F400055

General Info

Members Datasets Scaffolds Average Seq Length
309 162 618 363

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10087233|Ga0070692_100872332
Length 407
Sequence LTREEQVKSTKHVTRTASKGKIISIALIPIALLAGMIAFLFGPGQSLLNTGIPLPEVTIERIEFHEGNKVVAYVRNTGPEQIEIAQADINDRIIPAAIEPSKTLPRLAEAKVIIPFTWIPGVPYEVGVTTSDGARFSRGVEAAALAPTANIEQASFFALIGTYVGVIPVLIGLLWFPFLKRLSANKYNFFLSLTAGLLVFLGIDALIESNQIAQVNIAGAFNGQMLIAMITILSFLALLYASEKLVGRAAKRKSSDSAKSSQSLTSEPTATLQQQLARPFALALMIAIGIGLHNLGEGLAIGAAVLLGMARSGKVMIRQLAILGLIAGVPTIVGTWIGGFLYSPIAAVIFLSIGAGAIFQVVFSILSWMAKGTTGDGTRQSLLRTPIVAGFAVGMAIMYLTALLIPS

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
83 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
132 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
140 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2857472729 Cohnella sp. R-74144 Isolate Unclassified
162 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.29
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 5.5
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10087233 3300005345 Archaea 1690
2 Ga0065704_10010945 3300005289 Archaea 2127
3 Ga0070658_10237332 3300005327 Bacteria 1545
4 Ga0070676_10091217 3300005328 Bacteria 1867
5 Ga0070683_100017216 3300005329 Bacteria 6384
6 Ga0070682_100152795 3300005337 Bacteria 1586
7 Ga0068868_100233063 3300005338 Bacteria 1545
8 Ga0070674_100003871 3300005356 Bacteria 8470
9 Ga0070674_100055290 3300005356 Bacteria 2748
10 Ga0070709_10025497 3300005434 Archaea 3494
11 Ga0070711_100003103 3300005439 Archaea 9613
12 Ga0070705_100000450 3300005440 Bacteria 23624
13 Ga0070705_100001011 3300005440 Bacteria 15664
14 Ga0070700_100204193 3300005441 Bacteria 1390
15 Ga0070694_100001931 3300005444 Archaea 12288
16 Ga0070708_100005567 3300005445 Bacteria 9980
17 Ga0070663_100107319 3300005455 Bacteria 2093
18 Ga0070706_100000033 3300005467 Bacteria 152586
19 Ga0070706_100003843 3300005467 Bacteria 14683
20 Ga0070706_100146131 3300005467 Bacteria 2208
21 Ga0070706_100224611 3300005467 Bacteria 1753
22 Ga0070707_100160904 3300005468 Bacteria 2188
23 Ga0070707_100191287 3300005468 Bacteria 1995
24 Ga0070698_100032506 3300005471 Bacteria 5404
25 Ga0070698_100035606 3300005471 Bacteria 5146
26 Ga0070699_100000414 3300005518 Bacteria 40997
27 Ga0070699_100073300 3300005518 Bacteria 2979
28 Ga0070684_100000278 3300005535 Bacteria 35483
29 Ga0070684_100200207 3300005535 Bacteria 1819
30 Ga0070697_100019245 3300005536 Bacteria 5392
31 Ga0070695_100094086 3300005545 Archaea 2006
32 Ga0070695_100108727 3300005545 Bacteria 1878
33 Ga0070696_100001832 3300005546 Bacteria 13956
34 Ga0070696_100005407 3300005546 Bacteria 8514
35 Ga0070696_100057575 3300005546 Archaea 2713
36 Ga0070696_100061952 3300005546 Archaea 2618
37 Ga0070704_100003926 3300005549 Bacteria 8561
38 Ga0070704_100042233 3300005549 Archaea 3153
39 Ga0068857_100004024 3300005577 Bacteria 12375
40 Ga0081455_10007955 3300005937 Bacteria 11088
41 Ga0081455_10099329 3300005937 Bacteria 2341
42 Ga0081538_10000705 3300005981 Bacteria 36642
43 Ga0081538_10041790 3300005981 Bacteria 2903
44 Ga0081538_10049483 3300005981 Bacteria 2549
45 Ga0081538_10098279 3300005981 Bacteria 1484
46 Ga0081540_1012331 3300005983 Bacteria 5639
47 Ga0081540_1038926 3300005983 Bacteria 2499
48 Ga0081539_10009575 3300005985 Bacteria 8060
49 Ga0075363_100129867 3300006048 Bacteria 1412
50 Ga0075364_10013403 3300006051 Bacteria 5038
51 Ga0097621_100214615 3300006237 Bacteria 1675
52 Ga0075428_100050510 3300006844 Bacteria 4560
53 Ga0075428_100062435 3300006844 Bacteria 4079
54 Ga0075428_100076012 3300006844 Bacteria 3667
55 Ga0075428_100230029 3300006844 Bacteria 2001
56 Ga0075428_100413200 3300006844 Bacteria 1446
57 Ga0075430_100008674 3300006846 Bacteria 8577
58 Ga0075430_100011579 3300006846 Bacteria 7501
59 Ga0075430_100013815 3300006846 Bacteria 6880
60 Ga0075430_100021516 3300006846 Bacteria 5481
61 Ga0075431_100003041 3300006847 Bacteria 16228
62 Ga0075431_100013958 3300006847 Bacteria 8115
63 Ga0075431_100040277 3300006847 Bacteria 4815
64 Ga0075431_100346205 3300006847 Bacteria 1495
65 Ga0075433_10000900 3300006852 Bacteria 20958
66 Ga0075433_10007278 3300006852 Archaea 8771
67 Ga0075433_10040114 3300006852 Bacteria 4051
68 Ga0075434_100003680 3300006871 Bacteria 13696
69 Ga0075434_100082942 3300006871 Archaea 3203
70 Ga0075434_100143840 3300006871 Bacteria 2405
71 Ga0075434_100295152 3300006871 Bacteria 1641
72 Ga0075434_100363080 3300006871 Bacteria 1469
73 Ga0075429_100010487 3300006880 Bacteria 8013
74 Ga0075429_100010623 3300006880 Bacteria 7965
75 Ga0111539_10073095 3300009094 Bacteria 4043
76 Ga0111539_10087483 3300009094 Bacteria 3660
77 Ga0111539_10335970 3300009094 Bacteria 1758
78 Ga0105245_10184269 3300009098 Bacteria 1996
79 Ga0105245_10386813 3300009098 Unclassified 1394
80 Ga0114129_10031805 3300009147 Bacteria 7460
81 Ga0114129_10069184 3300009147 Bacteria 4921
82 Ga0114129_10084876 3300009147 Archaea 4395
83 Ga0114129_10127447 3300009147 Bacteria 3499
84 Ga0114129_10157047 3300009147 Bacteria 3110
85 Ga0114129_10206303 3300009147 Archaea 2659
86 Ga0114129_10299541 3300009147 Bacteria 2144
87 Ga0114129_10553800 3300009147 Unclassified 1495
88 Ga0105243_10028360 3300009148 Bacteria 4297
89 Ga0105243_10112129 3300009148 Bacteria 2284
90 Ga0105242_10025151 3300009176 Bacteria 4708
91 Ga0105239_10056042 3300010375 Bacteria 4324
92 Ga0157370_10033002 3300013104 Bacteria 5049
93 Ga0163163_10344927 3300014325 Bacteria 1545
94 Ga0182006_1022992 3300015261 Archaea 2585
95 Ga0207699_10013162 3300025906 Archaea 4225
96 Ga0207684_10000010 3300025910 Bacteria 552805
97 Ga0207684_10003344 3300025910 Bacteria 15723
98 Ga0207654_10154187 3300025911 Bacteria 1477
99 Ga0207663_10005373 3300025916 Archaea 6445
100 Ga0207660_10023640 3300025917 Archaea 4153
101 Ga0207646_10032508 3300025922 Bacteria 4722
102 Ga0207646_10069643 3300025922 Bacteria 3142
103 Ga0207646_10201028 3300025922 Unclassified 1800
104 Ga0207669_10094764 3300025937 Bacteria 1955
105 Ga0207665_10026106 3300025939 Archaea 3855
106 Ga0207661_10015402 3300025944 Bacteria 5626
107 Ga0207661_10026504 3300025944 Bacteria 4417
108 Ga0207661_10118028 3300025944 Archaea 2255
109 Ga0207679_10047212 3300025945 Bacteria 3127
110 Ga0207667_10159385 3300025949 Unclassified 2321
111 Ga0207648_10286555 3300026089 Bacteria 1474
112 Ga0207648_10306613 3300026089 Bacteria 1425
113 Ga0207674_10000863 3300026116 Bacteria 39645
114 Ga0209983_1000891 3300027665 Bacteria 6571
115 Ga0209974_10000339 3300027876 Bacteria 15262
116 Ga0207428_10029608 3300027907 Bacteria 4535
117 Ga0207428_10083353 3300027907 Bacteria 2494
118 Ga0307408_100109138 3300031548 Bacteria 2122
119 Ga0307405_10078946 3300031731 Bacteria 2144
120 Ga0307410_10023525 3300031852 Bacteria 3832
121 Ga0307410_10042162 3300031852 Bacteria 3015
122 Ga0307407_10037392 3300031903 Bacteria 2682
123 Ga0307407_10110046 3300031903 Bacteria 1727
124 Ga0307407_10168719 3300031903 Bacteria 1439
125 Ga0307409_100027777 3300031995 Bacteria 4017
126 Ga0307409_100122830 3300031995 Archaea 2203
127 Ga0307409_100165677 3300031995 Bacteria 1939
128 Ga0307409_100166884 3300031995 Bacteria 1933
129 Ga0307416_100049075 3300032002 Bacteria 3354
130 Ga0307416_100064994 3300032002 Bacteria 2995
131 Ga0307416_100231341 3300032002 Bacteria 1782
132 Ga0307416_100293640 3300032002 Bacteria 1611
133 Ga0307414_10029816 3300032004 Bacteria 3556
134 Ga0307414_10047302 3300032004 Bacteria 2960
135 Ga0307414_10090704 3300032004 Bacteria 2269
136 Ga0307414_10187138 3300032004 Bacteria 1671
137 Ga0307411_10003947 3300032005 Bacteria 7002
138 Ga0307411_10107663 3300032005 Bacteria 1987
139 Ga0307411_10154112 3300032005 Bacteria 1712
140 Ga0307415_100045749 3300032126 Bacteria 2937
141 Ga0307415_100108233 3300032126 Bacteria 2056
142 Ga0373949_0021711 3300035090 Bacteria 1475
143 Ga0373939_0025383 3300035114 Bacteria 1661
144 Ga0373962_0015708 3300035242 Bacteria 1944
145 Ga0316582_0009370 3300036647 Bacteria 5313
146 Ga0395899_0120978 3300037312 Bacteria 1875
147 Ga0395899_0129834 3300037312 Bacteria 1800
148 Ga0395900_0009949 3300037418 Bacteria 9736
149 Ga0395900_0009967 3300037418 Bacteria 9726
150 Ga0395900_0081627 3300037418 Bacteria 3322
151 Ga0395900_0171135 3300037418 Bacteria 2211
152 Ga0395900_0223506 3300037418 Bacteria 1897
153 Ga0395898_0033779 3300037466 Bacteria 5102
154 Ga0395905_0010383 3300037471 Bacteria 9064
155 Ga0395905_0010714 3300037471 Bacteria 8891
156 Ga0395905_0207546 3300037471 Bacteria 1836
157 Ga0395905_0246442 3300037471 Bacteria 1669
158 Ga0395905_0351659 3300037471 Bacteria 1366
159 Ga0395901_0002362 3300038443 Bacteria 19195
160 Ga0395901_0056458 3300038443 Bacteria 4084
161 Ga0395901_0077178 3300038443 Bacteria 3477
162 Ga0395901_0122156 3300038443 Bacteria 2737
163 Ga0395901_0187079 3300038443 Bacteria 2172
164 Ga0395901_0188688 3300038443 Bacteria 2162
165 Ga0242419_000112 3300038698 Archaea 4044
166 Ga0242420_000237 3300038996 Archaea 5933
167 Ga0439436_0003761 3300041404 Bacteria 4636
168 Ga0439439_0011083 3300041406 Bacteria 2164
169 Ga0439466_0014686 3300041411 Bacteria 2848
