F399614

General Info

Members Datasets Scaffolds Average Seq Length
308 217 616 228

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100007435|Ga0068860_1000074359
Length 232
Sequence MVEAALKRVPGRGRFITFEGGEGSGKSTQIRKLSERLTGTKLRNIVTREPGGSPGAEIMRHLVLSGMGKLLGPDAETLLFAAARDDHVRTVIQPALNQGIWVLCDRFSDSTRAYQGRVGNVPVGVLNAMQRVTIGDLKPDLTIILDVPVEVGLKRAAARRGNGAPDRFEAEDLKFHRDLREAYRQIAAEDPQRCVLIDASADPDTVAAQVWSILRNRLFMTATTAPPTAAMP

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
195 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
196 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
203 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
204 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
205 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
209 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
210 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
214 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
215 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
216 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
217 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0.32
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.69
Nodule 0.97
Rhizoplane 8.12
Rhizosphere 68.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100007435 3300005843 Bacteria 10954
2 JGI25406J46586_10008153 3300003203 Bacteria 4757
3 JGI25404J52841_10010431 3300003659 Bacteria 1997
4 JGI25404J52841_10011027 3300003659 Bacteria 1946
5 JGI25404J52841_10016261 3300003659 Bacteria 1614
6 Ga0065715_10307315 3300005293 Bacteria 1028
7 Ga0070683_100384750 3300005329 Bacteria 1337
8 Ga0068868_100368433 3300005338 Bacteria 1234
9 Ga0070709_10035234 3300005434 Bacteria 3041
10 Ga0070709_10204329 3300005434 Bacteria 1401
11 Ga0070713_100031531 3300005436 Bacteria 4223
12 Ga0070713_100036321 3300005436 Bacteria 3975
13 Ga0070710_10011645 3300005437 Bacteria 4351
14 Ga0070711_100046236 3300005439 Bacteria 2965
15 Ga0070711_100073032 3300005439 Bacteria 2422
16 Ga0070681_10028926 3300005458 Bacteria 5568
17 Ga0070707_100280612 3300005468 Bacteria 1619
18 Ga0070698_100084427 3300005471 Bacteria 3164
19 Ga0070679_100010413 3300005530 Bacteria 8821
20 Ga0070679_100177821 3300005530 Bacteria 2101
21 Ga0070679_100256322 3300005530 Bacteria 1705
22 Ga0070679_100535136 3300005530 Bacteria 1115
23 Ga0070684_100057400 3300005535 Bacteria 3399
24 Ga0070665_100883570 3300005548 Bacteria 907
25 Ga0070665_100983833 3300005548 Bacteria 856
26 Ga0068855_100512174 3300005563 Bacteria 1303
27 Ga0068855_101111720 3300005563 Bacteria 826
28 Ga0070664_100516371 3300005564 Bacteria 1102
29 Ga0068857_100082766 3300005577 Bacteria 2867
30 Ga0068856_100243544 3300005614 Bacteria 1813
31 Ga0070702_100100086 3300005615 Bacteria 1776
32 Ga0068864_100113468 3300005618 Bacteria 2416
33 Ga0068858_100122065 3300005842 Bacteria 2437
34 Ga0068858_100236488 3300005842 Bacteria 1732
35 Ga0068858_100517563 3300005842 Bacteria 1154
36 Ga0081455_10018364 3300005937 Bacteria 6666
37 Ga0081540_1000248 3300005983 Bacteria 56862
38 Ga0081540_1002279 3300005983 Bacteria 15773
