F400138

General Info

Members Datasets Scaffolds Average Seq Length
309 212 303 371

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10043221|Ga0075362_100432212
Length 365
Sequence LSPPVALITGVTGQDGAYLAELLIRKGYVVHGIKRRSSSFNTSRVDDLLDRQLKSGVPFHLHYGDLTDSMSLVRLVQSIQPTEIYNLGAQSHVMVSFETPEYTANADGTGALRLLDALRILGIEKRVRFYQASTSELYGSTPPPQSETTPFHPRSPYAVAKLYAYWIVVNYREAYGVHASNGILFNHESPLRGETFVTRKITRAVASIVRGEQKELCLGNLDARRDWGHAADYVEGMWMMLQRDVPDDFVLATGEAHSVREFVELAFQEVGVDIVWQGKGMDEIGVDARTGSALVRVDARYFRPTEVDYLLGDASKARRLLGWQHQISFKSLVSEMVQVDLALGENGHSVVGPKGVARRLSEVAD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221696 Nocardioides sp. Root140 Isolate Unclassified
5 2791355265 Rhizobium sp. H4 Isolate Nodule
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
143 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
144 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
194 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
195 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
196 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
211 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
212 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.86
Nodule 0.65
Rhizoplane 2.91
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 13.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI25156J39149_1000811 3300002705 Bacteria 15972
3 JGI25154J39366_1000524 3300002738 Bacteria 19275
4 JGI25157J39369_1000230 3300002741 Bacteria 43900
5 Ga0055539_1001560 3300003752 Bacteria 4154
6 Ga0055525_1000004 3300003759 Bacteria 888039
7 Ga0055535_1000079 3300003761 Bacteria 109482
8 Ga0055529_1000773 3300003763 Bacteria 20076
9 Ga0055526_1001313 3300003771 Bacteria 17819
10 Ga0055531_10000007 3300003794 Bacteria 225289
11 Ga0055531_10000048 3300003794 Bacteria 131142
12 Ga0055543_1005315 3300004625 Bacteria 3307
13 Ga0065165_1000016 3300005262 Bacteria 286248
14 Ga0065165_1000814 3300005262 Bacteria 41379
15 Ga0065165_1002843 3300005262 Bacteria 13478
16 Ga0065704_10070140 3300005289 Bacteria 482257
17 Ga0065715_10099473 3300005293 Bacteria 3386
18 Ga0070658_10199691 3300005327 Bacteria 1687
19 Ga0070690_100002055 3300005330 Bacteria 10742
20 Ga0070677_10043441 3300005333 Bacteria 1784
21 Ga0068869_100006082 3300005334 Bacteria 7630
22 Ga0070680_100007181 3300005336 Bacteria 8490
23 Ga0070660_100021905 3300005339 Bacteria 4720
24 Ga0070660_100037904 3300005339 Bacteria 3656
25 Ga0070673_100098348 3300005364 Bacteria 2405
26 Ga0070659_100011611 3300005366 Bacteria 6519
27 Ga0070659_100040675 3300005366 Bacteria 3633
28 Ga0070667_100000606 3300005367 Bacteria 34995
29 Ga0070667_100013211 3300005367 Bacteria 6824
30 Ga0070678_100006212 3300005456 Bacteria 6987
31 Ga0070681_10323871 3300005458 Bacteria 1451
32 Ga0070679_100005390 3300005530 Bacteria 11848
33 Ga0070679_100050147 3300005530 Bacteria 4158
34 Ga0068853_100023735 3300005539 Bacteria 5138
35 Ga0070672_100005989 3300005543 Bacteria 8115
36 Ga0070665_100188715 3300005548 Bacteria 2062
37 Ga0070665_100275562 3300005548 Bacteria 1684
38 Ga0068855_100001049 3300005563 Bacteria 34293
39 Ga0068855_100001983 3300005563 Bacteria 25432
40 Ga0068855_100011513 3300005563 Bacteria 10689
41 Ga0068855_100150903 3300005563 Bacteria 2643
42 Ga0070664_100057054 3300005564 Bacteria 3319
43 Ga0068857_100008945 3300005577 Bacteria 8676
44 Ga0068854_100009912 3300005578 Bacteria 6164
45 Ga0068856_100005509 3300005614 Bacteria 12463
46 Ga0068856_100045680 3300005614 Bacteria 4314
47 Ga0068861_100066504 3300005719 Bacteria 2779
48 Ga0068851_10000093 3300005834 Bacteria 49691
49 Ga0068863_100000449 3300005841 Bacteria 41845
50 Ga0068863_100032922 3300005841 Bacteria 4938
51 Ga0068863_100081598 3300005841 Bacteria 3063
52 Ga0068858_100000112 3300005842 Bacteria 86034
53 Ga0068860_100071887 3300005843 Bacteria 3287
54 Ga0068860_100137983 3300005843 Bacteria 2343
55 Ga0068862_100075394 3300005844 Bacteria 2918
56 Ga0068862_100255795 3300005844 Bacteria 1597
57 Ga0081455_10053681 3300005937 Bacteria 3441
58 Ga0075364_10205583 3300006051 Bacteria 1335
59 Ga0075362_10005250 3300006177 Bacteria 4725
60 Ga0075362_10043221 3300006177 Bacteria 1995
61 Ga0075369_10002972 3300006186 Bacteria 6126
62 Ga0075366_10055732 3300006195 Bacteria 2347
63 Ga0075366_10067842 3300006195 Bacteria 2123
64 Ga0097621_100006001 3300006237 Bacteria 8588
65 Ga0097621_100059978 3300006237 Bacteria 3117
66 Ga0068871_100007124 3300006358 Bacteria 7972
67 Ga0068871_100022570 3300006358 Bacteria 4854
