F399302

General Info

Members Datasets Scaffolds Average Seq Length
307 213 283 299

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0004907|Ga0439462_0004907_586_1599
Length 337
Sequence VGRAATAGHPLASGLVVASHGRHLLVESPEGPDGRRLICHPRGKKNDAVVGDRVRWLPTGDEGSIEAIEPRRNLFYRQDELRSKSFAANIDQVLILIAAEPEFSESQLARALIAAEAAGIAPLIALNKSDLSAAHARAWTRLAAYRRMGYTVLPLNLKNGPTQDSVLALRQHLQGRATLVLGPSGAGKSTLINLFAPDAQAQTGEISSALNSGKHTTTHTRWYWVDLQAGAATPRTALIDSPGFQEFGLHHIEVAQLASLMPDLRAHAGTCRFYNCTHLHEPGCAVIAAVEASEPATGSQTGAGNPTDHARPDPPVTSSRYRIYRELHAELSMPPRY

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2547132512 Azospira oryzae 6a3 Isolate Unclassified
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221717 Acidovorax sp. Root267 Isolate Unclassified
14 2721755523 Delftia sp. HK171 Isolate Unclassified
15 2738543012 Acidovorax sp. CF301 Isolate Unclassified
16 2816332133 Acidovorax radicis 2721A Isolate Unclassified
17 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
18 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
19 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
20 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
21 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
22 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
23 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
24 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
27 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
166 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.18
Metatranscriptomes 0
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.41
Nodule 0
Rhizoplane 0.98
Rhizosphere 59.61
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001708 3300001979 Bacteria 10083
2 JGI25155J39150_1000005 3300002704 Bacteria 261712
3 JGI25156J39149_1000006 3300002705 Bacteria 261778
4 JGI25154J39366_1000015 3300002738 Bacteria 261778
5 JGI25157J39369_1000111 3300002741 Bacteria 69508
6 JGI25150J39212_1001950 3300002774 Bacteria 5413
7 JGI25150J39212_1002104 3300002774 Bacteria 5152
8 JGI25159J45721_1000135 3300002987 Bacteria 34873
9 JGI25159J45721_1001885 3300002987 Bacteria 8382
10 JGI25151J46595_10003864 3300003187 Bacteria 8097
11 JGI25151J46595_10026625 3300003187 Bacteria 2330
12 rootL2_10003045 3300003322 Bacteria 14122
13 JGI25160J50197_1000045 3300003354 Bacteria 142992
14 JGI25161J50226_1000008 3300003374 Bacteria 239245
15 Ga0055526_1012404 3300003771 Bacteria 3722
16 Ga0055526_1012696 3300003771 Bacteria 3644
17 Ga0055537_1000182 3300003773 Bacteria 46822
18 Ga0055524_1000107 3300003775 Bacteria 100962
19 Ga0055524_1000126 3300003775 Bacteria 89985
20 Ga0055536_1004968 3300003781 Bacteria 6615
21 Ga0055534_1001254 3300003784 Bacteria 10451
22 Ga0055528_1000606 3300003790 Bacteria 26938
23 Ga0055530_10000302 3300003791 Bacteria 44821
24 Ga0055530_10000490 3300003791 Bacteria 34448
25 Ga0055540_1000021 3300003792 Bacteria 208733
26 Ga0055531_10000192 3300003794 Bacteria 67874
27 Ga0055531_10001001 3300003794 Bacteria 22450
28 Ga0055543_1000318 3300004625 Bacteria 33336
29 Ga0065165_1008387 3300005262 Bacteria 4848
30 Ga0065165_1023662 3300005262 Bacteria 2078
31 Ga0065165_1023663 3300005262 Bacteria 2078
32 Ga0070676_10215649 3300005328 Bacteria 1265
33 Ga0068869_100015545 3300005334 Bacteria 5109
34 Ga0070659_100100556 3300005366 Bacteria 2327
35 Ga0070667_100068800 3300005367 Bacteria 3013
36 Ga0070700_100026714 3300005441 Bacteria 3414
37 Ga0070700_100290020 3300005441 Unclassified 1190
38 Ga0070663_100002204 3300005455 Bacteria 10897
39 Ga0070662_100015503 3300005457 Bacteria 5107
40 Ga0070681_10008962 3300005458 Bacteria 9839
41 Ga0068867_100054017 3300005459 Bacteria 2967
42 Ga0068867_100157011 3300005459 Bacteria 1791
43 Ga0070679_100031482 3300005530 Bacteria 5241
44 Ga0068853_100369135 3300005539 Bacteria 1338
45 Ga0070665_100033280 3300005548 Bacteria 5187
46 Ga0070704_100132164 3300005549 Bacteria 1936
47 Ga0068855_100173483 3300005563 Bacteria 2441
48 Ga0070664_100027643 3300005564 Bacteria 4714
49 Ga0068857_100004780 3300005577 Bacteria 11473
50 Ga0068854_100008521 3300005578 Bacteria 6597
51 Ga0068856_100019270 3300005614 Bacteria 6623
52 Ga0068856_100149118 3300005614 Bacteria 2347
53 Ga0068858_100043018 3300005842 Bacteria 4189
54 Ga0068858_100101791 3300005842 Bacteria 2679
55 Ga0068862_100029477 3300005844 Bacteria 4624
56 Ga0075363_100029362 3300006048 Bacteria 2838
57 Ga0075432_10033074 3300006058 Bacteria 1792
58 Ga0075362_10024286 3300006177 Bacteria 2570
59 Ga0075362_10045703 3300006177 Bacteria 1945
60 Ga0075367_10061222 3300006178 Bacteria 2246
61 Ga0075366_10045562 3300006195 Bacteria 2599
62 Ga0075366_10132460 3300006195 Bacteria 1504
63 Ga0097621_100005867 3300006237 Bacteria 8677
64 Ga0075370_10002144 3300006353 Bacteria 9020
65 Ga0068871_100019653 3300006358 Bacteria 5160
66 Ga0068871_100384883 3300006358 Bacteria 1247
67 Ga0075431_100136272 3300006847 Bacteria 2531
68 Ga0075431_100191219 3300006847 Bacteria 2097
69 Ga0068865_100183927 3300006881 Bacteria 1611
70 Ga0105243_10312730 3300009148 Bacteria 1428
71 Ga0105243_10370442 3300009148 Bacteria 1321
72 Ga0105241_10004042 3300009174 Bacteria 10859
73 Ga0105241_10092763 3300009174 Bacteria 2385
74 Ga0105242_10001629 3300009176 Bacteria 17706
75 Ga0105248_10033181 3300009177 Bacteria 5767
76 Ga0105237_10020797 3300009545 Bacteria 6759
77 Ga0105237_10186992 3300009545 Bacteria 2071
78 Ga0105238_10051939 3300009551 Bacteria 4122
79 Ga0105239_10065333 3300010375 Bacteria 3995
80 Ga0105239_10111318 3300010375 Bacteria 3035
81 Ga0105239_10226339 3300010375 Bacteria 2098
82 Ga0105246_10276034 3300011119 Unclassified 1346
83 Ga0157374_10038464 3300013296 Bacteria 4398
84 Ga0157378_10106355 3300013297 Bacteria 2566
85 Ga0157375_10045918 3300013308 Bacteria 4254
86 Ga0157375_10066616 3300013308 Bacteria 3596
87 Ga0163163_10237872 3300014325 Bacteria 1870
88 Ga0163163_10294570 3300014325 Bacteria 1675
89 Ga0182008_10000207 3300014497 Bacteria 46359
90 Ga0157379_10165776 3300014968 Bacteria 1994
91 Ga0157376_10015342 3300014969 Bacteria 5786
92 Ga0183362_10001 3300015683 Bacteria 2046624
93 Ga0213872_10000114 3300021361 Bacteria 74773
94 Ga0213872_10001692 3300021361 Bacteria 13879
95 Ga0213872_10004245 3300021361 Bacteria 7681
96 Ga0213872_10015112 3300021361 Bacteria 3590
97 Ga0209435_100010 3300025206 Bacteria 475373
98 Ga0207425_1002648 3300025245 Bacteria 6175
99 Ga0209646_1000001 3300025246 Bacteria 3092932
100 Ga0209026_1000001 3300025250 Bacteria 1228671
101 Ga0209759_1000001 3300025256 Bacteria 2799452
102 Ga0209565_1000028 3300025263 Bacteria 348536
103 Ga0209565_1000433 3300025263 Bacteria 33703
104 Ga0209673_1000035 3300025273 Bacteria 328411
105 Ga0209673_1014451 3300025273 Bacteria 3053
106 Ga0209130_1000112 3300025284 Bacteria 131607
107 Ga0209130_1000186 3300025284 Bacteria 87096
108 Ga0209675_1000153 3300025291 Bacteria 90298
109 Ga0209675_1008419 3300025291 Bacteria 3790
110 Ga0209676_1000069 3300025292 Bacteria 312462
111 Ga0209676_1006872 3300025292 Bacteria 5506
112 Ga0209025_1001921 3300025294 Bacteria 24097
113 Ga0209025_1004787 3300025294 Bacteria 11478
114 Ga0209025_1021665 3300025294 Bacteria 3450
115 Ga0209025_1036681 3300025294 Bacteria 2190
116 Ga0209564_1000583 3300025295 Bacteria 57799
117 Ga0209564_1002659 3300025295 Bacteria 13606
118 Ga0209564_1008103 3300025295 Bacteria 5258
119 Ga0209758_1002912 3300025297 Bacteria 16512
120 Ga0209050_1000023 3300025298 Bacteria 537172
121 Ga0209050_1004606 3300025298 Bacteria 9215
122 Ga0209050_1016246 3300025298 Bacteria 3060
123 Ga0209256_1000003 3300025299 Bacteria 1661127
124 Ga0207426_1000153 3300025302 Bacteria 182839
125 Ga0207426_1002916 3300025302 Bacteria 10082
126 Ga0209051_1000017 3300025303 Bacteria 537172
127 Ga0209051_1000317 3300025303 Bacteria 73057
128 Ga0209257_1000039 3300025304 Bacteria 591694
129 Ga0209257_1000041 3300025304 Bacteria 537172
130 Ga0207656_10015773 3300025321 Bacteria 2930
131 Ga0207645_10010381 3300025907 Bacteria 6392
132 Ga0207643_10156684 3300025908 Unclassified 1368
133 Ga0207707_10004059 3300025912 Bacteria 12972
134 Ga0207671_10030303 3300025914 Bacteria 4035
135 Ga0207649_10122303 3300025920 Bacteria 1756
136 Ga0207659_10016028 3300025926 Bacteria 4870
137 Ga0207644_10018554 3300025931 Bacteria 4709
138 Ga0207704_10082385 3300025938 Bacteria 2084
139 Ga0207691_10020447 3300025940 Bacteria 6257
140 Ga0207711_10011873 3300025941 Bacteria 7240
141 Ga0207689_10002155 3300025942 Bacteria 18523
142 Ga0207689_10008289 3300025942 Bacteria 9057
143 Ga0207651_10088657 3300025960 Bacteria 2256
144 Ga0207658_10076525 3300025986 Bacteria 2550
145 Ga0207658_10081464 3300025986 Bacteria 2482
146 Ga0207703_10029243 3300026035 Bacteria 4346
147 Ga0207702_10117862 3300026078 Bacteria 2371
148 Ga0207641_10464779 3300026088 Unclassified 1224
149 Ga0207648_10009359 3300026089 Bacteria 9387
150 Ga0207648_10044399 3300026089 Bacteria 3899
151 Ga0207674_10008485 3300026116 Bacteria 11865
152 Ga0207683_10131090 3300026121 Unclassified 2255
153 Ga0209973_1009732 3300027252 Bacteria 1124
154 Ga0209970_1001339 3300027614 Bacteria 4310
155 Ga0209971_1009120 3300027682 Bacteria 2353
156 Ga0209974_10000874 3300027876 Bacteria 10431
157 Ga0209974_10003264 3300027876 Bacteria 5865
158 Ga0209974_10076487 3300027876 Bacteria 1147
159 Ga0268266_10017475 3300028379 Bacteria 6118
160 Ga0268264_10169475 3300028381 Bacteria 1973
161 Ga0265323_10008234 3300028653 Bacteria 4309
162 Ga0265336_10001259 3300028666 Bacteria 11998
163 Ga0307515_10000650 3300028794 Bacteria 80300
164 Ga0307515_10001727 3300028794 Bacteria 48647
165 Ga0307515_10030061 3300028794 Bacteria 9147
166 Ga0307515_10041599 3300028794 Bacteria 7217
167 Ga0307515_10064529 3300028794 Bacteria 5118
168 Ga0307515_10316735 3300028794 Bacteria 1230
169 Ga0265324_10000006 3300029957 Bacteria 267048
170 Ga0265324_10000753 3300029957 Bacteria 21463
171 Ga0265324_10016285 3300029957 Bacteria 2718
172 Ga0265332_10000009 3300031238 Bacteria 295760
173 Ga0265332_10000013 3300031238 Bacteria 250095
174 Ga0265331_10003248 3300031250 Bacteria 10594
175 Ga0265331_10011512 3300031250 Bacteria 4841
176 Ga0265327_10002575 3300031251 Bacteria 18772
177 Ga0265327_10005523 3300031251 Bacteria 10511