39 Ga0081540_1005772 3300005983 Bacteria 9165
40 Ga0081540_1016448 3300005983 Bacteria 4627
41 Ga0081540_1020961 3300005983 Bacteria 3912
42 Ga0081539_10000152 3300005985 Bacteria 160005
43 Ga0070717_10018411 3300006028 Bacteria 5452
44 Ga0070717_10063880 3300006028 Bacteria 3057
45 Ga0075365_10332760 3300006038 Bacteria 1070
46 Ga0075365_10360763 3300006038 Bacteria 1024
47 Ga0075368_10020890 3300006042 Bacteria 2482
48 Ga0075363_100067051 3300006048 Bacteria 1944
49 Ga0075363_100089840 3300006048 Bacteria 1689
50 Ga0070712_100129795 3300006175 Bacteria 1908
51 Ga0070712_100365581 3300006175 Bacteria 1184
52 Ga0075367_10092149 3300006178 Bacteria 1844
53 Ga0075436_100291399 3300006914 Bacteria 1168
54 Ga0075435_100070194 3300007076 Bacteria 2859
55 Ga0105240_10039567 3300009093 Bacteria 6037
56 Ga0105240_10429917 3300009093 Bacteria 1482
57 Ga0105240_10483968 3300009093 Bacteria 1379
58 Ga0105245_10812084 3300009098 Bacteria 974
59 Ga0105247_10155021 3300009101 Bacteria 1512
60 Ga0105241_10018091 3300009174 Bacteria 5182
61 Ga0105241_10041179 3300009174 Bacteria 3489
62 Ga0105241_10856114 3300009174 Bacteria 841
63 Ga0105248_10086187 3300009177 Bacteria 3534
64 Ga0105237_10066705 3300009545 Bacteria 3593
65 Ga0105237_10072126 3300009545 Bacteria 3447
66 Ga0105238_10111748 3300009551 Bacteria 2712
67 Ga0105238_10252323 3300009551 Bacteria 1743
68 Ga0105238_10289800 3300009551 Bacteria 1619
69 Ga0105238_10303842 3300009551 Bacteria 1579
70 Ga0099796_10046527 3300010159 Bacteria 1490
71 Ga0099796_10050496 3300010159 Bacteria 1442
72 Ga0105239_10046276 3300010375 Bacteria 4768
73 Ga0105239_10193440 3300010375 Bacteria 2277
74 Ga0105239_10307152 3300010375 Bacteria 1787
75 Ga0105239_10340722 3300010375 Bacteria 1692
76 Ga0157369_10015771 3300013105 Bacteria 8514
77 Ga0157369_10066697 3300013105 Bacteria 3871
78 Ga0157369_10234680 3300013105 Bacteria 1917
79 Ga0157369_10289457 3300013105 Bacteria 1705
80 Ga0157374_10130516 3300013296 Bacteria 2432
81 Ga0157372_10204964 3300013307 Bacteria 2285
82 Ga0157375_10473987 3300013308 Bacteria 1417
83 Ga0157380_10050577 3300014326 Bacteria 3283
84 Ga0157379_10056293 3300014968 Bacteria 3514
85 Ga0197907_11360137 3300020069 Bacteria 1261
86 Ga0213872_10089187 3300021361 Bacteria 1381
87 Ga0213876_10030128 3300021384 Bacteria 2861
88 Ga0213875_10071935 3300021388 Bacteria 1614
89 Ga0213871_10014939 3300021441 Bacteria 1849
90 Ga0209233_1001743 3300025261 Bacteria 8400
91 Ga0209455_1010217 3300025272 Bacteria 2401
92 Ga0207692_10023155 3300025898 Bacteria 2869
93 Ga0207710_10074646 3300025900 Bacteria 1561
94 Ga0207699_10168021 3300025906 Bacteria 1465
95 Ga0207684_10024912 3300025910 Bacteria 5099
96 Ga0207707_10000413 3300025912 Bacteria 44774
97 Ga0207707_10024411 3300025912 Bacteria 5289
98 Ga0207707_10027291 3300025912 Bacteria 4994
99 Ga0207695_10063674 3300025913 Bacteria 3801
100 Ga0207671_10155411 3300025914 Bacteria 1769
101 Ga0207671_10239253 3300025914 Bacteria 1426
102 Ga0207693_10070377 3300025915 Bacteria 2737
103 Ga0207693_10248654 3300025915 Bacteria 1395
