F399302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 213 | 283 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300042015|Ga0439462_0004907|Ga0439462_0004907_586_1599 |
| Length | 337 |
| Sequence | VGRAATAGHPLASGLVVASHGRHLLVESPEGPDGRRLICHPRGKKNDAVVGDRVRWLPTGDEGSIEAIEPRRNLFYRQDELRSKSFAANIDQVLILIAAEPEFSESQLARALIAAEAAGIAPLIALNKSDLSAAHARAWTRLAAYRRMGYTVLPLNLKNGPTQDSVLALRQHLQGRATLVLGPSGAGKSTLINLFAPDAQAQTGEISSALNSGKHTTTHTRWYWVDLQAGAATPRTALIDSPGFQEFGLHHIEVAQLASLMPDLRAHAGTCRFYNCTHLHEPGCAVIAAVEASEPATGSQTGAGNPTDHARPDPPVTSSRYRIYRELHAELSMPPRY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 3 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 12 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 13 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 14 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 15 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 16 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 17 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 18 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 19 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 20 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 21 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 22 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 23 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 24 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 25 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 26 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 27 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 28 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 35 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 150 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 151 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 162 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 163 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 164 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 168 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 169 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 170 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 171 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 172 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 176 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 202 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 203 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 207 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 208 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 209 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 210 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 212 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 213 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.18 |
| Metatranscriptomes | 0 |
| Isolates | 7.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.41 |
| Nodule | 0 |
| Rhizoplane | 0.98 |
| Rhizosphere | 59.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001708 | 3300001979 | Bacteria | 10083 |
| 2 | JGI25155J39150_1000005 | 3300002704 | Bacteria | 261712 |
| 3 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 4 | JGI25154J39366_1000015 | 3300002738 | Bacteria | 261778 |
| 5 | JGI25157J39369_1000111 | 3300002741 | Bacteria | 69508 |
| 6 | JGI25150J39212_1001950 | 3300002774 | Bacteria | 5413 |
| 7 | JGI25150J39212_1002104 | 3300002774 | Bacteria | 5152 |
| 8 | JGI25159J45721_1000135 | 3300002987 | Bacteria | 34873 |
| 9 | JGI25159J45721_1001885 | 3300002987 | Bacteria | 8382 |
| 10 | JGI25151J46595_10003864 | 3300003187 | Bacteria | 8097 |
