |
| 271 | 3300013307 | Ga0157372_10225795 | Ga0157372_102257952 | 368 |
| 272 | 3300025292 | Ga0209676_1002048 | Ga0209676_10020483 | 368 |
| 273 | 3300025294 | Ga0209025_1001439 | Ga0209025_100143911 | 368 |
| 274 | 3300025304 | Ga0209257_1000007 | Ga0209257_10000071316 | 368 |
| 275 | 3300025304 | Ga0209257_1001785 | Ga0209257_100178510 | 368 |
| 276 | 3300025321 | Ga0207656_10000036 | Ga0207656_1000003625 | 368 |
| 277 | 3300028381 | Ga0268264_10053365 | Ga0268264_100533652 | 368 |
| 278 | 3300031456 | Ga0307513_10007146 | Ga0307513_100071466 | 368 |
| 279 | 3300031507 | Ga0307509_10019267 | Ga0307509_100192673 | 368 |
| 280 | 3300031824 | Ga0307413_10017195 | Ga0307413_100171954 | 368 |
| 281 | 3300031901 | Ga0307406_10068586 | Ga0307406_100685862 | 368 |
| 282 | 3300044712 | Ga0453684_0001723 | Ga0453684_0001723_39355_40467 | 368 |
| 283 | 3300045051 | Ga0451576_0004854 | Ga0451576_0004854_7497_8609 | 368 |
| 284 | 3300048927 | Ga0496124_0000487 | Ga0496124_0000487_49926_51059 | 368 |
| 285 | 3300048928 | Ga0496125_0054498 | Ga0496125_0054498_1811_2944 | 368 |
| 286 | 3300049665 | Ga0501227_004934 | Ga0501227_004934_374_1501 | 368 |
| 287 | 2162886007 | SwRhRL2b_contig_1663050 | SwRhRL2b_0644.00006100 | 369 |
| 288 | 3300005289 | Ga0065704_10070140 | Ga0065704_10070140331 | 369 |
| 289 | 3300005841 | Ga0068863_100000449 | Ga0068863_10000044911 | 369 |
| 290 | 3300005841 | Ga0068863_100032922 | Ga0068863_1000329222 | 369 |
| 291 | 3300005843 | Ga0068860_100137983 | Ga0068860_1001379832 | 369 |
| 292 | 3300005844 | Ga0068862_100075394 | Ga0068862_1000753942 | 369 |
| 293 | 3300006237 | Ga0097621_100006001 | Ga0097621_1000060012 | 369 |
| 294 | 3300006358 | Ga0068871_100097140 | Ga0068871_1000971402 | 369 |
| 295 | 3300006931 | Ga0097620_100012023 | Ga0097620_1000120232 | 369 |
| 296 | 3300009176 | Ga0105242_10000158 | Ga0105242_1000015821 | 369 |
| 297 | 3300009553 | Ga0105249_10002034 | Ga0105249_1000203413 | 369 |
| 298 | 3300013102 | Ga0157371_10101674 | Ga0157371_101016741 | 369 |
| 299 | 3300013306 | Ga0163162_10096864 | Ga0163162_100968643 | 369 |
| 300 | 3300014969 | Ga0157376_10005761 | Ga0157376_100057613 | 369 |
| 301 | 3300025942 | Ga0207689_10084514 | Ga0207689_100845142 | 369 |
| 302 | 3300026088 | Ga0207641_10000111 | Ga0207641_1000011172 | 369 |
| 303 | 3300026088 | Ga0207641_10024191 | Ga0207641_100241917 | 369 |
| 304 | 3300028380 | Ga0268265_10083192 | Ga0268265_100831922 | 369 |
| 305 | 3300028381 | Ga0268264_10080551 | Ga0268264_100805513 | 369 |
| 306 | 3300028800 | Ga0265338_10015135 | Ga0265338_100151355 | 369 |
| 307 | 3300042007 | Ga0439449_0029056 | Ga0439449_0029056_586_1698 | 369 |
| 308 | 3300044712 | Ga0453684_0000584 | Ga0453684_0000584_19185_20306 | 369 |
| 309 | 3300050493 | nmdc:mga0k408_210889_c1 | nmdc:mga0k408_210889_c1_10_1143 | 369 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gpj-assembly1.cif.gz_A | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man | 0.9701 | 3 | 356 |
| 6q94-assembly3.cif.gz_H-2 | crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man | 0.9688 | 3 | 355 |
| 6gpl-assembly1.cif.gz_B | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man | 0.9678 | 3 | 356 |
| 6gpk-assembly1.cif.gz_C | crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man | 0.9621 | 3 | 356 |
| 6gpj-assembly1.cif.gz_A | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man | 0.9618 | 3 | 356 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AC88_3_270_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9845 | 3 | 268 | 3.40.50.720 |
| af_P0AC88_3_270_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9736 | 3 | 268 | 3.40.50.720 |
| af_Q4CM81_7_150_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9658 | 3 | 150 | 3.40.50.720 |
| af_Q4CM81_8_135_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9629 | 3 | 134 | 3.40.50.720 |
| 1db3A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 2 | 334 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A287VKI9-F1-model_v4 | deleted | 0.9958 | 159 | 268 |
|
| AF-A0A625RB69-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.995 | 58 | 192 |
GO:0008446
GO:0042351 |
| AF-A0A3A4XPU5-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9878 | 1 | 263 |
GO:0008446
GO:0042351 |
| AF-A0A625RB69-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9877 | 58 | 192 |
GO:0008446
GO:0042351 |
| AF-A0A382CEB6-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9872 | 61 | 229 |
GO:0008446
GO:0042351 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar