F399639

General Info

Members Datasets Scaffolds Average Seq Length
308 216 308 128

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_101769964|Ga0075429_1017699642
Length 137
Sequence MVDNRPDTRVSMRTPLARAKGLGPAGHGVEHWWMHRMLAVSNVPLVVAFVIIVASLVGRSHAQALAIVSHPLIAILLVXXIVSVVNHMRLGLQIVIDDYVHDKGRKIAVHIANNFFAAVIATVCLFSILKISFGWVP

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.01
Nodule 0
Rhizoplane 4.87
Rhizosphere 79.87
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10066084 3300003659 Bacteria 756
2 JGI25405J52794_10106417 3300003911 Bacteria 628
3 Ga0070658_10758025 3300005327 Bacteria 843
4 Ga0070690_100340721 3300005330 Bacteria 1085
5 Ga0068869_100076146 3300005334 Bacteria 2494
6 Ga0070680_100565706 3300005336 Bacteria 975
7 Ga0068868_100015868 3300005338 Bacteria 5581
8 Ga0070671_101565162 3300005355 Bacteria 584
9 Ga0070674_101020359 3300005356 Bacteria 727
10 Ga0070659_101129822 3300005366 Bacteria 691
11 Ga0070659_101449856 3300005366 Bacteria 611
12 Ga0070667_100215417 3300005367 Bacteria 1708
13 Ga0070709_10136440 3300005434 Bacteria 1681
14 Ga0070714_100040854 3300005435 Bacteria 3911
15 Ga0070714_101577870 3300005435 Bacteria 641
16 Ga0070713_100008643 3300005436 Bacteria 7237
17 Ga0070713_100021793 3300005436 Bacteria 4939
18 Ga0070710_10001983 3300005437 Bacteria 9707
19 Ga0070701_11350658 3300005438 Bacteria 511
20 Ga0070711_100024798 3300005439 Bacteria 3917
21 Ga0070705_100467303 3300005440 Bacteria 950
22 Ga0070708_100028414 3300005445 Bacteria 4812
23 Ga0070681_10931486 3300005458 Bacteria 788
24 Ga0070681_11141251 3300005458 Bacteria 701
25 Ga0070707_100029000 3300005468 Bacteria 5268
26 Ga0070699_100022614 3300005518 Bacteria 5419
27 Ga0070679_100106770 3300005530 Bacteria 2785
28 Ga0070686_100070588 3300005544 Bacteria 2284
29 Ga0070686_101262619 3300005544 Bacteria 616
30 Ga0070665_100251067 3300005548 Bacteria 1770
31 Ga0070665_102338534 3300005548 Unclassified 537
32 Ga0068855_100274043 3300005563 Bacteria 1876
33 Ga0068855_100319684 3300005563 Bacteria 1716
34 Ga0068855_101810965 3300005563 Bacteria 620
35 Ga0068864_100566529 3300005618 Bacteria 1099
36 Ga0068864_101989601 3300005618 Unclassified 587
37 Ga0068860_100388265 3300005843 Bacteria 1379
38 Ga0068860_101294021 3300005843 Bacteria 750
39 Ga0081455_10006689 3300005937 Bacteria 12317
40 Ga0081455_10009933 3300005937 Bacteria 9733
41 Ga0081538_10001222 3300005981 Bacteria 26967
42 Ga0081540_1003345 3300005983 Bacteria 12714
43 Ga0081540_1022865 3300005983 Bacteria 3679
44 Ga0070717_10073624 3300006028 Bacteria 2855
45 Ga0070717_11649243 3300006028 Bacteria 581
46 Ga0075365_10022033 3300006038 Bacteria 3984
47 Ga0075365_10251623 3300006038 Bacteria 1241
48 Ga0075368_10018493 3300006042 Bacteria 2619
49 Ga0075363_100004353 3300006048 Bacteria 6174
50 Ga0075363_100390798 3300006048 Bacteria 816
51 Ga0075364_10084734 3300006051 Bacteria 2098
52 Ga0075432_10222387 3300006058 Bacteria 756
53 Ga0070715_10019816 3300006163 Bacteria 2585
54 Ga0070716_100003805 3300006173 Bacteria 7158
55 Ga0075362_10031933 3300006177 Bacteria 2282
56 Ga0075367_10007557 3300006178 Bacteria 5575
57 Ga0075367_10307819 3300006178 Bacteria 998
58 Ga0075367_10552567 3300006178 Bacteria 731
59 Ga0075369_10008537 3300006186 Bacteria 3945
60 Ga0075369_10235975 3300006186 Bacteria 848
61 Ga0075370_10098512 3300006353 Bacteria 1691
62 Ga0075370_10119312 3300006353 Bacteria 1534
63 Ga0075370_10811317 3300006353 Bacteria 571
64 Ga0068871_100066442 3300006358 Bacteria 2956
65 Ga0075428_100301853 3300006844 Bacteria 1721
66 Ga0075430_101314186 3300006846 Bacteria 595
67 Ga0075431_100454386 3300006847 Bacteria 1276
68 Ga0075431_100768967 3300006847 Bacteria 938
69 Ga0075431_101629576 3300006847 Bacteria 603
70 Ga0075433_10081328 3300006852 Bacteria 2856
71 Ga0075433_10390803 3300006852 Bacteria 1228
72 Ga0075433_10979173 3300006852 Bacteria 737
73 Ga0075434_100193101 3300006871 Bacteria 2056
74 Ga0075434_100194163 3300006871 Bacteria 2050
75 Ga0075434_101085717 3300006871 Bacteria 814
76 Ga0075434_101925427 3300006871 Bacteria 597
77 Ga0075434_102465867 3300006871 Bacteria 522
78 Ga0075429_101769964 3300006880 Unclassified 536
79 Ga0075436_100290258 3300006914 Bacteria 1171
80 Ga0075436_100578765 3300006914 Bacteria 826
81 Ga0075435_100041721 3300007076 Bacteria 3669
82 Ga0075435_100296342 3300007076 Bacteria 1383
83 Ga0075435_100690574 3300007076 Bacteria 887
84 Ga0075435_101115030 3300007076 Bacteria 690
85 Ga0099794_10034805 3300007265 Bacteria 2375