178 Ga0265316_10014574 3300031344 Bacteria 6913
179 Ga0265316_10025294 3300031344 Bacteria 4956
180 Ga0265316_10287626 3300031344 Bacteria 1200
181 Ga0265316_10304533 3300031344 Bacteria 1160
182 Ga0265316_10394693 3300031344 Bacteria 997
183 Ga0307513_10000004 3300031456 Bacteria 558931
184 Ga0307513_10000015 3300031456 Bacteria 296183
185 Ga0307513_10031813 3300031456 Bacteria 5966
186 Ga0307513_10031881 3300031456 Bacteria 5957
187 Ga0307509_10079394 3300031507 Bacteria 3397
188 Ga0307408_100000186 3300031548 Bacteria 68520
189 Ga0307508_10000007 3300031616 Bacteria 268359
190 Ga0307508_10032898 3300031616 Bacteria 4682
191 Ga0307514_10002799 3300031649 Bacteria 17514
192 Ga0307514_10007132 3300031649 Bacteria 9647
193 Ga0316575_10000027 3300031665 Bacteria 35516
194 Ga0265314_10000397 3300031711 Bacteria 59137
195 Ga0265314_10061258 3300031711 Bacteria 2563
196 Ga0307516_10009209 3300031730 Bacteria 11050
197 Ga0307516_10014861 3300031730 Bacteria 8218
198 Ga0307406_10002742 3300031901 Bacteria 9611
199 Ga0373931_0042169 3300035691 Bacteria 2399
200 Ga0373937_0027185 3300036401 Bacteria 5172
201 Ga0373925_0173158 3300037068 Bacteria 1705
202 Ga0395899_0007462 3300037312 Bacteria 8449
203 Ga0395898_0195450 3300037466 Bacteria 1932
204 Ga0395901_0053168 3300038443 Bacteria 4208
205 Ga0436361_0215157 3300039447 Bacteria 166868
206 Ga0436361_0436655 3300039447 Bacteria 19070
207 Ga0436361_0588251 3300039447 Bacteria 1915
208 Ga0436361_0610098 3300039447 Bacteria 9675
209 Ga0436361_0632651 3300039447 Bacteria 49929
210 Ga0436361_0971261 3300039447 Bacteria 2262
211 Ga0436361_1043948 3300039447 Bacteria 4310
212 Ga0439436_0057432 3300041404 Bacteria 1092
213 Ga0439453_0012463 3300041408 Bacteria 1432
214 Ga0451791_1537883 3300041451 Bacteria 1648
215 Ga0451793_1806592 3300041452 Bacteria 2165
216 Ga0451795_0797898 3300041456 Bacteria 1727
217 Ga0451833_0442280 3300041491 Bacteria 1063
218 Ga0439462_0004907 3300042015 Bacteria 3283
219 Ga0450919_002650 3300042121 Bacteria 2311
220 Ga0439446_0015610 3300042156 Bacteria 2108
221 Ga0439464_0003813 3300042439 Bacteria 3831
222 Ga0450918_000104 3300042531 Bacteria 18155
223 Ga0451577_0000080 3300042876 Bacteria 218034
224 Ga0451577_0001963 3300042876 Bacteria 25875
225 Ga0451577_0037839 3300042876 Bacteria 4342
226 Ga0451577_0040604 3300042876 Bacteria 4178
227 Ga0466969_0057891 3300044656 Bacteria 1888
228 Ga0453683_0000049 3300044673 Bacteria 206697
229 Ga0453683_0149586 3300044673 Bacteria 1475
230 Ga0466965_0010229 3300044683 Bacteria 4370
231 Ga0466966_0084564 3300044684 Bacteria 1973
232 Ga0466966_0187531 3300044684 Bacteria 1254
233 Ga0466961_0000461 3300044693 Bacteria 25685
234 Ga0453684_0000237 3300044712 Bacteria 236999
235 Ga0453684_0000286 3300044712 Bacteria 218034
236 Ga0453684_0030539 3300044712 Bacteria 7610
237 Ga0453684_0036557 3300044712 Bacteria 6767
238 Ga0453684_0190658 3300044712 Bacteria 2398
239 Ga0453684_0375641 3300044712 Bacteria 1597
240 Ga0466959_0013399 3300045049 Bacteria 5943
241 Ga0451576_0000013 3300045051 Bacteria 665120
242 Ga0451576_0000102 3300045051 Bacteria 218034
243 Ga0451576_0003674 3300045051 Bacteria 20819
244 Ga0451576_0185290 3300045051 Bacteria 2174
245 Ga0451576_0563096 3300045051 Bacteria 1197
246 Ga0495610_0012778 3300046512 Bacteria 5025
247 Ga0495632_0016953 3300046519 Bacteria 4036
248 Ga0495652_0163711 3300046529 Bacteria 1724
249 Ga0495654_0002766 3300046530 Bacteria 11055
250 Ga0495597_0000505 3300046542 Bacteria 32423
251 Ga0495625_0016606 3300046660 Bacteria 5785
252 Ga0495658_0078370 3300046683 Bacteria 1934
253 Ga0495686_0020831 3300047472 Bacteria 4369
254 Ga0495686_0105451 3300047472 Bacteria 1696
255 Ga0496123_0117909 3300048926 Bacteria 1500
256 Ga0501031_0006785 3300049568 Bacteria 7470
257 Ga0501034_0153919 3300049571 Bacteria 2274
258 Ga0501037_0097820 3300049573 Bacteria 2120
259 Ga0501046_0026850 3300049580 Bacteria 4703
260 Ga0501047_0150124 3300049581 Bacteria 2207
261 Ga0501068_0001829 3300049584 Bacteria 11295
262 Ga0501074_0036860 3300049590 Bacteria 3543
263 Ga0501080_0052223 3300049742 Bacteria 3804
264 Ga0501080_0086066 3300049742 Bacteria 2920
265 Ga0501035_0440356 3300049822 Bacteria 1079
266 Ga0501044_0197647 3300049823 Bacteria 1970
267 nmdc:mga00v17_152148_c1 3300050491 Bacteria 1487
268 nmdc:mga0k408_14455_c1 3300050493 Bacteria 4350
269 nmdc:mga0k408_166144_c1 3300050493 Bacteria 1315
270 nmdc:mga0k408_683_c1 3300050493 Bacteria 11515
271 nmdc:mga06z11_44312_c1 3300050494 Bacteria 2243
272 nmdc:mga07m45_36124_c1 3300050496 Bacteria 2750
273 nmdc:mga07m45_3744_c1 3300050496 Bacteria 7362
274 Ga0500644_0014472 3300053088 Bacteria 2228
275 Ga0500644_0036302 3300053088 Bacteria 1603
276 Ga0500651_0031169 3300053093 Bacteria 3358
277 Ga0500566_0037777 3300053094 Bacteria 2797
278 Ga0500562_002177 3300053108 Bacteria 4898
279 Ga0500593_000742 3300053117 Bacteria 12287
280 Ga0500658_0012210 3300053134 Bacteria 3165
281 Ga0500559_0056790 3300053136 Bacteria 1738
282 Ga0500645_000855 3300053730 Bacteria 17844
283 Ga0500661_001583 3300055283 Bacteria 4294