104 Ga0207693_10351511 3300025915 Bacteria 1153
105 Ga0207663_10027821 3300025916 Bacteria 3300
106 Ga0207663_10226395 3300025916 Bacteria 1363
107 Ga0207660_10061580 3300025917 Bacteria 2701
108 Ga0207652_10018894 3300025921 Bacteria 5659
109 Ga0207652_10285959 3300025921 Bacteria 1488
110 Ga0207646_10239248 3300025922 Bacteria 1640
111 Ga0207694_10003246 3300025924 Bacteria 12960
112 Ga0207694_10143232 3300025924 Bacteria 1923
113 Ga0207694_10197245 3300025924 Bacteria 1637
114 Ga0207700_10024344 3300025928 Bacteria 4190
115 Ga0207700_10025196 3300025928 Bacteria 4128
116 Ga0207664_10050994 3300025929 Bacteria 3266
117 Ga0207686_10123023 3300025934 Bacteria 1768
118 Ga0207669_10528552 3300025937 Bacteria 948
119 Ga0207704_10101433 3300025938 Bacteria 1920
120 Ga0207665_10058299 3300025939 Bacteria 2610
121 Ga0207665_10151982 3300025939 Bacteria 1659
122 Ga0207667_10187070 3300025949 Bacteria 2125
123 Ga0207667_10432126 3300025949 Bacteria 1339
124 Ga0207658_10449485 3300025986 Bacteria 1141
125 Ga0207703_10064929 3300026035 Bacteria 2998
126 Ga0207703_10239049 3300026035 Bacteria 1632
127 Ga0207639_10036191 3300026041 Bacteria 3657
128 Ga0207639_10094630 3300026041 Bacteria 2399
129 Ga0207639_10259534 3300026041 Bacteria 1519
130 Ga0207702_10424032 3300026078 Bacteria 1287
131 Ga0207648_10372614 3300026089 Bacteria 1290
132 Ga0207676_10479482 3300026095 Bacteria 1178
133 Ga0207674_10095949 3300026116 Bacteria 2951
134 Ga0207683_10701613 3300026121 Bacteria 938
135 Ga0268266_10784136 3300028379 Bacteria 920
136 Ga0268264_10000043 3300028381 Bacteria 371761
137 Ga0268264_10139228 3300028381 Bacteria 2162
138 Ga0265319_1011947 3300028563 Bacteria 3530
139 Ga0265334_10001313 3300028573 Bacteria 11986
140 Ga0265318_10014386 3300028577 Bacteria 3324
141 Ga0265323_10002710 3300028653 Bacteria 7986
142 Ga0265336_10004511 3300028666 Bacteria 5254
143 Ga0307515_10015192 3300028794 Bacteria 14202
144 Ga0265338_10001194 3300028800 Bacteria 42941
145 Ga0265332_10049395 3300031238 Bacteria 1809
146 Ga0265339_10023006 3300031249 Bacteria 3605
147 Ga0265339_10028253 3300031249 Bacteria 3192
148 Ga0265316_10125726 3300031344 Bacteria 1934
149 Ga0307513_10145375 3300031456 Bacteria 2290
150 Ga0307509_10088490 3300031507 Bacteria 3178
151 Ga0307509_10232507 3300031507 Bacteria 1645
152 Ga0265314_10021998 3300031711 Bacteria 4890
153 Ga0265342_10004814 3300031712 Bacteria 10472
154 Ga0307516_10033810 3300031730 Bacteria 5143
155 Ga0307516_10287764 3300031730 Bacteria 1323
156 Ga0307405_10329293 3300031731 Bacteria 1170
157 Ga0307507_10172185 3300033179 Bacteria 1570
158 Ga0307510_10085961 3300033180 Bacteria 3019
159 Ga0316212_1030035 3300033547 Bacteria 764
160 Ga0373944_0080909 3300035089 Bacteria 1073
161 Ga0373923_0025855 3300035111 Bacteria 2331
162 Ga0373941_0028915 3300035115 Bacteria 1631
163 Ga0373957_0096254 3300035120 Bacteria 1181
164 Ga0373957_0296184 3300035120 Bacteria 686
165 Ga0373955_0068928 3300035172 Bacteria 1972
166 Ga0373955_0419553 3300035172 Bacteria 814
167 Ga0373924_0041861 3300035410 Bacteria 1878