86 Ga0099795_10144720 3300007788 Bacteria 969
87 Ga0099795_10164065 3300007788 Bacteria 919
88 Ga0111539_10031604 3300009094 Bacteria 6431
89 Ga0111539_11117361 3300009094 Bacteria 916
90 Ga0105245_10040834 3300009098 Bacteria 4135
91 Ga0114129_10100689 3300009147 Bacteria 3998
92 Ga0114129_10169800 3300009147 Bacteria 2974
93 Ga0114129_10210232 3300009147 Bacteria 2630
94 Ga0105243_10856071 3300009148 Bacteria 901
95 Ga0105242_10328222 3300009176 Bacteria 1406
96 Ga0105242_12691749 3300009176 Bacteria 547
97 Ga0105248_11251779 3300009177 Bacteria 839
98 Ga0099796_10001874 3300010159 Bacteria 4435
99 Ga0099796_10108072 3300010159 Bacteria 1056
100 Ga0105246_10188196 3300011119 Bacteria 1595
101 Ga0157374_11353834 3300013296 Bacteria 734
102 Ga0157378_10972110 3300013297 Bacteria 882
103 Ga0157375_13020958 3300013308 Bacteria 562
104 Ga0157380_10460649 3300014326 Bacteria 1224
105 Ga0163161_11140107 3300017792 Bacteria 672
106 Ga0213872_10073984 3300021361 Bacteria 1534
107 Ga0213874_10068206 3300021377 Bacteria 1129
108 Ga0213874_10100172 3300021377 Bacteria 962
109 Ga0213874_10106369 3300021377 Bacteria 938
110 Ga0213875_10224582 3300021388 Bacteria 884
111 Ga0207653_10025281 3300025885 Bacteria 1899
112 Ga0207692_10072592 3300025898 Bacteria 1818
113 Ga0207685_10129034 3300025905 Bacteria 1120
114 Ga0207685_10393401 3300025905 Bacteria 709
115 Ga0207699_10005705 3300025906 Bacteria 5983
116 Ga0207684_10010000 3300025910 Bacteria 8362
117 Ga0207707_11296137 3300025912 Bacteria 585
118 Ga0207693_10003033 3300025915 Bacteria 14514
119 Ga0207693_10036699 3300025915 Bacteria 3864
120 Ga0207663_10014075 3300025916 Bacteria 4369
121 Ga0207660_10206487 3300025917 Bacteria 1536
122 Ga0207660_10676916 3300025917 Bacteria 841
123 Ga0207652_10110831 3300025921 Bacteria 2434
124 Ga0207646_11618773 3300025922 Bacteria 558
125 Ga0207687_10018082 3300025927 Bacteria 4651
126 Ga0207700_10023909 3300025928 Bacteria 4223
127 Ga0207700_10137754 3300025928 Bacteria 2001
128 Ga0207700_10139785 3300025928 Bacteria 1988
129 Ga0207664_10033990 3300025929 Bacteria 3923
130 Ga0207664_10166971 3300025929 Bacteria 1881
131 Ga0207690_11651061 3300025932 Bacteria 535
132 Ga0207686_10282800 3300025934 Bacteria 1225
133 Ga0207709_11743711 3300025935 Bacteria 518
134 Ga0207669_11373969 3300025937 Bacteria 601
135 Ga0207665_10009190 3300025939 Bacteria 6489
136 Ga0207665_10709432 3300025939 Bacteria 791
137 Ga0207691_10333410 3300025940 Bacteria 1299
138 Ga0207711_10013031 3300025941 Bacteria 6906
139 Ga0207689_10077313 3300025942 Bacteria 2736
140 Ga0207667_10250960 3300025949 Bacteria 1810
141 Ga0207651_11861155 3300025960 Bacteria 541
142 Ga0207658_10225311 3300025986 Bacteria 1579
143 Ga0207677_10010254 3300026023 Bacteria 5296
144 Ga0207639_11992996 3300026041 Bacteria 542
145 Ga0207678_10398333 3300026067 Bacteria 1192
146 Ga0207676_10045758 3300026095 Bacteria 3383
147 Ga0209179_1050524 3300027512 Bacteria 890
148 Ga0209588_1096707 3300027671 Bacteria 951
149 Ga0209813_10010947 3300027866 Bacteria 2358
150 Ga0268264_12025876 3300028381 Bacteria 585
151 Ga0265332_10001634 3300031238 Bacteria 12252
152 Ga0265328_10216548 3300031239 Bacteria 729
153 Ga0265325_10279844 3300031241 Bacteria 748
154 Ga0265329_10073586 3300031242 Bacteria 1081
155 Ga0265340_10004984 3300031247 Bacteria 7381
156 Ga0265331_10009252 3300031250 Bacteria 5549
157 Ga0307408_100929680 3300031548 Bacteria 798
158 Ga0307408_101304217 3300031548 Bacteria 681
159 Ga0265314_10032181 3300031711 Bacteria 3861
160 Ga0265342_10000789 3300031712 Bacteria 31942
161 Ga0373958_0016668 3300034819 Bacteria 1312
162 Ga0373926_0270679 3300035083 Bacteria 660
163 Ga0373934_0140473 3300035086 Bacteria 987
164 Ga0373939_0027986 3300035114 Bacteria 1601
165 Ga0373953_0020273 3300035117 Bacteria 2484
166 Ga0373954_0016911 3300035118 Bacteria 3272
167 Ga0373942_0022004 3300035207 Bacteria 1614
168 Ga0373931_0295045 3300035691 Bacteria 999
169 Ga0373935_0169375 3300035692 Bacteria 1493
170 Ga0373935_0464711 3300035692 Bacteria 915
171 Ga0373935_1300102 3300035692 Bacteria 543
172 Ga0373927_0038103 3300035695 Bacteria 3122
173 Ga0373947_0044634 3300035725 Bacteria 2650
174 Ga0373937_0082578 3300036401 Bacteria 2973
175 Ga0373925_0015899 3300037068 Bacteria 5445
176 Ga0395900_0169521 3300037418 Bacteria 2223
177 Ga0395898_0091118 3300037466 Bacteria 2933
178 Ga0395905_0208981 3300037471 Bacteria 1829
179 Ga0436364_1030891 3300037853 Bacteria 1315
180 Ga0436364_1369491 3300037853 Bacteria 665