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100015545 Ga0068869_1000155453 232
2 3300005441 Ga0070700_100290020 Ga0070700_1002900202 232
3 3300005548 Ga0070665_100033280 Ga0070665_1000332804 232
4 3300005844 Ga0068862_100029477 Ga0068862_1000294774 232
5 3300006358 Ga0068871_100019653 Ga0068871_1000196533 232
6 3300021361 Ga0213872_10000114 Ga0213872_1000011477 232
7 3300025908 Ga0207643_10156684 Ga0207643_101566841 232
8 3300025986 Ga0207658_10076525 Ga0207658_100765252 232
9 3300026089 Ga0207648_10044399 Ga0207648_100443993 232
10 3300039447 Ga0436361_0215157 Ga0436361_0215157_101819_102688 232
11 3300025941 Ga0207711_10011873 Ga0207711_100118735 239
12 3300028379 Ga0268266_10017475 Ga0268266_100174752 239
13 3300044656 Ga0466969_0057891 Ga0466969_0057891_933_1799 239
14 3300044683 Ga0466965_0010229 Ga0466965_0010229_549_1415 239
15 3300044684 Ga0466966_0084564 Ga0466966_0084564_996_1862 239
16 3300044693 Ga0466961_0000461 Ga0466961_0000461_16768_17634 239
17 3300005459 Ga0068867_100157011 Ga0068867_1001570112 240
18 3300005842 Ga0068858_100101791 Ga0068858_1001017912 240
19 3300006237 Ga0097621_100005867 Ga0097621_1000058679 240
20 3300006881 Ga0068865_100183927 Ga0068865_1001839272 240
21 3300025942 Ga0207689_10002155 Ga0207689_100021554 240
22 3300025960 Ga0207651_10088657 Ga0207651_100886572 240
23 3300026088 Ga0207641_10464779 Ga0207641_104647792 240
24 3300026121 Ga0207683_10131090 Ga0207683_101310901 240
25 3300028381 Ga0268264_10169475 Ga0268264_101694752 240
26 3300042121 Ga0450919_002650 Ga0450919_002650_1522_2301 243
27 3300031250 Ga0265331_10011512 Ga0265331_100115126 248
28 3300031251 Ga0265327_10002575 Ga0265327_1000257514 248
29 3300045049 Ga0466959_0013399 Ga0466959_0013399_3399_4265 254
30 3300044673 Ga0453683_0149586 Ga0453683_0149586_43_993 260
31 3300049568 Ga0501031_0006785 Ga0501031_0006785_1487_2428 261
32 3300028794 Ga0307515_10316735 Ga0307515_103167352 262
33 3300035691 Ga0373931_0042169 Ga0373931_0042169_493_1362 262
34 3300044712 Ga0453684_0000237 Ga0453684_0000237_107096_107950 264
35 3300028794 Ga0307515_10064529 Ga0307515_100645295 265
36 3300053108 Ga0500562_002177 Ga0500562_002177_2007_2897 265
37 3300028666 Ga0265336_10001259 Ga0265336_100012592 266
38 3300029957 Ga0265324_10000006 Ga0265324_10000006168 266
39 3300037068 Ga0373925_0173158 Ga0373925_0173158_649_1503 266
40 3300042876 Ga0451577_0000080 Ga0451577_0000080_90483_91334 266
41 3300044673 Ga0453683_0000049 Ga0453683_0000049_90483_91334 266
42 3300044712 Ga0453684_0000286 Ga0453684_0000286_126701_127552 266
43 3300045051 Ga0451576_0000102 Ga0451576_0000102_90483_91334 266
44 iso_pu_bacteria 2846037992 2846041046 266
45 iso_pu_bacteria 2998344455 2998347314 267
46 3300031344 Ga0265316_10014574 Ga0265316_100145745 268
47 3300031344 Ga0265316_10304533 Ga0265316_103045332 268
48 3300031344 Ga0265316_10394693 Ga0265316_103946932 268
49 3300042876 Ga0451577_0037839 Ga0451577_0037839_619_1479 268
50 3300044712 Ga0453684_0030539 Ga0453684_0030539_83_943 268
51 3300021361 Ga0213872_10004245 Ga0213872_100042454 269
52 3300029957 Ga0265324_10000753 Ga0265324_100007536 269
53 3300031344 Ga0265316_10287626 Ga0265316_102876262 269
54 3300031711 Ga0265314_10000397 Ga0265314_1000039711 269
55 3300031711 Ga0265314_10061258 Ga0265314_100612582 269
56 3300039447 Ga0436361_0436655 Ga0436361_0436655_5387_6256 269
57 iso_pu_bacteria 2547132103 2547373842 269
58 iso_pu_bacteria 2843690924 2843693424 269
59 iso_pu_bacteria 2846033681 2846036674 269
60 3300031250 Ga0265331_10003248 Ga0265331_100032486 270
61 3300031251 Ga0265327_10005523 Ga0265327_1000552311 270
62 3300031344 Ga0265316_10025294 Ga0265316_100252943 270
63 3300039447 Ga0436361_0588251 Ga0436361_0588251_344_1210 270
64 3300045051 Ga0451576_0000013 Ga0451576_0000013_451680_452570 270
65 3300045051 Ga0451576_0563096 Ga0451576_0563096_34_900 270
66 iso_pu_bacteria 2526164512 2526213084 270
67 3300005563 Ga0068855_100173483 Ga0068855_1001734832 271
68 3300005614 Ga0068856_100149118 Ga0068856_1001491181 271
69 3300005842 Ga0068858_100043018 Ga0068858_1000430182 271
70 3300014325 Ga0163163_10294570 Ga0163163_102945702 271
71 3300014968 Ga0157379_10165776 Ga0157379_101657762 271
72 3300021361 Ga0213872_10001692 Ga0213872_1000169216 271
73 3300026035 Ga0207703_10029243 Ga0207703_100292434 271
74 3300028794 Ga0307515_10000650 Ga0307515_1000065063 271
75 3300031456 Ga0307513_10031813 Ga0307513_100318134 271
76 3300031616 Ga0307508_10032898 Ga0307508_100328985 271
77 3300031649 Ga0307514_10002799 Ga0307514_1000279910 271