68 Ga0068871_100097140 3300006358 Bacteria 2462
69 Ga0068871_100281168 3300006358 Bacteria 1456
70 Ga0075433_10133691 3300006852 Bacteria 2204
71 Ga0075434_100148080 3300006871 Bacteria 2368
72 Ga0068865_100074531 3300006881 Bacteria 2417
73 Ga0097620_100012023 3300006931 Bacteria 8696
74 Ga0075435_100080006 3300007076 Bacteria 2683
75 Ga0105250_10000032 3300009092 Bacteria 159642
76 Ga0105250_10008060 3300009092 Bacteria 4491
77 Ga0105240_10334700 3300009093 Bacteria 1721
78 Ga0105245_10002027 3300009098 Bacteria 18376
79 Ga0105245_10063712 3300009098 Bacteria 3330
80 Ga0105245_10114522 3300009098 Bacteria 2512
81 Ga0105245_10183685 3300009098 Bacteria 2000
82 Ga0105245_10284950 3300009098 Bacteria 1616
83 Ga0105243_10261635 3300009148 Bacteria 1549
84 Ga0105241_10025665 3300009174 Bacteria 4380
85 Ga0105242_10000158 3300009176 Bacteria 50486
86 Ga0105248_10004076 3300009177 Bacteria 16151
87 Ga0105237_10000448 3300009545 Bacteria 58618
88 Ga0105238_10014768 3300009551 Bacteria 7897
89 Ga0105249_10002034 3300009553 Bacteria 17542
90 Ga0099796_10034344 3300010159 Bacteria 1674
91 Ga0157371_10001648 3300013102 Bacteria 22775
92 Ga0157371_10002057 3300013102 Bacteria 19748
93 Ga0157371_10002793 3300013102 Bacteria 16372
94 Ga0157371_10012091 3300013102 Bacteria 6612
95 Ga0157371_10043180 3300013102 Bacteria 3212
96 Ga0157371_10101674 3300013102 Bacteria 2039
97 Ga0157370_10000510 3300013104 Bacteria 48462
98 Ga0157370_10277921 3300013104 Bacteria 1547
99 Ga0157369_10010080 3300013105 Bacteria 10791
100 Ga0157369_10047930 3300013105 Bacteria 4637
101 Ga0157374_10028020 3300013296 Bacteria 5088
102 Ga0157374_10148298 3300013296 Bacteria 2280
103 Ga0157378_10041078 3300013297 Bacteria 4102
104 Ga0157378_10064211 3300013297 Bacteria 3283
105 Ga0157378_10161482 3300013297 Bacteria 2096
106 Ga0157378_10185515 3300013297 Bacteria 1959
107 Ga0163162_10000845 3300013306 Bacteria 28442
108 Ga0163162_10096864 3300013306 Bacteria 3038
109 Ga0163162_10269087 3300013306 Bacteria 1836
110 Ga0157372_10000818 3300013307 Bacteria 33704
111 Ga0157372_10002511 3300013307 Bacteria 19897
112 Ga0157372_10011169 3300013307 Bacteria 9550
113 Ga0157372_10112690 3300013307 Bacteria 3117
114 Ga0157372_10161326 3300013307 Bacteria 2591
115 Ga0157372_10178854 3300013307 Bacteria 2455
116 Ga0157372_10225795 3300013307 Bacteria 2171
117 Ga0157375_10001840 3300013308 Bacteria 18237
118 Ga0157375_10101121 3300013308 Bacteria 2965
119 Ga0157379_10000004 3300014968 Bacteria 173351
120 Ga0157376_10005761 3300014969 Bacteria 8679
121 Ga0157376_10011325 3300014969 Bacteria 6570
122 Ga0213872_10000093 3300021361 Bacteria 83513
123 Ga0213872_10007291 3300021361 Bacteria 5458
124 Ga0213872_10011019 3300021361 Bacteria 4287
125 Ga0209563_100013 3300025230 Bacteria 941463
126 Ga0209258_100544 3300025242 Bacteria 34176
127 Ga0209646_1000198 3300025246 Bacteria 72654
128 Ga0209026_1000004 3300025250 Bacteria 949012
129 Ga0209677_100079 3300025253 Bacteria 121137
130 Ga0209148_1002662 3300025254 Bacteria 5753
131 Ga0209759_1000003 3300025256 Bacteria 792130
132 Ga0209759_1004148 3300025256 Bacteria 5522
133 Ga0209233_1000026 3300025261 Bacteria 678466
134 Ga0209233_1000028 3300025261 Bacteria 642062
135 Ga0209455_1000083 3300025272 Bacteria 255660
136 Ga0209673_1004826 3300025273 Bacteria 7065
137 Ga0209673_1005299 3300025273 Bacteria 6540
138 Ga0209676_1002048 3300025292 Bacteria 15760
139 Ga0209025_1001439 3300025294 Bacteria 31300
140 Ga0209564_1000008 3300025295 Bacteria 953227
141 Ga0209256_1001226 3300025299 Bacteria 28557
142 Ga0209257_1000007 3300025304 Bacteria 1564415
143 Ga0209257_1000021 3300025304 Bacteria 771986
144 Ga0209257_1001785 3300025304 Bacteria 23687
145 Ga0207697_10005892 3300025315 Bacteria 5628
146 Ga0207656_10000036 3300025321 Bacteria 61410
147 Ga0207696_1000198 3300025711 Bacteria 92750
148 Ga0207682_10002186 3300025893 Bacteria 8835
149 Ga0207695_10018954 3300025913 Bacteria 7937
150 Ga0207671_10000006 3300025914 Bacteria 836809
151 Ga0207671_10011020 3300025914 Bacteria 7402
152 Ga0207652_10004720 3300025921 Bacteria 11046
153 Ga0207650_10002944 3300025925 Bacteria 11746
154 Ga0207659_10034840 3300025926 Bacteria 3475
155 Ga0207687_10008637 3300025927 Bacteria 6658
156 Ga0207687_10068495 3300025927 Bacteria 2528
157 Ga0207644_10018721 3300025931 Bacteria 4688
158 Ga0207686_10007470 3300025934 Bacteria 5883
159 Ga0207709_10170042 3300025935 Bacteria 1528
160 Ga0207704_10029414 3300025938 Bacteria 3064
161 Ga0207691_10000964 3300025940 Bacteria 28552