181 Ga0395901_1443114 3300038443 Bacteria 645
182 Ga0242420_070325 3300038996 Bacteria 710
183 Ga0436365_0039437 3300039437 Bacteria 1064
184 Ga0436361_0074042 3300039447 Bacteria 7292
185 Ga0436363_0212463 3300039450 Bacteria 6055
186 Ga0436363_1019274 3300039450 Bacteria 1097
187 Ga0436363_1038944 3300039450 Bacteria 1148
188 Ga0436362_0659152 3300039453 Bacteria 754
189 Ga0466959_0332866 3300045049 Bacteria 1037
190 Ga0466958_0299425 3300045836 Bacteria 1032
191 Ga0466967_0013237 3300045976 Bacteria 6362
192 Ga0495651_0078422 3300046462 Bacteria 2498
193 Ga0495580_0077469 3300046472 Bacteria 2319
194 Ga0495582_0376770 3300046473 Bacteria 818
195 Ga0495662_0058872 3300046476 Bacteria 1855
196 Ga0495630_0116762 3300046517 Bacteria 2023
197 Ga0495642_0206499 3300046528 Bacteria 857
198 Ga0495652_0115125 3300046529 Bacteria 2155
199 Ga0495598_0147789 3300046537 Bacteria 818
200 Ga0495635_0111722 3300046663 Bacteria 1866
201 Ga0495647_0018946 3300046681 Bacteria 2457
202 Ga0495658_0202543 3300046683 Bacteria 1237
203 Ga0495624_0748718 3300046690 Bacteria 579
204 Ga0495581_0227477 3300047315 Bacteria 1091
205 Ga0495680_0042185 3300047322 Bacteria 3622
206 Ga0496100_0447286 3300048903 Bacteria 990
207 Ga0496101_0099715 3300048904 Bacteria 2172
208 Ga0496102_0561283 3300048905 Bacteria 1064
209 Ga0496103_0616854 3300048906 Bacteria 690
210 Ga0496103_0683733 3300048906 Bacteria 651
211 Ga0496106_0045536 3300048909 Bacteria 3295
212 Ga0496107_0352673 3300048910 Bacteria 1095
213 Ga0496108_1179617 3300048911 Bacteria 648
214 Ga0496110_0006914 3300048913 Bacteria 9022
215 Ga0496111_0038491 3300048914 Bacteria 3427
216 Ga0496112_0099234 3300048915 Bacteria 2882
217 Ga0496113_0859640 3300048916 Bacteria 719
218 Ga0496114_0246474 3300048917 Bacteria 1572
219 Ga0496114_0672355 3300048917 Bacteria 909
220 Ga0496115_0788554 3300048918 Bacteria 740
221 Ga0501031_0204240 3300049568 Bacteria 1289
222 Ga0501031_0224853 3300049568 Bacteria 1222
223 Ga0501031_0368201 3300049568 Bacteria 930
224 Ga0501032_0324088 3300049569 Bacteria 994
225 Ga0501033_0028772 3300049570 Bacteria 4175
226 Ga0501034_0439774 3300049571 Bacteria 1223
227 Ga0501036_0190463 3300049572 Bacteria 1726
228 Ga0501036_0932215 3300049572 Bacteria 712
229 Ga0501037_0096552 3300049573 Bacteria 2136
230 Ga0501037_0456746 3300049573 Bacteria 871
231 Ga0501038_0033179 3300049574 Bacteria 4548
232 Ga0501039_0320781 3300049575 Bacteria 1218
233 Ga0501040_0162481 3300049576 Bacteria 1579
234 Ga0501041_0436455 3300049577 Bacteria 831
235 Ga0501042_0553022 3300049578 Bacteria 836
236 Ga0501043_0306297 3300049579 Bacteria 1213
237 Ga0501047_0164411 3300049581 Bacteria 2090
238 Ga0501047_0802608 3300049581 Bacteria 756
239 Ga0501048_0358059 3300049582 Bacteria 1041
240 Ga0501070_0045164 3300049586 Bacteria 3665
241 Ga0501070_0136384 3300049586 Bacteria 2026
242 Ga0501072_0330184 3300049588 Bacteria 1212
243 Ga0501073_0058769 3300049589 Bacteria 2687
244 Ga0501074_0432223 3300049590 Bacteria 934
245 Ga0501074_0589628 3300049590 Bacteria 786
246 Ga0501076_0135594 3300049592 Bacteria 1998
247 Ga0501076_0487364 3300049592 Bacteria 1016
248 Ga0501076_0493489 3300049592 Bacteria 1009
249 Ga0501077_0102603 3300049593 Bacteria 1812
250 Ga0501077_0143133 3300049593 Bacteria 1517
251 Ga0501077_0524262 3300049593 Bacteria 760
252 Ga0501079_0493685 3300049741 Bacteria 962
253 Ga0501080_0100580 3300049742 Bacteria 2682
254 Ga0501080_0939318 3300049742 Bacteria 752
255 Ga0501081_0364210 3300049743 Bacteria 1067
256 Ga0501035_0040344 3300049822 Bacteria 4219
257 Ga0501035_0082731 3300049822 Bacteria 2833
258 Ga0501035_0087394 3300049822 Bacteria 2748
259 Ga0501044_0067421 3300049823 Bacteria 3646
260 Ga0501044_0081273 3300049823 Bacteria 3281
261 Ga0501044_0511975 3300049823 Bacteria 1100
262 Ga0501044_0625778 3300049823 Bacteria 967
263 Ga0501044_1539455 3300049823 Unclassified 530
264 Ga0501045_0227630 3300049824 Bacteria 1388
265 nmdc:mga03683_44385_c1 3300050489 Bacteria 1837
266 nmdc:mga03n38_62148_c1 3300050490 Bacteria 1703
267 nmdc:mga03n38_854361_c1 3300050490 Bacteria 532
268 nmdc:mga00v17_192591_c1 3300050491 Bacteria 1317
269 nmdc:mga00v17_24444_c1 3300050491 Bacteria 3506
270 nmdc:mga00v17_333079_c1 3300050491 Bacteria 986
271 nmdc:mga0yw44_38906_c1 3300050492 Bacteria 2817
272 nmdc:mga0yw44_580550_c1 3300050492 Bacteria 761
273 nmdc:mga0yw44_626859_c1 3300050492 Bacteria 731
274 nmdc:mga06z11_110030_c1 3300050494 Bacteria 1524
275 nmdc:mga06z11_3937_c1 3300050494 Bacteria 5795