78 3300039447 Ga0436361_0632651 Ga0436361_0632651_425_1306 271
79 3300039447 Ga0436361_0971261 Ga0436361_0971261_1201_2082 271
80 3300049580 Ga0501046_0026850 Ga0501046_0026850_1014_1916 271
81 3300049742 Ga0501080_0086066 Ga0501080_0086066_1541_2443 271
82 3300049822 Ga0501035_0440356 Ga0501035_0440356_95_997 271
83 iso_pu_bacteria 2547132512 2548848096 271
84 3300003187 JGI25151J46595_10026625 JGI25151J46595_100266253 272
85 3300003322 rootL2_10003045 rootL2_100030456 272
86 3300025250 Ga0209026_1000001 Ga0209026_1000001605 272
87 3300025292 Ga0209676_1006872 Ga0209676_10068724 272
88 3300025294 Ga0209025_1001921 Ga0209025_100192110 272
89 3300025295 Ga0209564_1008103 Ga0209564_10081032 272
90 3300025298 Ga0209050_1016246 Ga0209050_10162462 272
91 3300029957 Ga0265324_10016285 Ga0265324_100162852 273
92 3300044712 Ga0453684_0036557 Ga0453684_0036557_4434_5309 273
93 3300050491 nmdc:mga00v17_152148_c1 nmdc:mga00v17_152148_c1_501_1427 273
94 3300003794 Ga0055531_10000192 Ga0055531_1000019217 274
95 3300005539 Ga0068853_100369135 Ga0068853_1003691351 274
96 3300005549 Ga0070704_100132164 Ga0070704_1001321643 274
97 3300005578 Ga0068854_100008521 Ga0068854_1000085215 274
98 3300005614 Ga0068856_100019270 Ga0068856_1000192703 274
99 3300009551 Ga0105238_10051939 Ga0105238_100519393 274
100 3300015683 Ga0183362_10001 Ga0183362_10001153 274
101 3300021361 Ga0213872_10015112 Ga0213872_100151124 274
102 3300025303 Ga0209051_1000317 Ga0209051_100031738 274
103 3300025304 Ga0209257_1000039 Ga0209257_100003945 274
104 3300025321 Ga0207656_10015773 Ga0207656_100157732 274
105 3300025920 Ga0207649_10122303 Ga0207649_101223031 274
106 3300026078 Ga0207702_10117862 Ga0207702_101178622 274
107 3300031238 Ga0265332_10000013 Ga0265332_10000013180 274
108 3300031665 Ga0316575_10000027 Ga0316575_1000002732 274
109 3300038443 Ga0395901_0053168 Ga0395901_0053168_1081_2001 274
110 3300039447 Ga0436361_0610098 Ga0436361_0610098_3089_3973 274
111 3300039447 Ga0436361_1043948 Ga0436361_1043948_521_1405 274
112 3300044712 Ga0453684_0375641 Ga0453684_0375641_317_1198 274
113 3300048926 Ga0496123_0117909 Ga0496123_0117909_314_1273 274
114 3300053093 Ga0500651_0031169 Ga0500651_0031169_1169_2080 274
115 3300025273 Ga0209673_1014451 Ga0209673_10144513 275
116 3300037312 Ga0395899_0007462 Ga0395899_0007462_3537_4457 275
117 3300037466 Ga0395898_0195450 Ga0395898_0195450_976_1896 275
118 3300041404 Ga0439436_0057432 Ga0439436_0057432_122_1048 275
119 3300041408 Ga0439453_0012463 Ga0439453_0012463_413_1339 275
120 3300042156 Ga0439446_0015610 Ga0439446_0015610_613_1539 275
121 3300042439 Ga0439464_0003813 Ga0439464_0003813_250_1176 275
122 3300006847 Ga0075431_100136272 Ga0075431_1001362722 276
123 3300006847 Ga0075431_100191219 Ga0075431_1001912192 276
124 3300025294 Ga0209025_1021665 Ga0209025_10216652 276
125 3300028653 Ga0265323_10008234 Ga0265323_100082342 276
126 3300042876 Ga0451577_0001963 Ga0451577_0001963_23671_24558 276
127 3300042876 Ga0451577_0040604 Ga0451577_0040604_1242_2129 276
128 3300044684 Ga0466966_0187531 Ga0466966_0187531_289_1218 276
129 3300044712 Ga0453684_0190658 Ga0453684_0190658_1441_2328 276
130 3300045051 Ga0451576_0003674 Ga0451576_0003674_13578_14465 276
131 3300049581 Ga0501047_0150124 Ga0501047_0150124_673_1587 276
132 3300031456 Ga0307513_10000004 Ga0307513_10000004237 277
133 iso_pu_bacteria 2511231002 2511243933 277
134 3300005366 Ga0070659_100100556 Ga0070659_1001005562 278
135 3300005441 Ga0070700_100026714 Ga0070700_1000267144 278
136 3300005458 Ga0070681_10008962 Ga0070681_100089622 278
137 3300005530 Ga0070679_100031482 Ga0070679_1000314822 278
138 3300005577 Ga0068857_100004780 Ga0068857_1000047807 278
139 3300006195 Ga0075366_10045562 Ga0075366_100455622 278
140 3300009174 Ga0105241_10004042 Ga0105241_100040423 278
141 3300009174 Ga0105241_10092763 Ga0105241_100927632 278
142 3300009177 Ga0105248_10033181 Ga0105248_100331812 278
143 3300009545 Ga0105237_10020797 Ga0105237_100207973 278
144 3300010375 Ga0105239_10111318 Ga0105239_101113182 278
145 3300010375 Ga0105239_10226339 Ga0105239_102263393 278
146 3300011119 Ga0105246_10276034 Ga0105246_102760342 278
147 3300013297 Ga0157378_10106355 Ga0157378_101063554 278
148 3300013308 Ga0157375_10066616 Ga0157375_100666163 278
149 3300014325 Ga0163163_10237872 Ga0163163_102378722 278
150 3300014969 Ga0157376_10015342 Ga0157376_100153423 278
151 3300025912 Ga0207707_10004059 Ga0207707_100040596 278
152 3300025914 Ga0207671_10030303 Ga0207671_100303033 278
153 3300026116 Ga0207674_10008485 Ga0207674_100084857 278
154 3300027614 Ga0209970_1001339 Ga0209970_10013393 278