162 Ga0207711_10062253 3300025941 Bacteria 3218
163 Ga0207689_10037507 3300025942 Bacteria 4020
164 Ga0207689_10084514 3300025942 Bacteria 2609
165 Ga0207689_10164214 3300025942 Bacteria 1830
166 Ga0207651_10001048 3300025960 Bacteria 12244
167 Ga0207640_10011688 3300025981 Bacteria 4977
168 Ga0207658_10001958 3300025986 Bacteria 15365
169 Ga0207703_10001786 3300026035 Bacteria 19182
170 Ga0207678_10044139 3300026067 Bacteria 3856
171 Ga0207702_10001467 3300026078 Bacteria 23409
172 Ga0207641_10000111 3300026088 Bacteria 120527
173 Ga0207641_10024191 3300026088 Bacteria 5006
174 Ga0207648_10016260 3300026089 Bacteria 6806
175 Ga0207675_100012149 3300026118 Bacteria 8043
176 Ga0207675_100090375 3300026118 Bacteria 2879
177 Ga0207675_100094178 3300026118 Bacteria 2818
178 Ga0207683_10009394 3300026121 Bacteria 8332
179 Ga0207698_10127288 3300026142 Bacteria 2169
180 Ga0209588_1024608 3300027671 Bacteria 1901
181 Ga0209588_1034894 3300027671 Bacteria 1616
182 Ga0268266_10154739 3300028379 Bacteria 2070
183 Ga0268265_10083192 3300028380 Bacteria 2533
184 Ga0268264_10053365 3300028381 Bacteria 3372
185 Ga0268264_10080551 3300028381 Bacteria 2781
186 Ga0268264_10388548 3300028381 Bacteria 1338
187 Ga0307517_10045002 3300028786 Bacteria 4650
188 Ga0307515_10002251 3300028794 Bacteria 42303
189 Ga0307515_10004349 3300028794 Bacteria 29393
190 Ga0307515_10188353 3300028794 Bacteria 1984
191 Ga0265338_10015135 3300028800 Bacteria 8508
192 Ga0307511_10058082 3300030521 Bacteria 2996
193 Ga0307513_10007146 3300031456 Bacteria 14517
194 Ga0307513_10008378 3300031456 Bacteria 13239
195 Ga0307513_10024220 3300031456 Bacteria 7067
196 Ga0307509_10019267 3300031507 Bacteria 7790
197 Ga0307508_10000760 3300031616 Bacteria 38152
198 Ga0307508_10070546 3300031616 Bacteria 3067
199 Ga0307516_10000461 3300031730 Bacteria 53797
200 Ga0307516_10000984 3300031730 Bacteria 39418
201 Ga0307516_10023814 3300031730 Bacteria 6265
202 Ga0307413_10017195 3300031824 Bacteria 3761
203 Ga0307406_10068586 3300031901 Bacteria 2316
204 Ga0307510_10211922 3300033180 Bacteria 1458
205 Ga0316574_0090042 3300035398 Bacteria 1955
206 Ga0373927_0013341 3300035695 Bacteria 5463
207 Ga0373937_0153683 3300036401 Bacteria 2156
208 Ga0316584_0042213 3300036712 Bacteria 3401
209 Ga0395905_0001972 3300037471 Bacteria 23457
210 Ga0395905_0027937 3300037471 Bacteria 5320
211 Ga0395905_0067273 3300037471 Bacteria 3356
212 Ga0400488_08713 3300038741 Bacteria 1919
213 Ga0400483_028180 3300039062 Bacteria 30548
214 Ga0400487_01073 3300039110 Bacteria 19698
215 Ga0436361_0024534 3300039447 Bacteria 2953
216 Ga0436361_0135223 3300039447 Bacteria 18748
217 Ga0436361_0403975 3300039447 Bacteria 2039
218 Ga0436361_0507639 3300039447 Bacteria 35242
219 Ga0439449_0029056 3300042007 Bacteria 2060
220 Ga0439459_0005902 3300042438 Bacteria 2026
221 Ga0466969_0001057 3300044656 Bacteria 14871
222 Ga0466972_0000138 3300044658 Bacteria 59590
223 Ga0466961_0000714 3300044693 Bacteria 20956
224 Ga0453684_0000584 3300044712 Bacteria 135892
225 Ga0453684_0001723 3300044712 Bacteria 58623
226 Ga0466968_0012561 3300044735 Bacteria 3318
227 Ga0466959_0000604 3300045049 Bacteria 20935
228 Ga0451576_0004854 3300045051 Bacteria 17225
229 Ga0495592_0036995 3300046454 Bacteria 3675
230 Ga0495638_0000228 3300046460 Bacteria 76924
231 Ga0495638_0002175 3300046460 Bacteria 16437
232 Ga0495580_0112295 3300046472 Bacteria 1893
233 Ga0495583_0000173 3300046506 Bacteria 109405
234 Ga0495583_0006628 3300046506 Bacteria 7519
235 Ga0495606_0004328 3300046507 Bacteria 14279
236 Ga0495630_0049068 3300046517 Bacteria 3159
237 Ga0495632_0015654 3300046519 Bacteria 4241
238 Ga0495648_0000591 3300046524 Bacteria 38811
239 Ga0495663_0014091 3300046525 Bacteria 2239
240 Ga0495668_0023960 3300046616 Bacteria 3474
241 Ga0495668_0033833 3300046616 Bacteria 2870
242 Ga0495625_0000054 3300046660 Bacteria 187599
243 Ga0495625_0016096 3300046660 Bacteria 5893
244 Ga0495670_0004714 3300046691 Bacteria 6695
245 Ga0495670_0010022 3300046691 Bacteria 4660
246 Ga0495649_0000136 3300046694 Bacteria 64021
247 Ga0495589_0002439 3300046794 Bacteria 10439
248 Ga0495687_000811 3300047443 Bacteria 33635
249 Ga0496100_0032709 3300048903 Bacteria 3247
250 Ga0496108_0169241 3300048911 Bacteria 1890
251 Ga0496109_0127513 3300048912 Bacteria 2373
252 Ga0496109_0214113 3300048912 Bacteria 1812
253 Ga0496111_0057171 3300048914 Bacteria 2824
254 Ga0496113_0093085 3300048916 Bacteria 2326