170 Ga0439465_0007586 3300041413 Bacteria 3444
171 Ga0439462_0005998 3300042015 Bacteria 3009
172 Ga0450918_007763 3300042531 Bacteria 1891
173 Ga0453683_0043159 3300044673 Unclassified 2830
174 Ga0453683_0081122 3300044673 Bacteria 2032
175 Ga0451576_0000754 3300045051 Bacteria 64409
176 Ga0495638_0016284 3300046460 Bacteria 4982
177 Ga0495582_0114772 3300046473 Bacteria 1514
178 Ga0495584_0035420 3300046491 Bacteria 2523
179 Ga0495607_0125408 3300046501 Bacteria 1343
180 Ga0495656_0069424 3300046615 Bacteria 1561
181 Ga0496100_0007332 3300048903 Bacteria 6075
182 Ga0496101_0030294 3300048904 Bacteria 3792
183 Ga0496101_0072654 3300048904 Bacteria 2525
184 Ga0496102_0080374 3300048905 Bacteria 3003
185 Ga0496102_0219574 3300048905 Archaea 1792
186 Ga0496103_0037072 3300048906 Bacteria 2988
187 Ga0496104_0027923 3300048907 Bacteria 5226
188 Ga0496105_0074729 3300048908 Bacteria 2800
189 Ga0496106_0010440 3300048909 Bacteria 6858
190 Ga0496106_0029599 3300048909 Archaea 4082
191 Ga0496106_0137350 3300048909 Bacteria 1921
192 Ga0496107_0004586 3300048910 Bacteria 9365
193 Ga0496108_0070967 3300048911 Bacteria 2939
194 Ga0496113_0161982 3300048916 Bacteria 1769
195 Ga0496114_0017334 3300048917 Bacteria 5812
196 Ga0496114_0090178 3300048917 Bacteria 2602
197 Ga0496115_0053983 3300048918 Bacteria 3226
198 Ga0501291_002509 3300049514 Archaea 2204
199 Ga0501031_0018077 3300049568 Archaea 4585
200 Ga0501031_0023524 3300049568 Archaea 4016
201 Ga0501031_0106344 3300049568 Bacteria 1831
202 Ga0501032_0000276 3300049569 Bacteria 43345
203 Ga0501033_0079579 3300049570 Archaea 2405
204 Ga0501036_0052967 3300049572 Archaea 3436
205 Ga0501036_0135567 3300049572 Bacteria 2078
206 Ga0501037_0048115 3300049573 Archaea 3125
207 Ga0501039_0029219 3300049575 Archaea 4245
208 Ga0501039_0252840 3300049575 Archaea 1385
209 Ga0501040_0021493 3300049576 Archaea 4310
210 Ga0501040_0050403 3300049576 Bacteria 2848
211 Ga0501040_0077219 3300049576 Unclassified 2304
212 Ga0501041_0016979 3300049577 Archaea 4331
213 Ga0501041_0064754 3300049577 Archaea 2238
214 Ga0501041_0100476 3300049577 Bacteria 1790
215 Ga0501041_0119056 3300049577 Bacteria 1640
216 Ga0501042_0028187 3300049578 Archaea 3953
217 Ga0501042_0085970 3300049578 Archaea 2255
218 Ga0501043_0035614 3300049579 Archaea 3915
219 Ga0501046_0042291 3300049580 Archaea 3633
220 Ga0501046_0110311 3300049580 Bacteria 2103
221 Ga0501048_0040552 3300049582 Archaea 3336
222 Ga0501067_0032498 3300049583 Archaea 2897
223 Ga0501068_0120879 3300049584 Archaea 1633
224 Ga0501069_0056781 3300049585 Archaea 2182
225 Ga0501071_0001229 3300049587 Archaea 14494
226 Ga0501071_0094953 3300049587 Bacteria 2194
227 Ga0501071_0118386 3300049587 Bacteria 1962
228 Ga0501072_0033483 3300049588 Archaea 4026
229 Ga0501074_0038671 3300049590 Archaea 3456
230 Ga0501075_0006575 3300049591 Bacteria 8005
231 Ga0501075_0033024 3300049591 Archaea 3848
232 Ga0501075_0042636 3300049591 Archaea 3403
233 Ga0501075_0054723 3300049591 Archaea 3002
234 Ga0501076_0028799 3300049592 Archaea 4316
235 Ga0501076_0031530 3300049592 Bacteria 4134