155 3300027876 Ga0209974_10076487 Ga0209974_100764872 278
156 3300049571 Ga0501034_0153919 Ga0501034_0153919_792_1691 278
157 3300049584 Ga0501068_0001829 Ga0501068_0001829_4177_5076 278
158 3300049590 Ga0501074_0036860 Ga0501074_0036860_1135_2034 278
159 3300049742 Ga0501080_0052223 Ga0501080_0052223_2030_2929 278
160 3300050493 nmdc:mga0k408_683_c1 nmdc:mga0k408_683_c1_6863_7786 278
161 iso_pu_bacteria 2547132374 2548499829 279
162 iso_pu_bacteria 2643221570 2643868068 279
163 iso_pu_bacteria 2643221596 2643993927 279
164 iso_pu_bacteria 2643221609 2644059630 279
165 iso_pu_bacteria 2643221611 2644074771 279
166 iso_pu_bacteria 2643221652 2644293679 279
167 iso_pu_bacteria 2643221717 2644644844 279
168 iso_pu_bacteria 2738543012 2739241162 279
169 iso_pu_bacteria 2816332133 2816473325 279
170 iso_pu_bacteria 2990710928 2990713573 279
171 3300002704 JGI25155J39150_1000005 JGI25155J39150_1000005181 280
172 3300002705 JGI25156J39149_1000006 JGI25156J39149_1000006181 280
173 3300002738 JGI25154J39366_1000015 JGI25154J39366_100001565 280
174 3300002741 JGI25157J39369_1000111 JGI25157J39369_10001112 280
175 3300002774 JGI25150J39212_1002104 JGI25150J39212_10021042 280
176 3300002987 JGI25159J45721_1001885 JGI25159J45721_10018859 280
177 3300003187 JGI25151J46595_10003864 JGI25151J46595_1000386410 280
178 3300003771 Ga0055526_1012404 Ga0055526_10124043 280
179 3300003771 Ga0055526_1012696 Ga0055526_10126963 280
180 3300003773 Ga0055537_1000182 Ga0055537_100018218 280
181 3300003775 Ga0055524_1000107 Ga0055524_100010714 280
182 3300003775 Ga0055524_1000126 Ga0055524_10001263 280
183 3300003781 Ga0055536_1004968 Ga0055536_10049682 280
184 3300003784 Ga0055534_1001254 Ga0055534_10012549 280
185 3300003790 Ga0055528_1000606 Ga0055528_100060617 280
186 3300003791 Ga0055530_10000302 Ga0055530_1000030229 280
187 3300003791 Ga0055530_10000490 Ga0055530_1000049010 280
188 3300003792 Ga0055540_1000021 Ga0055540_1000021116 280
189 3300003794 Ga0055531_10001001 Ga0055531_1000100119 280
190 3300005262 Ga0065165_1008387 Ga0065165_10083873 280
191 3300025206 Ga0209435_100010 Ga0209435_100010192 280
192 3300025245 Ga0207425_1002648 Ga0207425_10026485 280
193 3300025246 Ga0209646_1000001 Ga0209646_10000011950 280
194 3300025256 Ga0209759_1000001 Ga0209759_10000011581 280
195 3300025263 Ga0209565_1000028 Ga0209565_1000028279 280
196 3300025273 Ga0209673_1000035 Ga0209673_100003556 280
197 3300025284 Ga0209130_1000112 Ga0209130_100011250 280
198 3300025291 Ga0209675_1000153 Ga0209675_100015365 280
199 3300025292 Ga0209676_1000069 Ga0209676_1000069181 280
200 3300025294 Ga0209025_1036681 Ga0209025_10366812 280
201 3300025295 Ga0209564_1000583 Ga0209564_10005833 280
202 3300025295 Ga0209564_1002659 Ga0209564_100265916 280
203 3300025298 Ga0209050_1000023 Ga0209050_1000023356 280
204 3300025299 Ga0209256_1000003 Ga0209256_10000031073 280
205 3300025302 Ga0207426_1002916 Ga0207426_100291610 280
206 3300025303 Ga0209051_1000017 Ga0209051_1000017356 280
207 3300025304 Ga0209257_1000041 Ga0209257_1000041356 280
208 3300053088 Ga0500644_0036302 Ga0500644_0036302_295_1245 280
209 3300053094 Ga0500566_0037777 Ga0500566_0037777_123_1073 280
210 3300053117 Ga0500593_000742 Ga0500593_000742_7418_8368 280
211 3300055283 Ga0500661_001583 Ga0500661_001583_3319_4269 280
212 3300045051 Ga0451576_0185290 Ga0451576_0185290_977_1906 281
213 3300046529 Ga0495652_0163711 Ga0495652_0163711_241_1170 281
214 iso_pu_bacteria 2585428062 2587755443 281
215 iso_pu_bacteria 2643221644 2644248743 281
216 iso_pu_bacteria 2721755523 2722882129 281
217 iso_pu_bacteria 2839138175 2839142643 281
218 iso_pu_bacteria 2842718218 2842721462 281
219 3300005367 Ga0070667_100068800 Ga0070667_1000688003 282
220 3300005459 Ga0068867_100054017 Ga0068867_1000540173 282
221 3300006358 Ga0068871_100384883 Ga0068871_1003848832 282
222 3300009148 Ga0105243_10312730 Ga0105243_103127302 282
223 3300009545 Ga0105237_10186992 Ga0105237_101869921 282
224 3300013308 Ga0157375_10045918 Ga0157375_100459183 282
225 3300014497 Ga0182008_10000207 Ga0182008_100002072 282
226 3300025926 Ga0207659_10016028 Ga0207659_100160283 282
227 3300025931 Ga0207644_10018554 Ga0207644_100185543 282
228 3300025938 Ga0207704_10082385 Ga0207704_100823853 282
229 3300025940 Ga0207691_10020447 Ga0207691_100204477 282
230 3300025942 Ga0207689_10008289 Ga0207689_100082895 282
231 3300025986 Ga0207658_10081464 Ga0207658_100814643 282
232 3300026089 Ga0207648_10009359 Ga0207648_1000935910 282
233 3300027252 Ga0209973_1009732 Ga0209973_10097321 282
234 3300027876 Ga0209974_10003264 Ga0209974_100032642 282