255 Ga0496114_0000294 3300048917 Bacteria 36628
256 Ga0496114_0233628 3300048917 Bacteria 1616
257 Ga0496115_0196676 3300048918 Bacteria 1666
258 Ga0496116_0046836 3300048919 Bacteria 2915
259 Ga0496117_0024213 3300048920 Bacteria 4809
260 Ga0496119_0021175 3300048922 Bacteria 4710
261 Ga0496120_0032269 3300048923 Bacteria 3160
262 Ga0496121_0008741 3300048924 Bacteria 11815
263 Ga0496121_0058099 3300048924 Bacteria 3201
264 Ga0496122_0020968 3300048925 Bacteria 5872
265 Ga0496122_0022290 3300048925 Bacteria 5636
266 Ga0496123_0065952 3300048926 Bacteria 2297
267 Ga0496124_0000487 3300048927 Bacteria 68031
268 Ga0496124_0013995 3300048927 Bacteria 7786
269 Ga0496125_0000145 3300048928 Bacteria 156267
270 Ga0496125_0046709 3300048928 Bacteria 3629
271 Ga0496125_0054498 3300048928 Bacteria 3267
272 Ga0496126_0003992 3300048929 Bacteria 18025
273 Ga0501300_004011 3300049523 Bacteria 2189
274 Ga0501301_000927 3300049524 Bacteria 1825
275 Ga0501223_000345 3300049663 Bacteria 11469
276 Ga0501223_003766 3300049663 Bacteria 3276
277 Ga0501227_004934 3300049665 Bacteria 2862
278 Ga0501233_001807 3300049668 Bacteria 3706
279 Ga0501235_000214 3300049669 Bacteria 10394
280 Ga0501236_000838 3300049670 Bacteria 3441
281 Ga0501221_000039 3300049704 Bacteria 12978
282 Ga0501229_000016 3300049706 Bacteria 20611
283 Ga0501229_004060 3300049706 Bacteria 1772
284 Ga0501267_000010 3300049764 Bacteria 13676
285 Ga0501044_0109197 3300049823 Bacteria 2776
286 Ga0501226_001569 3300049853 Bacteria 2901
287 nmdc:mga0k408_15219_c1 3300050493 Bacteria 2738
288 nmdc:mga0k408_153569_c1 3300050493 Bacteria 1371
289 nmdc:mga0k408_210889_c1 3300050493 Bacteria 1160
290 nmdc:mga07m45_1324_c1 3300050496 Bacteria 11280
291 nmdc:mga07m45_2734_c1 3300050496 Bacteria 8314
292 nmdc:mga0n895_194177_c1 3300050512 Bacteria 2061
293 nmdc:mga0sz30_2265_c1 3300050516 Bacteria 4489
294 Ga0495601_0018427 3300053077 Bacteria 4250
295 Ga0500635_0000065 3300053080 Bacteria 69362
296 Ga0500641_0029882 3300053096 Bacteria 2138
297 Ga0500618_000953 3300053125 Bacteria 14796
298 Ga0500658_0000400 3300053134 Bacteria 18787
299 Ga0500559_0020237 3300053136 Bacteria 2814
300 Ga0500559_0034272 3300053136 Bacteria 2189
301 Ga0500568_0048165 3300053139 Bacteria 1686
302 Ga0500627_0020567 3300053158 Bacteria 2648
303 Ga0500587_007026 3300053739 Bacteria 1476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221561 2643827278 316
2 iso_pu_bacteria 2643221696 2644533895 316
3 3300006051 Ga0075364_10205583 Ga0075364_102055832 344
4 3300006177 Ga0075362_10005250 Ga0075362_100052504 344
5 3300046506 Ga0495583_0006628 Ga0495583_0006628_1612_2718 349
6 3300046616 Ga0495668_0033833 Ga0495668_0033833_1470_2576 349
7 3300046660 Ga0495625_0016096 Ga0495625_0016096_94_1200 349
8 3300050516 nmdc:mga0sz30_2265_c1 nmdc:mga0sz30_2265_c1_1481_2560 349
9 3300025921 Ga0207652_10004720 Ga0207652_1000472013 351
10 3300025261 Ga0209233_1000028 Ga0209233_1000028384 352
11 3300048919 Ga0496116_0046836 Ga0496116_0046836_706_1857 352
12 3300048922 Ga0496119_0021175 Ga0496119_0021175_724_1863 352
13 3300048923 Ga0496120_0032269 Ga0496120_0032269_823_1962 352
14 3300048924 Ga0496121_0058099 Ga0496121_0058099_1169_2320 352
15 3300048925 Ga0496122_0022290 Ga0496122_0022290_1928_3079 352
16 3300048926 Ga0496123_0065952 Ga0496123_0065952_639_1790 352
17 3300048929 Ga0496126_0003992 Ga0496126_0003992_15595_16746 352
18 3300010159 Ga0099796_10034344 Ga0099796_100343442 353
19 3300027671 Ga0209588_1024608 Ga0209588_10246082 353
20 3300035695 Ga0373927_0013341 Ga0373927_0013341_1752_2846 353
21 3300039062 Ga0400483_028180 Ga0400483_028180_1710_2864 353
22 3300048911 Ga0496108_0169241 Ga0496108_0169241_95_1213 353
23 3300048912 Ga0496109_0127513 Ga0496109_0127513_688_1806 353
24 3300006177 Ga0075362_10043221 Ga0075362_100432212 354
25 3300006186 Ga0075369_10002972 Ga0075369_100029725 354
26 3300006237 Ga0097621_100059978 Ga0097621_1000599783 354
27 3300006358 Ga0068871_100022570 Ga0068871_1000225704 354
28 3300013297 Ga0157378_10064211 Ga0157378_100642113 354
29 3300005548 Ga0070665_100275562 Ga0070665_1002755622 355
30 3300005841 Ga0068863_100081598 Ga0068863_1000815981 355
31 3300048924 Ga0496121_0008741 Ga0496121_0008741_9298_10530 355
32 3300048928 Ga0496125_0000145 Ga0496125_0000145_130813_132018 355
33 3300053125 Ga0500618_000953 Ga0500618_000953_13150_14247 355
34 3300005719 Ga0068861_100066504 Ga0068861_1000665042 356
35 3300006852 Ga0075433_10133691 Ga0075433_101336912 356
36 3300006871 Ga0075434_100148080 Ga0075434_1001480802 356