236 Ga0501076_0034528 3300049592 Archaea 3953
237 Ga0501076_0076196 3300049592 Bacteria 2689
238 Ga0501076_0140944 3300049592 Bacteria 1959
239 Ga0501076_0292996 3300049592 Unclassified 1333
240 Ga0501077_0011818 3300049593 Bacteria 5460
241 Ga0501077_0168173 3300049593 Archaea 1393
242 Ga0501077_0206971 3300049593 Bacteria 1247
243 Ga0501199_000721 3300049650 Archaea 2928
244 Ga0501206_005329 3300049653 Archaea 1654
245 Ga0501235_004209 3300049669 Archaea 3117
246 Ga0501249_011161 3300049679 Archaea 1884
247 Ga0501251_001523 3300049681 Archaea 2172
248 Ga0501079_0042568 3300049741 Bacteria 3506
249 Ga0501079_0057374 3300049741 Bacteria 3005
250 Ga0501079_0101709 3300049741 Bacteria 2229
251 Ga0501079_0112533 3300049741 Bacteria 2116
252 Ga0501079_0290679 3300049741 Bacteria 1278
253 Ga0501080_0031161 3300049742 Bacteria 4969
254 Ga0501080_0072487 3300049742 Archaea 3204
255 Ga0501081_0021021 3300049743 Bacteria 4356
256 Ga0501081_0028863 3300049743 Archaea 3746
257 Ga0501081_0057227 3300049743 Archaea 2695
258 Ga0501081_0102664 3300049743 Bacteria 2023
259 Ga0501081_0152017 3300049743 Bacteria 1663
260 Ga0501081_0184229 3300049743 Bacteria 1511
261 Ga0501081_0185780 3300049743 Bacteria 1504
262 Ga0501278_001684 3300049774 Archaea 1568
263 Ga0501279_002942 3300049775 Archaea 2217
264 Ga0501035_0377205 3300049822 Bacteria 1183
265 Ga0501045_0027556 3300049824 Archaea 4095
266 Ga0501045_0041114 3300049824 Archaea 3363
267 Ga0501212_002853 3300049851 Bacteria 2118
268 nmdc:mga00v17_8828_c1 3300050491 Bacteria 5433
269 nmdc:mga0yw44_103973_c1 3300050492 Bacteria 1812
270 nmdc:mga05p37_124300_c1 3300050507 Bacteria 3169
271 nmdc:mga05p37_145247_c1 3300050507 Archaea 2905
272 nmdc:mga05p37_59144_c1 3300050507 Bacteria 4721
273 nmdc:mga05p37_77712_c1 3300050507 Bacteria 4086
274 nmdc:mga05p37_98983_c1 3300050507 Bacteria 3592
275 nmdc:mga09592_12020_c1 3300050508 Bacteria 7043
276 nmdc:mga09592_15704_c1 3300050508 Archaea 6187
277 nmdc:mga09592_204183_c1 3300050508 Bacteria 1712
278 nmdc:mga0qj67_119942_c1 3300050509 Bacteria 2127
279 nmdc:mga0qj67_15378_c1 3300050509 Bacteria 5794
280 nmdc:mga06r32_20515_c1 3300050510 Bacteria 6086
281 nmdc:mga06r32_305227_c1 3300050510 Bacteria 1577
282 nmdc:mga06r32_86945_c1 3300050510 Archaea 3050
283 nmdc:mga08y16_20022_c1 3300050511 Bacteria 7058
284 nmdc:mga08y16_54955_c1 3300050511 Bacteria 4162
285 nmdc:mga08y16_89028_c1 3300050511 Archaea 3217
286 nmdc:mga0n895_12335_c1 3300050512 Bacteria 7663
287 nmdc:mga0n895_140033_c1 3300050512 Bacteria 2447
288 nmdc:mga0n895_264782_c1 3300050512 Bacteria 1744
289 nmdc:mga0n895_86752_c1 3300050512 Archaea 3127
290 nmdc:mga0a205_251494_c1 3300050515 Archaea 1647
291 nmdc:mga0a205_2804_c1 3300050515 Bacteria 15418
292 nmdc:mga0a205_60647_c1 3300050515 Archaea 3653
293 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
294 Ga0501084_0118401 3300054114 Archaea 2226
295 Ga0501084_0131982 3300054114 Bacteria 2103
296 Ga0501084_0218921 3300054114 Unclassified 1606
297 Ga0501084_0265238 3300054114 Bacteria 1450