276 nmdc:mga06z11_623419_c1 3300050494 Bacteria 656
277 nmdc:mga04h51_15701_c1 3300050495 Bacteria 2186
278 nmdc:mga07m45_114712_c1 3300050496 Bacteria 1553
279 nmdc:mga07m45_51307_c1 3300050496 Bacteria 2326
280 nmdc:mga05p37_101388_c1 3300050507 Bacteria 3545
281 nmdc:mga05p37_110411_c1 3300050507 Bacteria 3383
282 nmdc:mga09592_1027782_c1 3300050508 Bacteria 688
283 nmdc:mga09592_1560380_c1 3300050508 Unclassified 536
284 nmdc:mga06r32_185152_c1 3300050510 Bacteria 2069
285 nmdc:mga06r32_650230_c1 3300050510 Bacteria 1022
286 nmdc:mga08y16_1317040_c1 3300050511 Bacteria 688
287 nmdc:mga08y16_69953_c1 3300050511 Bacteria 3658
288 nmdc:mga0n895_162103_c1 3300050512 Bacteria 2268
289 nmdc:mga0n895_367794_c1 3300050512 Bacteria 1456
290 nmdc:mga0rr50_425483_c1 3300050513 Bacteria 1124
291 nmdc:mga0rr50_547544_c1 3300050513 Bacteria 985
292 nmdc:mga0rr50_654964_c1 3300050513 Bacteria 896
293 nmdc:mga0rr50_66465_c1 3300050513 Bacteria 2736
294 nmdc:mga08x19_209701_c1 3300050514 Bacteria 1337
295 nmdc:mga0a205_185965_c1 3300050515 Bacteria 1970
296 nmdc:mga0a205_31595_c1 3300050515 Bacteria 5073
297 nmdc:mga0a205_44618_c1 3300050515 Bacteria 4274
298 nmdc:mga0sz30_12884_c1 3300050516 Bacteria 3262
299 nmdc:mga0sz30_218159_c1 3300050516 Bacteria 848
300 Ga0495601_0137564 3300053077 Bacteria 1592
301 Ga0495595_0245220 3300053084 Bacteria 896
302 Ga0500641_0003093 3300053096 Bacteria 5900
303 Ga0500595_042281 3300053119 Bacteria 1459
304 Ga0500652_000004 3300053131 Bacteria 173428
305 Ga0500604_0136157 3300053151 Bacteria 828
306 Ga0501084_0414741 3300054114 Bacteria 1138
307 Ga0501082_0153185 3300060353 Bacteria 2003
308 Ga0530510_0172912 3300061734 Bacteria 1600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1369491 Ga0436364_1369491_239_655 121
2 3300005548 Ga0070665_100251067 Ga0070665_1002510672 123
3 3300006847 Ga0075431_100768967 Ga0075431_1007689672 123
4 3300049568 Ga0501031_0368201 Ga0501031_0368201_332_703 123
5 3300049569 Ga0501032_0324088 Ga0501032_0324088_462_833 123
6 3300049570 Ga0501033_0028772 Ga0501033_0028772_1278_1649 123
7 3300049572 Ga0501036_0932215 Ga0501036_0932215_325_696 123
8 3300049573 Ga0501037_0456746 Ga0501037_0456746_230_601 123
9 3300049581 Ga0501047_0802608 Ga0501047_0802608_176_547 123
10 3300049586 Ga0501070_0136384 Ga0501070_0136384_1584_1955 123
11 3300049822 Ga0501035_0082731 Ga0501035_0082731_1301_1672 123
12 3300049822 Ga0501035_0087394 Ga0501035_0087394_70_441 123
13 3300049823 Ga0501044_0081273 Ga0501044_0081273_703_1074 123
14 3300049823 Ga0501044_0625778 Ga0501044_0625778_241_612 123
15 3300049823 Ga0501044_1539455 Ga0501044_1539455_16_387 123
16 3300006847 Ga0075431_100454386 Ga0075431_1004543862 124
17 3300009147 Ga0114129_10169800 Ga0114129_101698004 124
18 3300031239 Ga0265328_10216548 Ga0265328_102165482 124
19 3300038996 Ga0242420_070325 Ga0242420_070325_97_471 124
20 3300039447 Ga0436361_0074042 Ga0436361_0074042_3612_3986 124
21 3300048913 Ga0496110_0006914 Ga0496110_0006914_3495_3869 124
22 3300048914 Ga0496111_0038491 Ga0496111_0038491_2258_2632 124
23 3300048915 Ga0496112_0099234 Ga0496112_0099234_1558_1932 124
24 3300048916 Ga0496113_0859640 Ga0496113_0859640_23_397 124
25 3300049568 Ga0501031_0204240 Ga0501031_0204240_767_1141 124
26 3300049568 Ga0501031_0224853 Ga0501031_0224853_218_631 124
27 3300049575 Ga0501039_0320781 Ga0501039_0320781_656_1030 124
28 3300049577 Ga0501041_0436455 Ga0501041_0436455_205_618 124
29 3300049582 Ga0501048_0358059 Ga0501048_0358059_168_581 124
30 3300049588 Ga0501072_0330184 Ga0501072_0330184_774_1148 124
31 3300049590 Ga0501074_0432223 Ga0501074_0432223_480_893 124
32 3300049592 Ga0501076_0135594 Ga0501076_0135594_1108_1521 124
33 3300049592 Ga0501076_0487364 Ga0501076_0487364_452_826 124
34 3300049592 Ga0501076_0493489 Ga0501076_0493489_283_657 124
35 3300049593 Ga0501077_0102603 Ga0501077_0102603_1069_1443 124
36 3300049593 Ga0501077_0524262 Ga0501077_0524262_309_722 124
37 3300049741 Ga0501079_0493685 Ga0501079_0493685_61_474 124
38 3300049743 Ga0501081_0364210 Ga0501081_0364210_188_562 124
39 3300050491 nmdc:mga00v17_333079_c1 nmdc:mga00v17_333079_c1_147_521 124
40 3300050492 nmdc:mga0yw44_580550_c1 nmdc:mga0yw44_580550_c1_55_429 124
41 3300050507 nmdc:mga05p37_110411_c1 nmdc:mga05p37_110411_c1_2072_2446 124
42 3300050510 nmdc:mga06r32_185152_c1 nmdc:mga06r32_185152_c1_1203_1577 124
43 3300050512 nmdc:mga0n895_162103_c1 nmdc:mga0n895_162103_c1_340_714 124
44 3300050513 nmdc:mga0rr50_66465_c1 nmdc:mga0rr50_66465_c1_217_591 124