37 3300007076 Ga0075435_100080006 Ga0075435_1000800062 356
38 3300009098 Ga0105245_10183685 Ga0105245_101836851 356
39 3300013308 Ga0157375_10101121 Ga0157375_101011212 356
40 3300026118 Ga0207675_100094178 Ga0207675_1000941782 356
41 3300046472 Ga0495580_0112295 Ga0495580_0112295_720_1811 356
42 3300048912 Ga0496109_0214113 Ga0496109_0214113_539_1630 356
43 3300048914 Ga0496111_0057171 Ga0496111_0057171_1575_2666 356
44 3300048916 Ga0496113_0093085 Ga0496113_0093085_1177_2268 356
45 3300050512 nmdc:mga0n895_194177_c1 nmdc:mga0n895_194177_c1_917_2008 356
46 3300005937 Ga0081455_10053681 Ga0081455_100536812 357
47 3300006358 Ga0068871_100281168 Ga0068871_1002811681 357
48 3300025942 Ga0207689_10164214 Ga0207689_101642142 357
49 3300049823 Ga0501044_0109197 Ga0501044_0109197_752_1858 357
50 3300026118 Ga0207675_100090375 Ga0207675_1000903752 358
51 3300028381 Ga0268264_10388548 Ga0268264_103885481 358
52 3300031616 Ga0307508_10070546 Ga0307508_100705463 358
53 iso_pu_bacteria 2791355265 2793356584 358
54 iso_pu_bacteria 8056382006 8056383839 358
55 3300004625 Ga0055543_1005315 Ga0055543_10053152 360
56 3300005262 Ga0065165_1000016 Ga0065165_1000016100 360
57 3300005336 Ga0070680_100007181 Ga0070680_1000071814 360
58 3300005339 Ga0070660_100021905 Ga0070660_1000219054 360
59 3300005339 Ga0070660_100037904 Ga0070660_1000379043 360
60 3300005366 Ga0070659_100011611 Ga0070659_1000116114 360
61 3300005366 Ga0070659_100040675 Ga0070659_1000406753 360
62 3300005458 Ga0070681_10323871 Ga0070681_103238711 360
63 3300005530 Ga0070679_100005390 Ga0070679_1000053902 360
64 3300005530 Ga0070679_100050147 Ga0070679_1000501473 360
65 3300005539 Ga0068853_100023735 Ga0068853_1000237353 360
66 3300005563 Ga0068855_100001049 Ga0068855_10000104928 360
67 3300005563 Ga0068855_100001983 Ga0068855_1000019837 360
68 3300005563 Ga0068855_100011513 Ga0068855_1000115138 360
69 3300005563 Ga0068855_100150903 Ga0068855_1001509033 360
70 3300013102 Ga0157371_10001648 Ga0157371_100016482 360
71 3300013102 Ga0157371_10002057 Ga0157371_1000205716 360
72 3300013102 Ga0157371_10002793 Ga0157371_1000279310 360
73 3300013102 Ga0157371_10012091 Ga0157371_100120914 360
74 3300013102 Ga0157371_10043180 Ga0157371_100431803 360
75 3300013104 Ga0157370_10000510 Ga0157370_1000051035 360
76 3300013104 Ga0157370_10277921 Ga0157370_102779211 360
77 3300013105 Ga0157369_10010080 Ga0157369_100100804 360
78 3300013307 Ga0157372_10000818 Ga0157372_1000081811 360
79 3300013307 Ga0157372_10002511 Ga0157372_100025113 360
80 3300013307 Ga0157372_10011169 Ga0157372_100111694 360
81 3300013307 Ga0157372_10161326 Ga0157372_101613262 360
82 3300044658 Ga0466972_0000138 Ga0466972_0000138_43024_44124 360
83 3300046454 Ga0495592_0036995 Ga0495592_0036995_474_1565 360
84 3300046517 Ga0495630_0049068 Ga0495630_0049068_1423_2514 360
85 3300053077 Ga0495601_0018427 Ga0495601_0018427_2855_3946 360
86 3300009545 Ga0105237_10000448 Ga0105237_1000044829 361
87 3300013297 Ga0157378_10185515 Ga0157378_101855151 361
88 3300013307 Ga0157372_10112690 Ga0157372_101126903 361
89 3300025914 Ga0207671_10000006 Ga0207671_10000006778 361
90 3300027671 Ga0209588_1034894 Ga0209588_10348942 361
91 3300039110 Ga0400487_01073 Ga0400487_01073_16823_17923 361
92 3300046524 Ga0495648_0000591 Ga0495648_0000591_3408_4499 361
93 3300048920 Ga0496117_0024213 Ga0496117_0024213_2886_3977 361
94 3300049663 Ga0501223_000345 Ga0501223_000345_6841_7932 361
95 3300049853 Ga0501226_001569 Ga0501226_001569_1537_2628 361
96 3300053158 Ga0500627_0020567 Ga0500627_0020567_329_1420 361
97 3300003771 Ga0055526_1001313 Ga0055526_10013138 362
98 3300005327 Ga0070658_10199691 Ga0070658_101996912 362
99 3300005367 Ga0070667_100013211 Ga0070667_1000132115 362
100 3300005842 Ga0068858_100000112 Ga0068858_10000011269 362
101 3300005844 Ga0068862_100255795 Ga0068862_1002557951 362
102 3300009093 Ga0105240_10334700 Ga0105240_103347002 362
103 3300009098 Ga0105245_10002027 Ga0105245_100020279 362
104 3300009098 Ga0105245_10063712 Ga0105245_100637122 362
105 3300009148 Ga0105243_10261635 Ga0105243_102616352 362
106 3300013296 Ga0157374_10028020 Ga0157374_100280202 362
107 3300013296 Ga0157374_10148298 Ga0157374_101482982 362
108 3300013297 Ga0157378_10161482 Ga0157378_101614822 362
109 3300021361 Ga0213872_10007291 Ga0213872_100072913 362
110 3300025261 Ga0209233_1000026 Ga0209233_1000026424 362
111 3300025273 Ga0209673_1004826 Ga0209673_10048262 362
112 3300025295 Ga0209564_1000008 Ga0209564_1000008439 362