168 Ga0373931_0010989 3300035691 Bacteria 4364
169 Ga0373935_0557222 3300035692 Bacteria 836
170 Ga0373935_0560574 3300035692 Bacteria 833
171 Ga0373927_0026204 3300035695 Bacteria 3810
172 Ga0373927_0088592 3300035695 Bacteria 2009
173 Ga0373933_0039089 3300035724 Bacteria 2790
174 Ga0373947_0063645 3300035725 Bacteria 2248
175 Ga0373937_0011408 3300036401 Bacteria 7798
176 Ga0373925_0096342 3300037068 Bacteria 2268
177 Ga0373925_0121018 3300037068 Bacteria 2032
178 Ga0436364_1032192 3300037853 Bacteria 2784
179 Ga0436365_0001581 3300039437 Bacteria 1980
180 Ga0436365_0774235 3300039437 Bacteria 3029
181 Ga0436365_1243874 3300039437 Bacteria 2122
182 Ga0436365_1388183 3300039437 Bacteria 3856
183 Ga0436361_0582210 3300039447 Bacteria 2232
184 Ga0436363_1390407 3300039450 Bacteria 2955
185 Ga0436362_0735454 3300039453 Bacteria 2457
186 Ga0466969_0083077 3300044656 Bacteria 1526
187 Ga0466969_0152987 3300044656 Bacteria 1062
188 Ga0466966_0097357 3300044684 Bacteria 1822
189 Ga0466966_0196859 3300044684 Bacteria 1220
190 Ga0466963_0154554 3300044694 Bacteria 1594
191 Ga0466959_0034306 3300045049 Bacteria 3753
192 Ga0466959_0051717 3300045049 Bacteria 3011
193 Ga0466967_0120627 3300045976 Bacteria 2422
194 Ga0466967_0244347 3300045976 Bacteria 1713
195 Ga0495603_0121187 3300046455 Bacteria 1524
196 Ga0495629_0057231 3300046459 Bacteria 2726
197 Ga0495638_0226034 3300046460 Bacteria 1044
198 Ga0495651_0030336 3300046462 Bacteria 4217
199 Ga0495651_0061560 3300046462 Bacteria 2872
200 Ga0495580_0074404 3300046472 Bacteria 2371
201 Ga0495582_0151617 3300046473 Bacteria 1316
202 Ga0495639_0084812 3300046475 Bacteria 1480
203 Ga0495628_0473697 3300046516 Bacteria 907
204 Ga0495630_0429402 3300046517 Bacteria 1012
205 Ga0495652_0139321 3300046529 Bacteria 1909
206 Ga0495640_0088729 3300046533 Bacteria 2043
207 Ga0495609_0125751 3300046538 Bacteria 1100
208 Ga0495667_0155533 3300046559 Bacteria 1471
209 Ga0495668_0105436 3300046616 Bacteria 1542
210 Ga0495634_0043851 3300046642 Bacteria 3030
211 Ga0495635_0098605 3300046663 Bacteria 1997
212 Ga0495657_0185366 3300046675 Bacteria 1274
213 Ga0495599_0557704 3300046678 Bacteria 670
214 Ga0495647_0073283 3300046681 Bacteria 1375
215 Ga0495669_0092183 3300046684 Bacteria 1400
216 Ga0495613_0203653 3300046689 Bacteria 1394
217 Ga0495600_0179722 3300046809 Bacteria 1363
218 Ga0495604_0106196 3300047317 Bacteria 2054
219 Ga0495674_0285754 3300047319 Bacteria 1350
220 Ga0495672_0003056 3300047320 Bacteria 14644
221 Ga0495675_0012245 3300047444 Bacteria 5398
222 Ga0495602_0036570 3300048088 Bacteria 4568
223 Ga0495602_0285104 3300048088 Bacteria 1215
224 Ga0496100_0776858 3300048903 Bacteria 750
225 Ga0496101_0014835 3300048904 Bacteria 5243
226 Ga0496101_0122367 3300048904 Bacteria 1968
227 Ga0496102_0058773 3300048905 Bacteria 3514
228 Ga0496102_0059397 3300048905 Bacteria 3497
229 Ga0496103_0057143 3300048906 Bacteria 2422
230 Ga0496104_0112102 3300048907 Bacteria 2615
231 Ga0496105_0011146 3300048908 Bacteria 7091
232 Ga0496106_0005058 3300048909 Bacteria 9760
233 Ga0496106_0037692 3300048909 Bacteria 3617