45 3300050515 nmdc:mga0a205_31595_c1 nmdc:mga0a205_31595_c1_2696_3070 124
46 3300053096 Ga0500641_0003093 Ga0500641_0003093_4162_4536 124
47 3300054114 Ga0501084_0414741 Ga0501084_0414741_480_893 124
48 3300060353 Ga0501082_0153185 Ga0501082_0153185_410_823 124
49 3300005330 Ga0070690_100340721 Ga0070690_1003407212 126
50 3300005334 Ga0068869_100076146 Ga0068869_1000761461 126
51 3300005338 Ga0068868_100015868 Ga0068868_1000158682 126
52 3300005355 Ga0070671_101565162 Ga0070671_1015651622 126
53 3300005366 Ga0070659_101129822 Ga0070659_1011298221 126
54 3300005366 Ga0070659_101449856 Ga0070659_1014498561 126
55 3300005367 Ga0070667_100215417 Ga0070667_1002154173 126
56 3300005438 Ga0070701_11350658 Ga0070701_113506581 126
57 3300005544 Ga0070686_100070588 Ga0070686_1000705883 126
58 3300005548 Ga0070665_102338534 Ga0070665_1023385342 126
59 3300005563 Ga0068855_100274043 Ga0068855_1002740433 126
60 3300005618 Ga0068864_100566529 Ga0068864_1005665292 126
61 3300005618 Ga0068864_101989601 Ga0068864_1019896012 126
62 3300005843 Ga0068860_101294021 Ga0068860_1012940212 126
63 3300006048 Ga0075363_100390798 Ga0075363_1003907982 126
64 3300006178 Ga0075367_10307819 Ga0075367_103078192 126
65 3300009098 Ga0105245_10040834 Ga0105245_100408342 126
66 3300009176 Ga0105242_10328222 Ga0105242_103282222 126
67 3300009177 Ga0105248_11251779 Ga0105248_112517792 126
68 3300011119 Ga0105246_10188196 Ga0105246_101881963 126
69 3300013296 Ga0157374_11353834 Ga0157374_113538342 126
70 3300013297 Ga0157378_10972110 Ga0157378_109721102 126
71 3300013308 Ga0157375_13020958 Ga0157375_130209582 126
72 3300014326 Ga0157380_10460649 Ga0157380_104606492 126
73 3300017792 Ga0163161_11140107 Ga0163161_111401072 126
74 3300021388 Ga0213875_10224582 Ga0213875_102245822 126
75 3300025927 Ga0207687_10018082 Ga0207687_100180822 126
76 3300025932 Ga0207690_11651061 Ga0207690_116510612 126
77 3300025934 Ga0207686_10282800 Ga0207686_102828002 126
78 3300025940 Ga0207691_10333410 Ga0207691_103334102 126
79 3300025941 Ga0207711_10013031 Ga0207711_100130317 126
80 3300025942 Ga0207689_10077313 Ga0207689_100773132 126
81 3300025949 Ga0207667_10250960 Ga0207667_102509603 126
82 3300025986 Ga0207658_10225311 Ga0207658_102253112 126
83 3300026023 Ga0207677_10010254 Ga0207677_100102542 126
84 3300026041 Ga0207639_11992996 Ga0207639_119929961 126
85 3300026095 Ga0207676_10045758 Ga0207676_100457585 126
86 3300028381 Ga0268264_12025876 Ga0268264_120258762 126
87 3300031548 Ga0307408_101304217 Ga0307408_1013042172 126
88 3300037853 Ga0436364_1030891 Ga0436364_1030891_484_864 126
89 3300039437 Ga0436365_0039437 Ga0436365_0039437_671_1051 126
90 3300048911 Ga0496108_1179617 Ga0496108_1179617_56_436 126
91 3300049571 Ga0501034_0439774 Ga0501034_0439774_677_1057 126
92 3300050494 nmdc:mga06z11_110030_c1 nmdc:mga06z11_110030_c1_949_1329 126
93 3300050494 nmdc:mga06z11_623419_c1 nmdc:mga06z11_623419_c1_99_479 126
94 3300005843 Ga0068860_100388265 Ga0068860_1003882653 127
95 3300005937 Ga0081455_10006689 Ga0081455_100066899 127
96 3300006358 Ga0068871_100066442 Ga0068871_1000664424 127
97 3300009148 Ga0105243_10856071 Ga0105243_108560712 127
98 3300009176 Ga0105242_12691749 Ga0105242_126917491 127
99 3300025935 Ga0207709_11743711 Ga0207709_117437111 127
100 3300026067 Ga0207678_10398333 Ga0207678_103983332 127
101 3300031241 Ga0265325_10279844 Ga0265325_102798442 127
102 3300031242 Ga0265329_10073586 Ga0265329_100735861 127
103 3300031250 Ga0265331_10009252 Ga0265331_100092523 127
104 3300031711 Ga0265314_10032181 Ga0265314_100321815 127
105 3300031712 Ga0265342_10000789 Ga0265342_100007894 127
106 3300034819 Ga0373958_0016668 Ga0373958_0016668_417_800 127
107 3300035083 Ga0373926_0270679 Ga0373926_0270679_80_463 127
108 3300035114 Ga0373939_0027986 Ga0373939_0027986_1122_1505 127
109 3300035207 Ga0373942_0022004 Ga0373942_0022004_1043_1426 127
110 3300035691 Ga0373931_0295045 Ga0373931_0295045_289_672 127
111 3300035692 Ga0373935_0464711 Ga0373935_0464711_232_615 127
112 3300035695 Ga0373927_0038103 Ga0373927_0038103_135_518 127
113 3300035725 Ga0373947_0044634 Ga0373947_0044634_275_658 127
114 3300037068 Ga0373925_0015899 Ga0373925_0015899_2281_2664 127
115 3300046472 Ga0495580_0077469 Ga0495580_0077469_1877_2260 127
116 3300046473 Ga0495582_0376770 Ga0495582_0376770_35_418 127
117 3300046517 Ga0495630_0116762 Ga0495630_0116762_1597_1980 127
118 3300046528 Ga0495642_0206499 Ga0495642_0206499_283_666 127
119 3300046681 Ga0495647_0018946 Ga0495647_0018946_1032_1415 127