113 3300025927 Ga0207687_10008637 Ga0207687_100086375 362
114 3300025927 Ga0207687_10068495 Ga0207687_100684952 362
115 3300025935 Ga0207709_10170042 Ga0207709_101700422 362
116 3300026035 Ga0207703_10001786 Ga0207703_1000178611 362
117 3300031616 Ga0307508_10000760 Ga0307508_100007609 362
118 3300036401 Ga0373937_0153683 Ga0373937_0153683_802_1902 362
119 3300038741 Ga0400488_08713 Ga0400488_08713_67_1185 362
120 3300039447 Ga0436361_0024534 Ga0436361_0024534_1805_2908 362
121 3300039447 Ga0436361_0507639 Ga0436361_0507639_19451_20551 362
122 3300046460 Ga0495638_0000228 Ga0495638_0000228_75560_76675 362
123 3300046525 Ga0495663_0014091 Ga0495663_0014091_128_1243 362
124 3300046660 Ga0495625_0000054 Ga0495625_0000054_181259_182359 362
125 3300046691 Ga0495670_0004714 Ga0495670_0004714_4609_5709 362
126 3300048917 Ga0496114_0000294 Ga0496114_0000294_7059_8159 362
127 3300048918 Ga0496115_0196676 Ga0496115_0196676_28_1128 362
128 3300048925 Ga0496122_0020968 Ga0496122_0020968_645_1820 362
129 3300048928 Ga0496125_0046709 Ga0496125_0046709_959_2056 362
130 3300053096 Ga0500641_0029882 Ga0500641_0029882_773_1888 362
131 3300053134 Ga0500658_0000400 Ga0500658_0000400_17537_18652 362
132 3300053136 Ga0500559_0020237 Ga0500559_0020237_608_1708 362
133 3300053136 Ga0500559_0034272 Ga0500559_0034272_265_1365 362
134 3300053139 Ga0500568_0048165 Ga0500568_0048165_46_1161 362
135 3300053739 Ga0500587_007026 Ga0500587_007026_283_1383 362
136 3300031730 Ga0307516_10023814 Ga0307516_100238145 363
137 3300035398 Ga0316574_0090042 Ga0316574_0090042_126_1226 364
138 3300003794 Ga0055531_10000007 Ga0055531_10000007105 366
139 3300005548 Ga0070665_100188715 Ga0070665_1001887152 366
140 3300009092 Ga0105250_10008060 Ga0105250_100080603 366
141 3300009098 Ga0105245_10114522 Ga0105245_101145222 366
142 3300009177 Ga0105248_10004076 Ga0105248_1000407613 366
143 3300013306 Ga0163162_10000845 Ga0163162_100008452 366
144 3300013308 Ga0157375_10001840 Ga0157375_100018406 366
145 3300025304 Ga0209257_1000021 Ga0209257_1000021123 366
146 3300025941 Ga0207711_10062253 Ga0207711_100622532 366
147 3300026067 Ga0207678_10044139 Ga0207678_100441395 366
148 3300028379 Ga0268266_10154739 Ga0268266_101547392 366
149 3300028794 Ga0307515_10188353 Ga0307515_101883532 366
150 3300031456 Ga0307513_10008378 Ga0307513_100083785 366
151 3300046460 Ga0495638_0002175 Ga0495638_0002175_12625_13737 366
152 3300046691 Ga0495670_0010022 Ga0495670_0010022_226_1338 366
153 3300046794 Ga0495589_0002439 Ga0495589_0002439_3586_4698 366
154 3300048903 Ga0496100_0032709 Ga0496100_0032709_1450_2562 366
155 3300048917 Ga0496114_0233628 Ga0496114_0233628_15_1127 366
156 3300002705 JGI25156J39149_1000811 JGI25156J39149_100081110 367
157 3300002738 JGI25154J39366_1000524 JGI25154J39366_100052416 367
158 3300002741 JGI25157J39369_1000230 JGI25157J39369_100023010 367
159 3300003752 Ga0055539_1001560 Ga0055539_10015603 367
160 3300003759 Ga0055525_1000004 Ga0055525_1000004439 367
161 3300003761 Ga0055535_1000079 Ga0055535_100007983 367
162 3300003763 Ga0055529_1000773 Ga0055529_10007735 367
163 3300005262 Ga0065165_1002843 Ga0065165_10028433 367
164 3300005293 Ga0065715_10099473 Ga0065715_100994731 367
165 3300005330 Ga0070690_100002055 Ga0070690_1000020555 367
166 3300005333 Ga0070677_10043441 Ga0070677_100434412 367
167 3300005334 Ga0068869_100006082 Ga0068869_1000060826 367
168 3300005364 Ga0070673_100098348 Ga0070673_1000983482 367
169 3300005367 Ga0070667_100000606 Ga0070667_10000060629 367
170 3300005456 Ga0070678_100006212 Ga0070678_1000062122 367
171 3300005543 Ga0070672_100005989 Ga0070672_1000059898 367
172 3300005564 Ga0070664_100057054 Ga0070664_1000570544 367
173 3300005577 Ga0068857_100008945 Ga0068857_1000089455 367
174 3300005578 Ga0068854_100009912 Ga0068854_1000099125 367
175 3300005614 Ga0068856_100005509 Ga0068856_1000055095 367
176 3300006195 Ga0075366_10055732 Ga0075366_100557323 367
177 3300006195 Ga0075366_10067842 Ga0075366_100678422 367
178 3300006358 Ga0068871_100007124 Ga0068871_1000071247 367
179 3300006881 Ga0068865_100074531 Ga0068865_1000745312 367
180 3300009092 Ga0105250_10000032 Ga0105250_1000003289 367
181 3300009098 Ga0105245_10284950 Ga0105245_102849502 367
182 3300009174 Ga0105241_10025665 Ga0105241_100256652 367
183 3300009551 Ga0105238_10014768 Ga0105238_100147685 367
184 3300013105 Ga0157369_10047930 Ga0157369_100479304 367
185 3300013297 Ga0157378_10041078 Ga0157378_100410782 367