234 Ga0496106_0292844 3300048909 Bacteria 1305
235 Ga0496107_0020342 3300048910 Bacteria 4687
236 Ga0496107_0321351 3300048910 Bacteria 1152
237 Ga0496108_0059508 3300048911 Bacteria 3212
238 Ga0496108_0658399 3300048911 Bacteria 910
239 Ga0496109_0070635 3300048912 Bacteria 3205
240 Ga0496109_0077041 3300048912 Bacteria 3068
241 Ga0496110_0026557 3300048913 Bacteria 4957
242 Ga0496110_0057131 3300048913 Bacteria 3435
243 Ga0496112_0014561 3300048915 Bacteria 7306
244 Ga0496112_0222757 3300048915 Bacteria 1842
245 Ga0496113_0041032 3300048916 Bacteria 3412
246 Ga0496114_0013880 3300048917 Bacteria 6458
247 Ga0496114_0151606 3300048917 Bacteria 2011
248 Ga0496115_0078994 3300048918 Bacteria 2678
249 Ga0496116_0260672 3300048919 Bacteria 855
250 Ga0496117_0011872 3300048920 Bacteria 7749
251 Ga0496118_0004195 3300048921 Bacteria 17323
252 Ga0496119_0238467 3300048922 Bacteria 922
253 Ga0496121_0000110 3300048924 Bacteria 186482
254 Ga0496121_0277230 3300048924 Bacteria 1149
255 Ga0496122_0050490 3300048925 Bacteria 3172
256 Ga0496124_0014758 3300048927 Bacteria 7539
257 Ga0496125_0028656 3300048928 Bacteria 5023
258 Ga0496126_0017652 3300048929 Bacteria 7108
259 Ga0496126_0018667 3300048929 Bacteria 6863
260 Ga0496126_0036050 3300048929 Bacteria 4630
261 Ga0496126_0181892 3300048929 Bacteria 1785
262 Ga0496126_0347216 3300048929 Bacteria 1214
263 Ga0501042_0085426 3300049578 Bacteria 2263
264 Ga0501047_0251056 3300049581 Bacteria 1617
265 Ga0501048_0142648 3300049582 Bacteria 1694
266 Ga0501070_0037890 3300049586 Bacteria 4024
267 Ga0501080_0100379 3300049742 Bacteria 2685
268 Ga0501044_0075755 3300049823 Bacteria 3416
269 nmdc:mga0yw44_180054_c1 3300050492 Bacteria 1391
270 nmdc:mga0yw44_342104_c1 3300050492 Bacteria 1006
271 nmdc:mga0yw44_547210_c1 3300050492 Bacteria 786
272 nmdc:mga0n895_7189_c1 3300050512 Bacteria 9528
273 nmdc:mga08x19_416826_c1 3300050514 Bacteria 943
274 Ga0495601_0085587 3300053077 Bacteria 2025
275 Ga0495601_0438503 3300053077 Bacteria 845
276 Ga0500635_0006725 3300053080 Bacteria 3083
277 Ga0500635_0027507 3300053080 Bacteria 1808
278 Ga0495595_0072995 3300053084 Bacteria 1624
279 Ga0500647_0043925 3300053091 Bacteria 2145
280 Ga0500566_0000122 3300053094 Bacteria 40534
281 Ga0500640_013573 3300053095 Bacteria 3373
282 Ga0500572_000053 3300053111 Bacteria 34807
283 Ga0500591_039354 3300053115 Bacteria 2257
284 Ga0500595_027610 3300053119 Bacteria 1942
285 Ga0500608_093040 3300053122 Bacteria 1406
286 Ga0500614_007786 3300053123 Bacteria 2263
287 Ga0500559_0010571 3300053136 Bacteria 3959
288 Ga0500559_0046754 3300053136 Bacteria 1898
289 Ga0500573_0006358 3300053140 Bacteria 6384
290 Ga0500590_016046 3300053148 Bacteria 3870
291 Ga0500590_077500 3300053148 Bacteria 1640
292 Ga0500603_000229 3300053150 Bacteria 14636
293 Ga0500630_000099 3300053159 Bacteria 27705
294 Ga0500639_000008 3300053163 Bacteria 143238
295 Ga0500639_103638 3300053163 Bacteria 1395
296 Ga0500636_0125180 3300053177 Bacteria 1437
297 Ga0500637_0016660 3300053178 Bacteria 3922
298 Ga0500657_040059 3300053728 Bacteria 2181