| 11 | JGI25151J46595_10026625 | 3300003187 | Bacteria | 2330 |
| 12 | rootL2_10003045 | 3300003322 | Bacteria | 14122 |
| 13 | JGI25160J50197_1000045 | 3300003354 | Bacteria | 142992 |
| 14 | JGI25161J50226_1000008 | 3300003374 | Bacteria | 239245 |
| 15 | Ga0055526_1012404 | 3300003771 | Bacteria | 3722 |
| 16 | Ga0055526_1012696 | 3300003771 | Bacteria | 3644 |
| 17 | Ga0055537_1000182 | 3300003773 | Bacteria | 46822 |
| 18 | Ga0055524_1000107 | 3300003775 | Bacteria | 100962 |
| 19 | Ga0055524_1000126 | 3300003775 | Bacteria | 89985 |
| 20 | Ga0055536_1004968 | 3300003781 | Bacteria | 6615 |
| 21 | Ga0055534_1001254 | 3300003784 | Bacteria | 10451 |
| 22 | Ga0055528_1000606 | 3300003790 | Bacteria | 26938 |
| 23 | Ga0055530_10000302 | 3300003791 | Bacteria | 44821 |
| 24 | Ga0055530_10000490 | 3300003791 | Bacteria | 34448 |
| 25 | Ga0055540_1000021 | 3300003792 | Bacteria | 208733 |
| 26 | Ga0055531_10000192 | 3300003794 | Bacteria | 67874 |
| 27 | Ga0055531_10001001 | 3300003794 | Bacteria | 22450 |
| 28 | Ga0055543_1000318 | 3300004625 | Bacteria | 33336 |
| 29 | Ga0065165_1008387 | 3300005262 | Bacteria | 4848 |
| 30 | Ga0065165_1023662 | 3300005262 | Bacteria | 2078 |
| 31 | Ga0065165_1023663 | 3300005262 | Bacteria | 2078 |
| 32 | Ga0070676_10215649 | 3300005328 | Bacteria | 1265 |
| 33 | Ga0068869_100015545 | 3300005334 | Bacteria | 5109 |
| 34 | Ga0070659_100100556 | 3300005366 | Bacteria | 2327 |
| 35 | Ga0070667_100068800 | 3300005367 | Bacteria | 3013 |
| 36 | Ga0070700_100026714 | 3300005441 | Bacteria | 3414 |
| 37 | Ga0070700_100290020 | 3300005441 | Unclassified | 1190 |
| 38 | Ga0070663_100002204 | 3300005455 | Bacteria | 10897 |
| 39 | Ga0070662_100015503 | 3300005457 | Bacteria | 5107 |
| 40 | Ga0070681_10008962 | 3300005458 | Bacteria | 9839 |
| 41 | Ga0068867_100054017 | 3300005459 | Bacteria | 2967 |
| 42 | Ga0068867_100157011 | 3300005459 | Bacteria | 1791 |
| 43 | Ga0070679_100031482 | 3300005530 | Bacteria | 5241 |
| 44 | Ga0068853_100369135 | 3300005539 | Bacteria | 1338 |
| 45 | Ga0070665_100033280 | 3300005548 | Bacteria | 5187 |
| 46 | Ga0070704_100132164 | 3300005549 | Bacteria | 1936 |
| 47 | Ga0068855_100173483 | 3300005563 | Bacteria | 2441 |
| 48 | Ga0070664_100027643 | 3300005564 | Bacteria | 4714 |
| 49 | Ga0068857_100004780 | 3300005577 | Bacteria | 11473 |
| 50 | Ga0068854_100008521 | 3300005578 | Bacteria | 6597 |
| 51 | Ga0068856_100019270 | 3300005614 | Bacteria | 6623 |
| 52 | Ga0068856_100149118 | 3300005614 | Bacteria | 2347 |
| 53 | Ga0068858_100043018 | 3300005842 | Bacteria | 4189 |
| 54 | Ga0068858_100101791 | 3300005842 | Bacteria | 2679 |
| 55 | Ga0068862_100029477 | 3300005844 | Bacteria | 4624 |
| 56 | Ga0075363_100029362 | 3300006048 | Bacteria | 2838 |
| 57 | Ga0075432_10033074 | 3300006058 | Bacteria | 1792 |
| 58 | Ga0075362_10024286 | 3300006177 | Bacteria | 2570 |
| 59 | Ga0075362_10045703 | 3300006177 | Bacteria | 1945 |
| 60 | Ga0075367_10061222 | 3300006178 | Bacteria | 2246 |
| 61 | Ga0075366_10045562 | 3300006195 | Bacteria | 2599 |
| 62 | Ga0075366_10132460 | 3300006195 | Bacteria | 1504 |
| 63 | Ga0097621_100005867 | 3300006237 | Bacteria | 8677 |
| 64 | Ga0075370_10002144 | 3300006353 | Bacteria | 9020 |
| 65 | Ga0068871_100019653 | 3300006358 | Bacteria | 5160 |
| 66 | Ga0068871_100384883 | 3300006358 | Bacteria | 1247 |
| 67 | Ga0075431_100136272 | 3300006847 | Bacteria | 2531 |
| 68 | Ga0075431_100191219 | 3300006847 | Bacteria | 2097 |
| 69 | Ga0068865_100183927 | 3300006881 | Bacteria | 1611 |
| 70 | Ga0105243_10312730 | 3300009148 | Bacteria | 1428 |