235 3300031548 Ga0307408_100000186 Ga0307408_10000018614 282
236 3300031901 Ga0307406_10002742 Ga0307406_1000274210 282
237 3300046530 Ga0495654_0002766 Ga0495654_0002766_1489_2430 282
238 3300047472 Ga0495686_0020831 Ga0495686_0020831_811_1725 282
239 3300050496 nmdc:mga07m45_36124_c1 nmdc:mga07m45_36124_c1_1737_2639 282
240 3300053136 Ga0500559_0056790 Ga0500559_0056790_87_1019 282
241 3300002774 JGI25150J39212_1001950 JGI25150J39212_10019505 283
242 3300002987 JGI25159J45721_1000135 JGI25159J45721_100013529 283
243 3300003354 JGI25160J50197_1000045 JGI25160J50197_100004560 283
244 3300003374 JGI25161J50226_1000008 JGI25161J50226_1000008160 283
245 3300004625 Ga0055543_1000318 Ga0055543_100031833 283
246 3300005262 Ga0065165_1023662 Ga0065165_10236622 283
247 3300005262 Ga0065165_1023663 Ga0065165_10236632 283
248 3300005328 Ga0070676_10215649 Ga0070676_102156491 283
249 3300005457 Ga0070662_100015503 Ga0070662_1000155033 283
250 3300006058 Ga0075432_10033074 Ga0075432_100330742 283
251 3300006177 Ga0075362_10024286 Ga0075362_100242863 283
252 3300006195 Ga0075366_10132460 Ga0075366_101324603 283
253 3300006353 Ga0075370_10002144 Ga0075370_100021445 283
254 3300009148 Ga0105243_10370442 Ga0105243_103704422 283
255 3300009176 Ga0105242_10001629 Ga0105242_100016297 283
256 3300010375 Ga0105239_10065333 Ga0105239_100653334 283
257 3300025263 Ga0209565_1000433 Ga0209565_100043329 283
258 3300025284 Ga0209130_1000186 Ga0209130_100018613 283
259 3300025291 Ga0209675_1008419 Ga0209675_10084193 283
260 3300025294 Ga0209025_1004787 Ga0209025_10047875 283
261 3300025297 Ga0209758_1002912 Ga0209758_100291212 283
262 3300025298 Ga0209050_1004606 Ga0209050_10046062 283
263 3300025302 Ga0207426_1000153 Ga0207426_1000153111 283
264 3300027682 Ga0209971_1009120 Ga0209971_10091203 283
265 3300031238 Ga0265332_10000009 Ga0265332_10000009101 283
266 3300031456 Ga0307513_10000015 Ga0307513_1000001573 283
267 3300031730 Ga0307516_10009209 Ga0307516_1000920911 283
268 3300041451 Ga0451791_1537883 Ga0451791_1537883_205_1152 283
269 3300046542 Ga0495597_0000505 Ga0495597_0000505_25876_26832 283
270 3300049573 Ga0501037_0097820 Ga0501037_0097820_604_1572 283
271 3300049823 Ga0501044_0197647 Ga0501044_0197647_380_1348 283
272 3300050493 nmdc:mga0k408_14455_c1 nmdc:mga0k408_14455_c1_3325_4236 283
273 3300050493 nmdc:mga0k408_166144_c1 nmdc:mga0k408_166144_c1_317_1300 283
274 3300050496 nmdc:mga07m45_3744_c1 nmdc:mga07m45_3744_c1_4116_5027 283
275 3300053730 Ga0500645_000855 Ga0500645_000855_2264_3247 283
276 3300001979 JGI24740J21852_10001708 JGI24740J21852_100017088 284
277 3300005455 Ga0070663_100002204 Ga0070663_1000022043 284
278 3300005564 Ga0070664_100027643 Ga0070664_1000276433 284
279 3300006048 Ga0075363_100029362 Ga0075363_1000293623 284
280 3300006177 Ga0075362_10045703 Ga0075362_100457033 284
281 3300006178 Ga0075367_10061222 Ga0075367_100612223 284
282 3300013296 Ga0157374_10038464 Ga0157374_100384643 284
283 3300025907 Ga0207645_10010381 Ga0207645_100103811 284
284 3300027876 Ga0209974_10000874 Ga0209974_100008749 284
285 3300028794 Ga0307515_10001727 Ga0307515_100017276 284
286 3300028794 Ga0307515_10030061 Ga0307515_100300616 284
287 3300028794 Ga0307515_10041599 Ga0307515_100415997 284
288 3300031456 Ga0307513_10031881 Ga0307513_100318813 284
289 3300031507 Ga0307509_10079394 Ga0307509_100793942 284
290 3300031616 Ga0307508_10000007 Ga0307508_10000007173 284
291 3300031649 Ga0307514_10007132 Ga0307514_100071328 284
292 3300031730 Ga0307516_10014861 Ga0307516_100148619 284
293 3300036401 Ga0373937_0027185 Ga0373937_0027185_4132_5040 284
294 3300041452 Ga0451793_1806592 Ga0451793_1806592_746_1651 284
295 3300041456 Ga0451795_0797898 Ga0451795_0797898_221_1126 284
296 3300041491 Ga0451833_0442280 Ga0451833_0442280_79_984 284
297 3300042015 Ga0439462_0004907 Ga0439462_0004907_586_1599 284
298 3300042531 Ga0450918_000104 Ga0450918_000104_1467_2372 284
299 3300046512 Ga0495610_0012778 Ga0495610_0012778_2545_3450 284
300 3300046519 Ga0495632_0016953 Ga0495632_0016953_1523_2428 284
301 3300046660 Ga0495625_0016606 Ga0495625_0016606_1803_2708 284
302 3300046683 Ga0495658_0078370 Ga0495658_0078370_36_941 284
303 3300047472 Ga0495686_0105451 Ga0495686_0105451_751_1656 284
304 3300050494 nmdc:mga06z11_44312_c1 nmdc:mga06z11_44312_c1_349_1254 284
305 3300053088 Ga0500644_0014472 Ga0500644_0014472_1244_2149 284
306 3300053134 Ga0500658_0012210 Ga0500658_0012210_1439_2344 284
307 iso_pu_bacteria 2919704043 2919704332 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03193