299 Ga0500596_005742 3300053735 Bacteria 2152
300 Ga0500596_007500 3300053735 Bacteria 1786
301 Ga0500661_018830 3300055283 Bacteria 1230
302 Ga0501082_0179048 3300060353 Bacteria 1844
303 Ga0466962_0108435 3300061719 Bacteria 1336
304 2513675616 2513237098 Bacteria 9902361
305 2524464289 2524023210 Bacteria 9029266
306 2885387452 2885383462 Bacteria 9473874
307 2903769128 2903768456 Bacteria 9749579
308 8056688093 8056681323 Bacteria 8472857
309 Ga0068860_100007435
310 JGI25406J46586_10008153
311 JGI25404J52841_10010431
312 JGI25404J52841_10011027
313 JGI25404J52841_10016261
314 Ga0065715_10307315
315 Ga0070683_100384750
316 Ga0068868_100368433
317 Ga0070709_10035234
318 Ga0070709_10204329
319 Ga0070713_100031531
320 Ga0070713_100036321
321 Ga0070710_10011645
322 Ga0070711_100046236
323 Ga0070711_100073032
324 Ga0070681_10028926
325 Ga0070707_100280612
326 Ga0070698_100084427
327 Ga0070679_100010413
328 Ga0070679_100177821
329 Ga0070679_100256322
330 Ga0070679_100535136
331 Ga0070684_100057400
332 Ga0070665_100883570
333 Ga0070665_100983833
334 Ga0068855_100512174
335 Ga0068855_101111720
336 Ga0070664_100516371
337 Ga0068857_100082766
338 Ga0068856_100243544
339 Ga0070702_100100086
340 Ga0068864_100113468
341 Ga0068858_100122065
342 Ga0068858_100236488
343 Ga0068858_100517563
344 Ga0081455_10018364
345 Ga0081540_1000248
346 Ga0081540_1002279
347 Ga0081540_1005772
348 Ga0081540_1016448
349 Ga0081540_1020961
350 Ga0081539_10000152
351 Ga0070717_10018411
352 Ga0070717_10063880
353 Ga0075365_10332760
354 Ga0075365_10360763
355 Ga0075368_10020890
356 Ga0075363_100067051
357 Ga0075363_100089840
358 Ga0070712_100129795
359 Ga0070712_100365581
360 Ga0075367_10092149
361 Ga0075436_100291399
362 Ga0075435_100070194
363 Ga0105240_10039567
364 Ga0105240_10429917
365 Ga0105240_10483968
366 Ga0105245_10812084
367 Ga0105247_10155021
368 Ga0105241_10018091
369 Ga0105241_10041179
370 Ga0105241_10856114
371 Ga0105248_10086187
372 Ga0105237_10066705
373 Ga0105237_10072126
374 Ga0105238_10111748
375 Ga0105238_10252323
376 Ga0105238_10289800
377 Ga0105238_10303842
378 Ga0099796_10046527
379 Ga0099796_10050496
380 Ga0105239_10046276
381 Ga0105239_10193440
382 Ga0105239_10307152
383 Ga0105239_10340722
384 Ga0157369_10015771
385 Ga0157369_10066697
386 Ga0157369_10234680
387 Ga0157369_10289457
388 Ga0157374_10130516
389 Ga0157372_10204964
390 Ga0157375_10473987
391 Ga0157380_10050577
392 Ga0157379_10056293
393 Ga0197907_11360137
394 Ga0213872_10089187
395 Ga0213876_10030128
396 Ga0213875_10071935
397 Ga0213871_10014939
398 Ga0209233_1001743
399 Ga0209455_1010217
400 Ga0207692_10023155
401 Ga0207710_10074646
402 Ga0207699_10168021
403 Ga0207684_10024912
404 Ga0207707_10000413
405 Ga0207707_10024411
406 Ga0207707_10027291
407 Ga0207695_10063674
408 Ga0207671_10155411
409 Ga0207671_10239253
410 Ga0207693_10070377
411 Ga0207693_10248654
412 Ga0207693_10351511
413 Ga0207663_10027821
414 Ga0207663_10226395
415 Ga0207660_10061580
416 Ga0207652_10018894
417 Ga0207652_10285959
418 Ga0207646_10239248
419 Ga0207694_10003246
420 Ga0207694_10143232