186 3300013306 Ga0163162_10269087 Ga0163162_102690872 367
187 3300014968 Ga0157379_10000004 Ga0157379_1000000480 367
188 3300014969 Ga0157376_10011325 Ga0157376_100113255 367
189 3300021361 Ga0213872_10000093 Ga0213872_1000009350 367
190 3300021361 Ga0213872_10011019 Ga0213872_100110194 367
191 3300025230 Ga0209563_100013 Ga0209563_100013439 367
192 3300025230 Ga0209563_100013 Ga0209563_100013509 367
193 3300025242 Ga0209258_100544 Ga0209258_10054412 367
194 3300025246 Ga0209646_1000198 Ga0209646_100019810 367
195 3300025250 Ga0209026_1000004 Ga0209026_1000004625 367
196 3300025253 Ga0209677_100079 Ga0209677_10007939 367
197 3300025254 Ga0209148_1002662 Ga0209148_10026623 367
198 3300025256 Ga0209759_1000003 Ga0209759_100000399 367
199 3300025256 Ga0209759_1004148 Ga0209759_10041485 367
200 3300025272 Ga0209455_1000083 Ga0209455_100008347 367
201 3300025273 Ga0209673_1005299 Ga0209673_10052995 367
202 3300025299 Ga0209256_1001226 Ga0209256_100122626 367
203 3300025315 Ga0207697_10005892 Ga0207697_100058924 367
204 3300025711 Ga0207696_1000198 Ga0207696_10001987 367
205 3300025893 Ga0207682_10002186 Ga0207682_100021865 367
206 3300025913 Ga0207695_10018954 Ga0207695_100189546 367
207 3300025914 Ga0207671_10011020 Ga0207671_100110205 367
208 3300025925 Ga0207650_10002944 Ga0207650_100029444 367
209 3300025926 Ga0207659_10034840 Ga0207659_100348402 367
210 3300025931 Ga0207644_10018721 Ga0207644_100187214 367
211 3300025934 Ga0207686_10007470 Ga0207686_100074702 367
212 3300025938 Ga0207704_10029414 Ga0207704_100294142 367
213 3300025940 Ga0207691_10000964 Ga0207691_1000096410 367
214 3300025942 Ga0207689_10037507 Ga0207689_100375073 367
215 3300025960 Ga0207651_10001048 Ga0207651_100010484 367
216 3300025981 Ga0207640_10011688 Ga0207640_100116882 367
217 3300025986 Ga0207658_10001958 Ga0207658_100019583 367
218 3300026078 Ga0207702_10001467 Ga0207702_1000146716 367
219 3300026089 Ga0207648_10016260 Ga0207648_100162604 367
220 3300026118 Ga0207675_100012149 Ga0207675_1000121495 367
221 3300026121 Ga0207683_10009394 Ga0207683_100093944 367
222 3300026142 Ga0207698_10127288 Ga0207698_101272882 367
223 3300028786 Ga0307517_10045002 Ga0307517_100450023 367
224 3300028794 Ga0307515_10002251 Ga0307515_1000225136 367
225 3300028794 Ga0307515_10004349 Ga0307515_1000434920 367
226 3300030521 Ga0307511_10058082 Ga0307511_100580822 367
227 3300031456 Ga0307513_10024220 Ga0307513_100242204 367
228 3300031730 Ga0307516_10000461 Ga0307516_100004616 367
229 3300031730 Ga0307516_10000984 Ga0307516_100009842 367
230 3300033180 Ga0307510_10211922 Ga0307510_102119222 367
231 3300036712 Ga0316584_0042213 Ga0316584_0042213_119_1273 367
232 3300037471 Ga0395905_0001972 Ga0395905_0001972_18172_19296 367
233 3300037471 Ga0395905_0027937 Ga0395905_0027937_2870_3991 367
234 3300037471 Ga0395905_0067273 Ga0395905_0067273_850_1974 367
235 3300039447 Ga0436361_0135223 Ga0436361_0135223_14158_15282 367
236 3300039447 Ga0436361_0403975 Ga0436361_0403975_639_1760 367
237 3300042438 Ga0439459_0005902 Ga0439459_0005902_465_1589 367
238 3300044656 Ga0466969_0001057 Ga0466969_0001057_10562_11683 367
239 3300044693 Ga0466961_0000714 Ga0466961_0000714_4059_5180 367
240 3300044735 Ga0466968_0012561 Ga0466968_0012561_1351_2481 367
241 3300045049 Ga0466959_0000604 Ga0466959_0000604_4059_5180 367
242 3300046506 Ga0495583_0000173 Ga0495583_0000173_94909_96030 367
243 3300046507 Ga0495606_0004328 Ga0495606_0004328_12808_13929 367
244 3300046519 Ga0495632_0015654 Ga0495632_0015654_2635_3756 367
245 3300046616 Ga0495668_0023960 Ga0495668_0023960_979_2100 367
246 3300046694 Ga0495649_0000136 Ga0495649_0000136_49985_51106 367
247 3300047443 Ga0495687_000811 Ga0495687_000811_9929_11053 367
248 3300048927 Ga0496124_0013995 Ga0496124_0013995_6650_7774 367
249 3300049523 Ga0501300_004011 Ga0501300_004011_471_1595 367
250 3300049524 Ga0501301_000927 Ga0501301_000927_471_1595 367
251 3300049663 Ga0501223_003766 Ga0501223_003766_368_1492 367
252 3300049668 Ga0501233_001807 Ga0501233_001807_1165_2280 367
253 3300049669 Ga0501235_000214 Ga0501235_000214_4496_5620 367
254 3300049670 Ga0501236_000838 Ga0501236_000838_543_1658 367
255 3300049704 Ga0501221_000039 Ga0501221_000039_6925_8049 367
256 3300049706 Ga0501229_000016 Ga0501229_000016_4942_6066 367
257 3300049706 Ga0501229_004060 Ga0501229_004060_409_1524 367
258 3300049764 Ga0501267_000010 Ga0501267_000010_1944_3059 367
259 3300050493 nmdc:mga0k408_15219_c1 nmdc:mga0k408_15219_c1_1023_2147 367