120 3300046683 Ga0495658_0202543 Ga0495658_0202543_17_400 127
121 3300046690 Ga0495624_0748718 Ga0495624_0748718_28_411 127
122 3300047315 Ga0495581_0227477 Ga0495581_0227477_588_971 127
123 3300048906 Ga0496103_0616854 Ga0496103_0616854_29_412 127
124 3300048910 Ga0496107_0352673 Ga0496107_0352673_277_660 127
125 3300048917 Ga0496114_0672355 Ga0496114_0672355_51_434 127
126 3300005327 Ga0070658_10758025 Ga0070658_107580251 128
127 3300005336 Ga0070680_100565706 Ga0070680_1005657062 128
128 3300005435 Ga0070714_101577870 Ga0070714_1015778701 128
129 3300005458 Ga0070681_11141251 Ga0070681_111412512 128
130 3300007788 Ga0099795_10144720 Ga0099795_101447202 128
131 3300010159 Ga0099796_10001874 Ga0099796_100018744 128
132 3300025912 Ga0207707_11296137 Ga0207707_112961372 128
133 3300025917 Ga0207660_10206487 Ga0207660_102064872 128
134 3300027512 Ga0209179_1050524 Ga0209179_10505242 128
135 3300003911 JGI25405J52794_10106417 JGI25405J52794_101064172 129
136 3300005356 Ga0070674_101020359 Ga0070674_1010203592 129
137 3300005434 Ga0070709_10136440 Ga0070709_101364402 129
138 3300005435 Ga0070714_100040854 Ga0070714_1000408544 129
139 3300005436 Ga0070713_100008643 Ga0070713_1000086433 129
140 3300005436 Ga0070713_100021793 Ga0070713_1000217932 129
141 3300005437 Ga0070710_10001983 Ga0070710_1000198310 129
142 3300005439 Ga0070711_100024798 Ga0070711_1000247982 129
143 3300005440 Ga0070705_100467303 Ga0070705_1004673031 129
144 3300005445 Ga0070708_100028414 Ga0070708_1000284146 129
145 3300005468 Ga0070707_100029000 Ga0070707_1000290004 129
146 3300005518 Ga0070699_100022614 Ga0070699_1000226144 129
147 3300005544 Ga0070686_101262619 Ga0070686_1012626192 129
148 3300005563 Ga0068855_101810965 Ga0068855_1018109652 129
149 3300005937 Ga0081455_10009933 Ga0081455_100099332 129
150 3300005983 Ga0081540_1022865 Ga0081540_10228652 129
151 3300006028 Ga0070717_10073624 Ga0070717_100736243 129
152 3300006028 Ga0070717_11649243 Ga0070717_116492432 129
153 3300006038 Ga0075365_10022033 Ga0075365_100220334 129
154 3300006038 Ga0075365_10251623 Ga0075365_102516232 129
155 3300006042 Ga0075368_10018493 Ga0075368_100184932 129
156 3300006048 Ga0075363_100004353 Ga0075363_1000043533 129
157 3300006051 Ga0075364_10084734 Ga0075364_100847343 129
158 3300006058 Ga0075432_10222387 Ga0075432_102223872 129
159 3300006163 Ga0070715_10019816 Ga0070715_100198162 129
160 3300006173 Ga0070716_100003805 Ga0070716_1000038055 129
161 3300006177 Ga0075362_10031933 Ga0075362_100319333 129
162 3300006178 Ga0075367_10007557 Ga0075367_100075572 129
163 3300006178 Ga0075367_10552567 Ga0075367_105525672 129
164 3300006186 Ga0075369_10008537 Ga0075369_100085372 129
165 3300006186 Ga0075369_10235975 Ga0075369_102359752 129
166 3300006353 Ga0075370_10098512 Ga0075370_100985122 129
167 3300006353 Ga0075370_10811317 Ga0075370_108113172 129
168 3300006844 Ga0075428_100301853 Ga0075428_1003018532 129
169 3300006846 Ga0075430_101314186 Ga0075430_1013141862 129
170 3300006847 Ga0075431_101629576 Ga0075431_1016295762 129
171 3300006852 Ga0075433_10081328 Ga0075433_100813281 129
172 3300006852 Ga0075433_10390803 Ga0075433_103908032 129
173 3300006871 Ga0075434_100193101 Ga0075434_1001931012 129
174 3300006871 Ga0075434_100194163 Ga0075434_1001941632 129
175 3300006871 Ga0075434_101085717 Ga0075434_1010857172 129
176 3300006871 Ga0075434_101925427 Ga0075434_1019254272 129
177 3300006871 Ga0075434_102465867 Ga0075434_1024658672 129
178 3300006914 Ga0075436_100290258 Ga0075436_1002902582 129
179 3300006914 Ga0075436_100578765 Ga0075436_1005787652 129
180 3300007076 Ga0075435_100041721 Ga0075435_1000417214 129
181 3300007076 Ga0075435_100690574 Ga0075435_1006905741 129
182 3300007076 Ga0075435_101115030 Ga0075435_1011150302 129
183 3300007265 Ga0099794_10034805 Ga0099794_100348052 129
184 3300007788 Ga0099795_10164065 Ga0099795_101640652 129
185 3300009094 Ga0111539_11117361 Ga0111539_111173612 129
186 3300009147 Ga0114129_10210232 Ga0114129_102102322 129
187 3300010159 Ga0099796_10108072 Ga0099796_101080722 129
188 3300021361 Ga0213872_10073984 Ga0213872_100739843 129
189 3300021377 Ga0213874_10068206 Ga0213874_100682062 129
190 3300021377 Ga0213874_10106369 Ga0213874_101063692 129
191 3300025885 Ga0207653_10025281 Ga0207653_100252812 129
192 3300025898 Ga0207692_10072592 Ga0207692_100725922 129
193 3300025905 Ga0207685_10129034 Ga0207685_101290341 129
194 3300025905 Ga0207685_10393401 Ga0207685_103934012 129
195 3300025906 Ga0207699_10005705 Ga0207699_100057055 129