421 Ga0207694_10197245
422 Ga0207700_10024344
423 Ga0207700_10025196
424 Ga0207664_10050994
425 Ga0207686_10123023
426 Ga0207669_10528552
427 Ga0207704_10101433
428 Ga0207665_10058299
429 Ga0207665_10151982
430 Ga0207667_10187070
431 Ga0207667_10432126
432 Ga0207658_10449485
433 Ga0207703_10064929
434 Ga0207703_10239049
435 Ga0207639_10036191
436 Ga0207639_10094630
437 Ga0207639_10259534
438 Ga0207702_10424032
439 Ga0207648_10372614
440 Ga0207676_10479482
441 Ga0207674_10095949
442 Ga0207683_10701613
443 Ga0268266_10784136
444 Ga0268264_10000043
445 Ga0268264_10139228
446 Ga0265319_1011947
447 Ga0265334_10001313
448 Ga0265318_10014386
449 Ga0265323_10002710
450 Ga0265336_10004511
451 Ga0307515_10015192
452 Ga0265338_10001194
453 Ga0265332_10049395
454 Ga0265339_10023006
455 Ga0265339_10028253
456 Ga0265316_10125726
457 Ga0307513_10145375
458 Ga0307509_10088490
459 Ga0307509_10232507
460 Ga0265314_10021998
461 Ga0265342_10004814
462 Ga0307516_10033810
463 Ga0307516_10287764
464 Ga0307405_10329293
465 Ga0307507_10172185
466 Ga0307510_10085961
467 Ga0316212_1030035
468 Ga0373944_0080909
469 Ga0373923_0025855
470 Ga0373941_0028915
471 Ga0373957_0096254
472 Ga0373957_0296184
473 Ga0373955_0068928
474 Ga0373955_0419553
475 Ga0373924_0041861
476 Ga0373931_0010989
477 Ga0373935_0557222
478 Ga0373935_0560574
479 Ga0373927_0026204
480 Ga0373927_0088592
481 Ga0373933_0039089
482 Ga0373947_0063645
483 Ga0373937_0011408
484 Ga0373925_0096342
485 Ga0373925_0121018
486 Ga0436364_1032192
487 Ga0436365_0001581
488 Ga0436365_0774235
489 Ga0436365_1243874
490 Ga0436365_1388183
491 Ga0436361_0582210
492 Ga0436363_1390407
493 Ga0436362_0735454
494 Ga0466969_0083077
495 Ga0466969_0152987
496 Ga0466966_0097357
497 Ga0466966_0196859
498 Ga0466963_0154554
499 Ga0466959_0034306
500 Ga0466959_0051717
501 Ga0466967_0120627
502 Ga0466967_0244347
503 Ga0495603_0121187
504 Ga0495629_0057231
505 Ga0495638_0226034
506 Ga0495651_0030336
507 Ga0495651_0061560
508 Ga0495580_0074404
509 Ga0495582_0151617
510 Ga0495639_0084812
511 Ga0495628_0473697
512 Ga0495630_0429402
513 Ga0495652_0139321
514 Ga0495640_0088729
515 Ga0495609_0125751
516 Ga0495667_0155533
517 Ga0495668_0105436
518 Ga0495634_0043851
519 Ga0495635_0098605
520 Ga0495657_0185366
521 Ga0495599_0557704
522 Ga0495647_0073283
523 Ga0495669_0092183
524 Ga0495613_0203653
525 Ga0495600_0179722
526 Ga0495604_0106196
527 Ga0495674_0285754
528 Ga0495672_0003056
529 Ga0495675_0012245
530 Ga0495602_0036570
531 Ga0495602_0285104
532 Ga0496100_0776858
533 Ga0496101_0014835
534 Ga0496101_0122367
535 Ga0496102_0058773
536 Ga0496102_0059397
537 Ga0496103_0057143
538 Ga0496104_0112102
539 Ga0496105_0011146
540 Ga0496106_0005058
541 Ga0496106_0037692
542 Ga0496106_0292844
543 Ga0496107_0020342
544 Ga0496107_0321351
545 Ga0496108_0059508
546 Ga0496108_0658399
547 Ga0496109_0070635
548 Ga0496109_0077041
549 Ga0496110_0026557
550 Ga0496110_0057131
551 Ga0496112_0014561
552 Ga0496112_0222757
553 Ga0496113_0041032
554 Ga0496114_0013880
555 Ga0496114_0151606
556 Ga0496115_0078994
557 Ga0496116_0260672