260 3300050493 nmdc:mga0k408_153569_c1 nmdc:mga0k408_153569_c1_199_1332 367
261 3300050496 nmdc:mga07m45_1324_c1 nmdc:mga07m45_1324_c1_5724_6881 367
262 3300050496 nmdc:mga07m45_2734_c1 nmdc:mga07m45_2734_c1_2277_3401 367
263 3300053080 Ga0500635_0000065 Ga0500635_0000065_11547_12668 367
264 iso_pu_bacteria 2643221544 2643745006 367
265 3300003794 Ga0055531_10000048 Ga0055531_1000004814 368
266 3300005262 Ga0065165_1000814 Ga0065165_100081435 368
267 3300005614 Ga0068856_100045680 Ga0068856_1000456803 368
268 3300005834 Ga0068851_10000093 Ga0068851_1000009313 368
269 3300005843 Ga0068860_100071887 Ga0068860_1000718872 368
270 3300013307 Ga0157372_10178854 Ga0157372_101788542 368
271 3300013307 Ga0157372_10225795 Ga0157372_102257952 368
272 3300025292 Ga0209676_1002048 Ga0209676_10020483 368
273 3300025294 Ga0209025_1001439 Ga0209025_100143911 368
274 3300025304 Ga0209257_1000007 Ga0209257_10000071316 368
275 3300025304 Ga0209257_1001785 Ga0209257_100178510 368
276 3300025321 Ga0207656_10000036 Ga0207656_1000003625 368
277 3300028381 Ga0268264_10053365 Ga0268264_100533652 368
278 3300031456 Ga0307513_10007146 Ga0307513_100071466 368
279 3300031507 Ga0307509_10019267 Ga0307509_100192673 368
280 3300031824 Ga0307413_10017195 Ga0307413_100171954 368
281 3300031901 Ga0307406_10068586 Ga0307406_100685862 368
282 3300044712 Ga0453684_0001723 Ga0453684_0001723_39355_40467 368
283 3300045051 Ga0451576_0004854 Ga0451576_0004854_7497_8609 368
284 3300048927 Ga0496124_0000487 Ga0496124_0000487_49926_51059 368
285 3300048928 Ga0496125_0054498 Ga0496125_0054498_1811_2944 368
286 3300049665 Ga0501227_004934 Ga0501227_004934_374_1501 368
287 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00006100 369
288 3300005289 Ga0065704_10070140 Ga0065704_10070140331 369
289 3300005841 Ga0068863_100000449 Ga0068863_10000044911 369
290 3300005841 Ga0068863_100032922 Ga0068863_1000329222 369
291 3300005843 Ga0068860_100137983 Ga0068860_1001379832 369
292 3300005844 Ga0068862_100075394 Ga0068862_1000753942 369
293 3300006237 Ga0097621_100006001 Ga0097621_1000060012 369
294 3300006358 Ga0068871_100097140 Ga0068871_1000971402 369
295 3300006931 Ga0097620_100012023 Ga0097620_1000120232 369
296 3300009176 Ga0105242_10000158 Ga0105242_1000015821 369
297 3300009553 Ga0105249_10002034 Ga0105249_1000203413 369
298 3300013102 Ga0157371_10101674 Ga0157371_101016741 369
299 3300013306 Ga0163162_10096864 Ga0163162_100968643 369
300 3300014969 Ga0157376_10005761 Ga0157376_100057613 369
301 3300025942 Ga0207689_10084514 Ga0207689_100845142 369
302 3300026088 Ga0207641_10000111 Ga0207641_1000011172 369
303 3300026088 Ga0207641_10024191 Ga0207641_100241917 369
304 3300028380 Ga0268265_10083192 Ga0268265_100831922 369
305 3300028381 Ga0268264_10080551 Ga0268264_100805513 369
306 3300028800 Ga0265338_10015135 Ga0265338_100151355 369
307 3300042007 Ga0439449_0029056 Ga0439449_0029056_586_1698 369
308 3300044712 Ga0453684_0000584 Ga0453684_0000584_19185_20306 369
309 3300050493 nmdc:mga0k408_210889_c1 nmdc:mga0k408_210889_c1_10_1143 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

7

336

0.99

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

252

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.9701 3 356
6q94-assembly3.cif.gz_H-2 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9688 3 355
6gpl-assembly1.cif.gz_B crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man 0.9678 3 356
6gpk-assembly1.cif.gz_C crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.9621 3 356
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.9618 3 356
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9845 3 268 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9736 3 268 3.40.50.720
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 3 150 3.40.50.720
af_Q4CM81_8_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 3 134 3.40.50.720
1db3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 2 334 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A287VKI9-F1-model_v4 deleted 0.9958 159 268
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.995 58 192 GO:0008446
GO:0042351
AF-A0A3A4XPU5-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9878 1 263 GO:0008446
GO:0042351
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9877 58 192 GO:0008446
GO:0042351
AF-A0A382CEB6-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9872 61 229 GO:0008446
GO:0042351

Feature Viewer

pLDDT pTM Quality
92.31 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map