196 3300025910 Ga0207684_10010000 Ga0207684_100100002 129
197 3300025915 Ga0207693_10003033 Ga0207693_1000303314 129
198 3300025915 Ga0207693_10036699 Ga0207693_100366994 129
199 3300025916 Ga0207663_10014075 Ga0207663_100140752 129
200 3300025922 Ga0207646_11618773 Ga0207646_116187732 129
201 3300025928 Ga0207700_10023909 Ga0207700_100239095 129
202 3300025928 Ga0207700_10137754 Ga0207700_101377542 129
203 3300025928 Ga0207700_10139785 Ga0207700_101397852 129
204 3300025929 Ga0207664_10033990 Ga0207664_100339903 129
205 3300025929 Ga0207664_10166971 Ga0207664_101669712 129
206 3300025937 Ga0207669_11373969 Ga0207669_113739691 129
207 3300025939 Ga0207665_10009190 Ga0207665_100091902 129
208 3300025939 Ga0207665_10709432 Ga0207665_107094322 129
209 3300025960 Ga0207651_11861155 Ga0207651_118611552 129
210 3300027671 Ga0209588_1096707 Ga0209588_10967072 129
211 3300027866 Ga0209813_10010947 Ga0209813_100109472 129
212 3300035692 Ga0373935_1300102 Ga0373935_1300102_131_520 129
213 3300037418 Ga0395900_0169521 Ga0395900_0169521_1246_1635 129
214 3300037466 Ga0395898_0091118 Ga0395898_0091118_1666_2055 129
215 3300037471 Ga0395905_0208981 Ga0395905_0208981_788_1177 129
216 3300038443 Ga0395901_1443114 Ga0395901_1443114_181_570 129
217 3300039450 Ga0436363_0212463 Ga0436363_0212463_5240_5638 129
218 3300039450 Ga0436363_1019274 Ga0436363_1019274_349_738 129
219 3300046537 Ga0495598_0147789 Ga0495598_0147789_394_783 129
220 3300048903 Ga0496100_0447286 Ga0496100_0447286_586_975 129
221 3300048904 Ga0496101_0099715 Ga0496101_0099715_658_1047 129
222 3300048905 Ga0496102_0561283 Ga0496102_0561283_180_569 129
223 3300048906 Ga0496103_0683733 Ga0496103_0683733_172_561 129
224 3300048909 Ga0496106_0045536 Ga0496106_0045536_86_475 129
225 3300048917 Ga0496114_0246474 Ga0496114_0246474_118_507 129
226 3300048918 Ga0496115_0788554 Ga0496115_0788554_297_686 129
227 3300049576 Ga0501040_0162481 Ga0501040_0162481_89_478 129
228 3300049578 Ga0501042_0553022 Ga0501042_0553022_206_595 129
229 3300049590 Ga0501074_0589628 Ga0501074_0589628_240_629 129
230 3300049593 Ga0501077_0143133 Ga0501077_0143133_433_822 129
231 3300049742 Ga0501080_0939318 Ga0501080_0939318_138_527 129
232 3300049824 Ga0501045_0227630 Ga0501045_0227630_922_1311 129
233 3300050489 nmdc:mga03683_44385_c1 nmdc:mga03683_44385_c1_1013_1402 129
234 3300050490 nmdc:mga03n38_62148_c1 nmdc:mga03n38_62148_c1_319_708 129
235 3300050491 nmdc:mga00v17_24444_c1 nmdc:mga00v17_24444_c1_1833_2222 129
236 3300050492 nmdc:mga0yw44_38906_c1 nmdc:mga0yw44_38906_c1_435_824 129
237 3300050492 nmdc:mga0yw44_626859_c1 nmdc:mga0yw44_626859_c1_145_534 129
238 3300050494 nmdc:mga06z11_3937_c1 nmdc:mga06z11_3937_c1_3123_3512 129
239 3300050495 nmdc:mga04h51_15701_c1 nmdc:mga04h51_15701_c1_1159_1548 129
240 3300050496 nmdc:mga07m45_114712_c1 nmdc:mga07m45_114712_c1_194_583 129
241 3300050508 nmdc:mga09592_1027782_c1 nmdc:mga09592_1027782_c1_284_676 129
242 3300050511 nmdc:mga08y16_1317040_c1 nmdc:mga08y16_1317040_c1_238_627 129
243 3300050512 nmdc:mga0n895_367794_c1 nmdc:mga0n895_367794_c1_474_863 129
244 3300050513 nmdc:mga0rr50_547544_c1 nmdc:mga0rr50_547544_c1_86_475 129
245 3300050513 nmdc:mga0rr50_654964_c1 nmdc:mga0rr50_654964_c1_313_702 129
246 3300050514 nmdc:mga08x19_209701_c1 nmdc:mga08x19_209701_c1_712_1101 129
247 3300050515 nmdc:mga0a205_185965_c1 nmdc:mga0a205_185965_c1_468_857 129
248 3300050516 nmdc:mga0sz30_12884_c1 nmdc:mga0sz30_12884_c1_983_1372 129
249 3300050516 nmdc:mga0sz30_218159_c1 nmdc:mga0sz30_218159_c1_197_586 129
250 3300053151 Ga0500604_0136157 Ga0500604_0136157_110_499 129
251 3300061734 Ga0530510_0172912 Ga0530510_0172912_883_1272 129
252 3300005981 Ga0081538_10001222 Ga0081538_1000122216 130
253 3300039453 Ga0436362_0659152 Ga0436362_0659152_217_609 130
254 3300049589 Ga0501073_0058769 Ga0501073_0058769_389_781 130
255 3300006852 Ga0075433_10979173 Ga0075433_109791732 131
256 3300007076 Ga0075435_100296342 Ga0075435_1002963422 131
257 3300009094 Ga0111539_10031604 Ga0111539_100316048 131
258 3300009147 Ga0114129_10100689 Ga0114129_101006893 131
259 3300021377 Ga0213874_10100172 Ga0213874_101001722 131
260 3300031238 Ga0265332_10001634 Ga0265332_100016343 131
261 3300031247 Ga0265340_10004984 Ga0265340_100049842 131
262 3300031548 Ga0307408_100929680 Ga0307408_1009296802 131
263 3300035086 Ga0373934_0140473 Ga0373934_0140473_32_427 131
264 3300035117 Ga0373953_0020273 Ga0373953_0020273_466_861 131
265 3300035118 Ga0373954_0016911 Ga0373954_0016911_2284_2679 131