298 Ga0590075_003791 3300059424 Bacteria 3585
299 Ga0587091_005039 3300059511 Archaea 1774
300 Ga0587067_001538 3300059640 Archaea 2528
301 Ga0587068_001689 3300059641 Archaea 2542
302 Ga0587072_001329 3300059643 Bacteria 3016
303 Ga0501082_0037439 3300060353 Archaea 4181
304 Ga0501082_0150956 3300060353 Bacteria 2018
305 Ga0501082_0190971 3300060353 Bacteria 1782
306 Ga0501082_0230363 3300060353 Bacteria 1612
307 Ga0530510_0040630 3300061734 Archaea 3357
308 2857474287 2857472729 Bacteria 6568124
309 8057980671 8057977335 Bacteria 5694872
310 Ga0070692_10087233
311 Ga0065704_10010945
312 Ga0070658_10237332
313 Ga0070676_10091217
314 Ga0070683_100017216
315 Ga0070682_100152795
316 Ga0068868_100233063
317 Ga0070674_100003871
318 Ga0070674_100055290
319 Ga0070709_10025497
320 Ga0070711_100003103
321 Ga0070705_100000450
322 Ga0070705_100001011
323 Ga0070700_100204193
324 Ga0070694_100001931
325 Ga0070708_100005567
326 Ga0070663_100107319
327 Ga0070706_100000033
328 Ga0070706_100003843
329 Ga0070706_100146131
330 Ga0070706_100224611
331 Ga0070707_100160904
332 Ga0070707_100191287
333 Ga0070698_100032506
334 Ga0070698_100035606
335 Ga0070699_100000414
336 Ga0070699_100073300
337 Ga0070684_100000278
338 Ga0070684_100200207
339 Ga0070697_100019245
340 Ga0070695_100094086
341 Ga0070695_100108727
342 Ga0070696_100001832
343 Ga0070696_100005407
344 Ga0070696_100057575
345 Ga0070696_100061952
346 Ga0070704_100003926
347 Ga0070704_100042233
348 Ga0068857_100004024
349 Ga0081455_10007955
350 Ga0081455_10099329
351 Ga0081538_10000705
352 Ga0081538_10041790
353 Ga0081538_10049483
354 Ga0081538_10098279
355 Ga0081540_1012331
356 Ga0081540_1038926
357 Ga0081539_10009575
358 Ga0075363_100129867
359 Ga0075364_10013403
360 Ga0097621_100214615
361 Ga0075428_100050510
362 Ga0075428_100062435
363 Ga0075428_100076012
364 Ga0075428_100230029
365 Ga0075428_100413200
366 Ga0075430_100008674
367 Ga0075430_100011579
368 Ga0075430_100013815
369 Ga0075430_100021516
370 Ga0075431_100003041
371 Ga0075431_100013958
372 Ga0075431_100040277
373 Ga0075431_100346205
374 Ga0075433_10000900
375 Ga0075433_10007278
376 Ga0075433_10040114
377 Ga0075434_100003680
378 Ga0075434_100082942
379 Ga0075434_100143840
380 Ga0075434_100295152
381 Ga0075434_100363080
382 Ga0075429_100010487
383 Ga0075429_100010623
384 Ga0111539_10073095
385 Ga0111539_10087483
386 Ga0111539_10335970
387 Ga0105245_10184269
388 Ga0105245_10386813
389 Ga0114129_10031805
390 Ga0114129_10069184
391 Ga0114129_10084876
392 Ga0114129_10127447
393 Ga0114129_10157047
394 Ga0114129_10206303
395 Ga0114129_10299541
396 Ga0114129_10553800
397 Ga0105243_10028360
398 Ga0105243_10112129
399 Ga0105242_10025151
400 Ga0105239_10056042
401 Ga0157370_10033002
402 Ga0163163_10344927
403 Ga0182006_1022992
404 Ga0207699_10013162
405 Ga0207684_10000010
406 Ga0207684_10003344
407 Ga0207654_10154187
408 Ga0207663_10005373
409 Ga0207660_10023640
410 Ga0207646_10032508
411 Ga0207646_10069643
412 Ga0207646_10201028
413 Ga0207669_10094764
414 Ga0207665_10026106