RsgA_GTPase

RsgA GTPase

68

250

0.92

PF00005

ABC_tran

ABC transporter

171

261

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zp4-assembly1.cif.gz_G sars-cov-2 nsp1 bound to a human 43s preinitiation ribosome complex - state 2 0.8221 1 62
6nf8-assembly1.cif.gz_L structure of human mitochondrial translation initiation factor 3 bound to the small ribosomal subunit -class i 0.7962 4 58
2eif-assembly1.cif.gz_A eukaryotic translation initiation factor 5a from methanococcus jannaschii 0.7833 6 61
7pnw-assembly1.cif.gz_J mouse mitochondrial ribosome small subunit lacking m5u modification 0.7744 2 58
8cai-assembly1.cif.gz_L streptomycin and hygromycin b bound to the 30s body 0.7726 2 57
ID Description Score Start End Superfamily
1t9hA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 0.9648 221 282 1.10.40.50
2rcnA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9177 6 62 2.40.50.140
2rcnA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 0.9173 221 279 1.10.40.50
1t9hA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 0.8702 221 282 1.10.40.50
2rcnA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 0.8638 221 279 1.10.40.50
ID Description Score Start End GO Terms
AF-A0A4Q3QD92-F1-model_v4 deleted 0.96 1 87
AF-I4Z580-F1-model_v4 EngC GTPase domain-containing protein 0.9213 1 130 GO:0003924
GO:0005525
GO:0005737
GO:0019843
GO:0042254
GO:0046872
AF-A0A4Q3HVN2-F1-model_v4 deleted 0.9171 1 146
AF-A0A1W6LBN1-F1-model_v4 Small ribosomal subunit biogenesis GTPase RsgA (EC 3.6.1.-) 0.9044 1 280 GO:0003924
GO:0005525
GO:0005737
GO:0019843
GO:0042274
GO:0046872
AF-A0A6L5DAW3-F1-model_v4 deleted 0.8994 1 280

Feature Viewer

pLDDT pTM Quality
86.76 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map