266 3300035692 Ga0373935_0169375 Ga0373935_0169375_678_1073 131
267 3300036401 Ga0373937_0082578 Ga0373937_0082578_516_911 131
268 3300039450 Ga0436363_1038944 Ga0436363_1038944_241_636 131
269 3300046462 Ga0495651_0078422 Ga0495651_0078422_681_1076 131
270 3300046476 Ga0495662_0058872 Ga0495662_0058872_1056_1451 131
271 3300046529 Ga0495652_0115125 Ga0495652_0115125_148_543 131
272 3300046663 Ga0495635_0111722 Ga0495635_0111722_256_651 131
273 3300047322 Ga0495680_0042185 Ga0495680_0042185_2172_2567 131
274 3300050511 nmdc:mga08y16_69953_c1 nmdc:mga08y16_69953_c1_1678_2073 131
275 3300050513 nmdc:mga0rr50_425483_c1 nmdc:mga0rr50_425483_c1_508_903 131
276 3300050515 nmdc:mga0a205_44618_c1 nmdc:mga0a205_44618_c1_2244_2639 131
277 3300053077 Ga0495601_0137564 Ga0495601_0137564_337_732 131
278 3300053084 Ga0495595_0245220 Ga0495595_0245220_246_641 131
279 3300053119 Ga0500595_042281 Ga0500595_042281_771_1166 131
280 3300053131 Ga0500652_000004 Ga0500652_000004_2835_3230 131
281 3300003659 JGI25404J52841_10066084 JGI25404J52841_100660842 132
282 3300005458 Ga0070681_10931486 Ga0070681_109314861 132
283 3300005530 Ga0070679_100106770 Ga0070679_1001067703 132
284 3300005563 Ga0068855_100319684 Ga0068855_1003196842 132
285 3300005983 Ga0081540_1003345 Ga0081540_100334513 132
286 3300006353 Ga0075370_10119312 Ga0075370_101193123 132
287 3300006880 Ga0075429_101769964 Ga0075429_1017699642 132
288 3300025917 Ga0207660_10676916 Ga0207660_106769162 132
289 3300025921 Ga0207652_10110831 Ga0207652_101108312 132
290 3300045049 Ga0466959_0332866 Ga0466959_0332866_281_697 132
291 3300045836 Ga0466958_0299425 Ga0466958_0299425_507_905 132
292 3300045976 Ga0466967_0013237 Ga0466967_0013237_1993_2391 132
293 3300049572 Ga0501036_0190463 Ga0501036_0190463_628_1032 132
294 3300049573 Ga0501037_0096552 Ga0501037_0096552_757_1161 132
295 3300049574 Ga0501038_0033179 Ga0501038_0033179_1435_1839 132
296 3300049579 Ga0501043_0306297 Ga0501043_0306297_505_909 132
297 3300049581 Ga0501047_0164411 Ga0501047_0164411_941_1345 132
298 3300049586 Ga0501070_0045164 Ga0501070_0045164_1166_1570 132
299 3300049742 Ga0501080_0100580 Ga0501080_0100580_1885_2289 132
300 3300049822 Ga0501035_0040344 Ga0501035_0040344_1297_1701 132
301 3300049823 Ga0501044_0067421 Ga0501044_0067421_1591_1995 132
302 3300049823 Ga0501044_0511975 Ga0501044_0511975_10_414 132
303 3300050490 nmdc:mga03n38_854361_c1 nmdc:mga03n38_854361_c1_119_517 132
304 3300050491 nmdc:mga00v17_192591_c1 nmdc:mga00v17_192591_c1_179_577 132
305 3300050496 nmdc:mga07m45_51307_c1 nmdc:mga07m45_51307_c1_1711_2109 132
306 3300050507 nmdc:mga05p37_101388_c1 nmdc:mga05p37_101388_c1_1638_2036 132
307 3300050508 nmdc:mga09592_1560380_c1 nmdc:mga09592_1560380_c1_24_437 132
308 3300050510 nmdc:mga06r32_650230_c1 nmdc:mga06r32_650230_c1_184_597 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

10

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yxd-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with flutolanil 0.8585 26 125
4ytp-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide 0.858 26 127
6myo-assembly1.cif.gz_D avian mitochondrial complex ii with flutolanyl bound 0.8563 26 123
1yq4-assembly1.cif.gz_D avian respiratory complex ii with 3-nitropropionate and ubiquinone 0.8496 26 120
3abv-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.8431 26 120
ID Description Score Start End Superfamily
3sfdD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8625 26 125 1.20.1300.10
4ytpD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.858 26 127 1.20.1300.10
3ae6D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8554 26 125 1.20.1300.10
3ae7D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8538 26 125 1.20.1300.10
3aeeD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8537 26 125 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A527GFI1-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9747 65 132 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A832DFY7-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9731 65 132 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A4U7EYN9-F1-model_v4 Succinate dehydrogenase, hydrophobic membrane anchor protein 0.9681 65 132 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A258C8M7-F1-model_v4 deleted 0.9421 61 129
AF-A0A848V830-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.917 57 131 GO:0006099
GO:0016020
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.53 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map