558 Ga0496117_0011872
559 Ga0496118_0004195
560 Ga0496119_0238467
561 Ga0496121_0000110
562 Ga0496121_0277230
563 Ga0496122_0050490
564 Ga0496124_0014758
565 Ga0496125_0028656
566 Ga0496126_0017652
567 Ga0496126_0018667
568 Ga0496126_0036050
569 Ga0496126_0181892
570 Ga0496126_0347216
571 Ga0501042_0085426
572 Ga0501047_0251056
573 Ga0501048_0142648
574 Ga0501070_0037890
575 Ga0501080_0100379
576 Ga0501044_0075755
577 nmdc:mga0yw44_180054_c1
578 nmdc:mga0yw44_342104_c1
579 nmdc:mga0yw44_547210_c1
580 nmdc:mga0n895_7189_c1
581 nmdc:mga08x19_416826_c1
582 Ga0495601_0085587
583 Ga0495601_0438503
584 Ga0500635_0006725
585 Ga0500635_0027507
586 Ga0495595_0072995
587 Ga0500647_0043925
588 Ga0500566_0000122
589 Ga0500640_013573
590 Ga0500572_000053
591 Ga0500591_039354
592 Ga0500595_027610
593 Ga0500608_093040
594 Ga0500614_007786
595 Ga0500559_0010571
596 Ga0500559_0046754
597 Ga0500573_0006358
598 Ga0500590_016046
599 Ga0500590_077500
600 Ga0500603_000229
601 Ga0500630_000099
602 Ga0500639_000008
603 Ga0500639_103638
604 Ga0500636_0125180
605 Ga0500637_0016660
606 Ga0500657_040059
607 Ga0500596_005742
608 Ga0500596_007500
609 Ga0500661_018830
610 Ga0501082_0179048
611 Ga0466962_0108435
612 2513675616
613 2524464289
614 2885387452
615 2903769128
616 8056688093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

18

210

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xbh-assembly1.cif.gz_B crystal structure of r145e mutant of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.8988 16 217
5h56-assembly1.cif.gz_B adp and dtdp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.8984 16 219
5xb5-assembly1.cif.gz_B crystal structure of r90a mutant of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.8949 16 217
5xt8-assembly1.cif.gz_B magnesium bound apo structure of thymidylate kinase (form i) from thermus thermophilus hb8 0.8947 14 219
5xb5-assembly1.cif.gz_A crystal structure of r90a mutant of thymidylate kinase (aq_969) from aquifex aeolicus vf5 0.8945 16 215
ID Description Score Start End Superfamily
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9066 16 220 3.40.50.300
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8935 16 220 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.883 14 217 3.40.50.300
2cckB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8775 15 219 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8621 14 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A433B7M8-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9255 13 221 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A833G907-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.922 13 220 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A562CPA4-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9203 13 220 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A1Q4DQL8-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9174 13 220 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2A5GDW0-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9165 13 220 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map