415 Ga0207661_10015402
416 Ga0207661_10026504
417 Ga0207661_10118028
418 Ga0207679_10047212
419 Ga0207667_10159385
420 Ga0207648_10286555
421 Ga0207648_10306613
422 Ga0207674_10000863
423 Ga0209983_1000891
424 Ga0209974_10000339
425 Ga0207428_10029608
426 Ga0207428_10083353
427 Ga0307408_100109138
428 Ga0307405_10078946
429 Ga0307410_10023525
430 Ga0307410_10042162
431 Ga0307407_10037392
432 Ga0307407_10110046
433 Ga0307407_10168719
434 Ga0307409_100027777
435 Ga0307409_100122830
436 Ga0307409_100165677
437 Ga0307409_100166884
438 Ga0307416_100049075
439 Ga0307416_100064994
440 Ga0307416_100231341
441 Ga0307416_100293640
442 Ga0307414_10029816
443 Ga0307414_10047302
444 Ga0307414_10090704
445 Ga0307414_10187138
446 Ga0307411_10003947
447 Ga0307411_10107663
448 Ga0307411_10154112
449 Ga0307415_100045749
450 Ga0307415_100108233
451 Ga0373949_0021711
452 Ga0373939_0025383
453 Ga0373962_0015708
454 Ga0316582_0009370
455 Ga0395899_0120978
456 Ga0395899_0129834
457 Ga0395900_0009949
458 Ga0395900_0009967
459 Ga0395900_0081627
460 Ga0395900_0171135
461 Ga0395900_0223506
462 Ga0395898_0033779
463 Ga0395905_0010383
464 Ga0395905_0010714
465 Ga0395905_0207546
466 Ga0395905_0246442
467 Ga0395905_0351659
468 Ga0395901_0002362
469 Ga0395901_0056458
470 Ga0395901_0077178
471 Ga0395901_0122156
472 Ga0395901_0187079
473 Ga0395901_0188688
474 Ga0242419_000112
475 Ga0242420_000237
476 Ga0439436_0003761
477 Ga0439439_0011083
478 Ga0439466_0014686
479 Ga0439465_0007586
480 Ga0439462_0005998
481 Ga0450918_007763
482 Ga0453683_0043159
483 Ga0453683_0081122
484 Ga0451576_0000754
485 Ga0495638_0016284
486 Ga0495582_0114772
487 Ga0495584_0035420
488 Ga0495607_0125408
489 Ga0495656_0069424
490 Ga0496100_0007332
491 Ga0496101_0030294
492 Ga0496101_0072654
493 Ga0496102_0080374
494 Ga0496102_0219574
495 Ga0496103_0037072
496 Ga0496104_0027923
497 Ga0496105_0074729
498 Ga0496106_0010440
499 Ga0496106_0029599
500 Ga0496106_0137350
501 Ga0496107_0004586
502 Ga0496108_0070967
503 Ga0496113_0161982
504 Ga0496114_0017334
505 Ga0496114_0090178
506 Ga0496115_0053983
507 Ga0501291_002509
508 Ga0501031_0018077
509 Ga0501031_0023524
510 Ga0501031_0106344
511 Ga0501032_0000276
512 Ga0501033_0079579
513 Ga0501036_0052967
514 Ga0501036_0135567
515 Ga0501037_0048115
516 Ga0501039_0029219
517 Ga0501039_0252840
518 Ga0501040_0021493
519 Ga0501040_0050403
520 Ga0501040_0077219
521 Ga0501041_0016979
522 Ga0501041_0064754
523 Ga0501041_0100476
524 Ga0501041_0119056
525 Ga0501042_0028187
526 Ga0501042_0085970
527 Ga0501043_0035614
528 Ga0501046_0042291
529 Ga0501046_0110311
530 Ga0501048_0040552
531 Ga0501067_0032498
532 Ga0501068_0120879
533 Ga0501069_0056781
534 Ga0501071_0001229
535 Ga0501071_0094953
536 Ga0501071_0118386
537 Ga0501072_0033483
538 Ga0501074_0038671
539 Ga0501075_0006575
540 Ga0501075_0033024
541 Ga0501075_0042636
542 Ga0501075_0054723
543 Ga0501076_0028799
544 Ga0501076_0031530
545 Ga0501076_0034528
546 Ga0501076_0076196
547 Ga0501076_0140944
548 Ga0501076_0292996
549 Ga0501077_0011818
550 Ga0501077_0168173
551 Ga0501077_0206971
552 Ga0501199_000721
553 Ga0501206_005329
554 Ga0501235_004209
555 Ga0501249_011161
556 Ga0501251_001523
557 Ga0501079_0042568
558 Ga0501079_0057374
559 Ga0501079_0101709
560 Ga0501079_0112533
561 Ga0501079_0290679
562 Ga0501080_0031161
563 Ga0501080_0072487
564 Ga0501081_0021021
565 Ga0501081_0028863
566 Ga0501081_0057227
567 Ga0501081_0102664
568 Ga0501081_0152017
569 Ga0501081_0184229
570 Ga0501081_0185780
571 Ga0501278_001684
572 Ga0501279_002942
573 Ga0501035_0377205
574 Ga0501045_0027556
575 Ga0501045_0041114
576 Ga0501212_002853
577 nmdc:mga00v17_8828_c1
578 nmdc:mga0yw44_103973_c1
579 nmdc:mga05p37_124300_c1
580 nmdc:mga05p37_145247_c1
581 nmdc:mga05p37_59144_c1
582 nmdc:mga05p37_77712_c1
583 nmdc:mga05p37_98983_c1
584 nmdc:mga09592_12020_c1
585 nmdc:mga09592_15704_c1
586 nmdc:mga09592_204183_c1
587 nmdc:mga0qj67_119942_c1
588 nmdc:mga0qj67_15378_c1
589 nmdc:mga06r32_20515_c1
590 nmdc:mga06r32_305227_c1
591 nmdc:mga06r32_86945_c1
592 nmdc:mga08y16_20022_c1
593 nmdc:mga08y16_54955_c1
594 nmdc:mga08y16_89028_c1
595 nmdc:mga0n895_12335_c1
596 nmdc:mga0n895_140033_c1
597 nmdc:mga0n895_264782_c1
598 nmdc:mga0n895_86752_c1
599 nmdc:mga0a205_251494_c1
600 nmdc:mga0a205_2804_c1
601 nmdc:mga0a205_60647_c1
602 nmdc:mga0a205_6_c1
603 Ga0501084_0118401
604 Ga0501084_0131982
605 Ga0501084_0218921
606 Ga0501084_0265238
607 Ga0590075_003791
608 Ga0587091_005039
609 Ga0587067_001538
610 Ga0587068_001689
611 Ga0587072_001329
612 Ga0501082_0037439
613 Ga0501082_0150956
614 Ga0501082_0190971
615 Ga0501082_0230363
616 Ga0530510_0040630
617 2857474287
618 8057980671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.6216 151 365
6oun-assembly1.cif.gz_A structure of hiv-1 reverse transcriptase (rt) in complex with dsdna and (-)3tc-tp 0.6204 115 134
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.6194 147 358
7z6n-assembly1.cif.gz_B crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.619 151 360
6h6f-assembly1.cif.gz_E ptc3 holotoxin complex from photorhabdus luminiscens - mutant tcc-d651a 0.6155 46 133
ID Description Score Start End Superfamily
af_Q58307_1_139_3.30.700.10 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.825 53 134 3.30.700.10
af_Q58308_52_153_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7869 55 132 2.60.40.10
af_Q55G32_146_238_2.60.40.760 Mainly Beta;Sandwich;Immunoglobulin-like;Expansin, cellulose-binding-like domain 0.6289 49 141 2.60.40.760
af_Q9ZUV4_277_552_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6189 176 360 1.20.1250.20
af_Q58308_52_153_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6189 55 132 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A533UV49-F1-model_v4 Divalent cation transporter 0.9266 50 363 GO:0005385
GO:0016020
AF-A0A7W1Q7Z0-F1-model_v4 Uncharacterized protein 0.9229 49 130
AF-A0A842N5K4-F1-model_v4 Divalent cation transporter 0.9226 144 363 GO:0016020
AF-A0A2U0RZC4-F1-model_v4 CARDB domain-containing protein 0.9152 53 138
AF-A0A7W0TZR9-F1-model_v4 Metal transporter 0.9102 54 365 GO:0016020

Map