| 71 | Ga0105243_10370442 | 3300009148 | Bacteria | 1321 |
| 72 | Ga0105241_10004042 | 3300009174 | Bacteria | 10859 |
| 73 | Ga0105241_10092763 | 3300009174 | Bacteria | 2385 |
| 74 | Ga0105242_10001629 | 3300009176 | Bacteria | 17706 |
| 75 | Ga0105248_10033181 | 3300009177 | Bacteria | 5767 |
| 76 | Ga0105237_10020797 | 3300009545 | Bacteria | 6759 |
| 77 | Ga0105237_10186992 | 3300009545 | Bacteria | 2071 |
| 78 | Ga0105238_10051939 | 3300009551 | Bacteria | 4122 |
| 79 | Ga0105239_10065333 | 3300010375 | Bacteria | 3995 |
| 80 | Ga0105239_10111318 | 3300010375 | Bacteria | 3035 |
| 81 | Ga0105239_10226339 | 3300010375 | Bacteria | 2098 |
| 82 | Ga0105246_10276034 | 3300011119 | Unclassified | 1346 |
| 83 | Ga0157374_10038464 | 3300013296 | Bacteria | 4398 |
| 84 | Ga0157378_10106355 | 3300013297 | Bacteria | 2566 |
| 85 | Ga0157375_10045918 | 3300013308 | Bacteria | 4254 |
| 86 | Ga0157375_10066616 | 3300013308 | Bacteria | 3596 |
| 87 | Ga0163163_10237872 | 3300014325 | Bacteria | 1870 |
| 88 | Ga0163163_10294570 | 3300014325 | Bacteria | 1675 |
| 89 | Ga0182008_10000207 | 3300014497 | Bacteria | 46359 |
| 90 | Ga0157379_10165776 | 3300014968 | Bacteria | 1994 |
| 91 | Ga0157376_10015342 | 3300014969 | Bacteria | 5786 |
| 92 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 93 | Ga0213872_10000114 | 3300021361 | Bacteria | 74773 |
| 94 | Ga0213872_10001692 | 3300021361 | Bacteria | 13879 |
| 95 | Ga0213872_10004245 | 3300021361 | Bacteria | 7681 |
| 96 | Ga0213872_10015112 | 3300021361 | Bacteria | 3590 |
| 97 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 98 | Ga0207425_1002648 | 3300025245 | Bacteria | 6175 |
| 99 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 100 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 101 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 102 | Ga0209565_1000028 | 3300025263 | Bacteria | 348536 |
| 103 | Ga0209565_1000433 | 3300025263 | Bacteria | 33703 |
| 104 | Ga0209673_1000035 | 3300025273 | Bacteria | 328411 |
| 105 | Ga0209673_1014451 | 3300025273 | Bacteria | 3053 |
| 106 | Ga0209130_1000112 | 3300025284 | Bacteria | 131607 |
| 107 | Ga0209130_1000186 | 3300025284 | Bacteria | 87096 |
| 108 | Ga0209675_1000153 | 3300025291 | Bacteria | 90298 |
| 109 | Ga0209675_1008419 | 3300025291 | Bacteria | 3790 |
| 110 | Ga0209676_1000069 | 3300025292 | Bacteria | 312462 |
| 111 | Ga0209676_1006872 | 3300025292 | Bacteria | 5506 |
| 112 | Ga0209025_1001921 | 3300025294 | Bacteria | 24097 |
| 113 | Ga0209025_1004787 | 3300025294 | Bacteria | 11478 |
| 114 | Ga0209025_1021665 | 3300025294 | Bacteria | 3450 |
| 115 | Ga0209025_1036681 | 3300025294 | Bacteria | 2190 |
| 116 | Ga0209564_1000583 | 3300025295 | Bacteria | 57799 |
| 117 | Ga0209564_1002659 | 3300025295 | Bacteria | 13606 |
| 118 | Ga0209564_1008103 | 3300025295 | Bacteria | 5258 |
| 119 | Ga0209758_1002912 | 3300025297 | Bacteria | 16512 |
| 120 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 121 | Ga0209050_1004606 | 3300025298 | Bacteria | 9215 |
| 122 | Ga0209050_1016246 | 3300025298 | Bacteria | 3060 |
| 123 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 124 | Ga0207426_1000153 | 3300025302 | Bacteria | 182839 |
| 125 | Ga0207426_1002916 | 3300025302 | Bacteria | 10082 |
| 126 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 127 | Ga0209051_1000317 | 3300025303 | Bacteria | 73057 |
| 128 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 129 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 130 | Ga0207656_10015773 | 3300025321 | Bacteria | 2930 |
| 131 | Ga0207645_10010381 | 3300025907 | Bacteria | 6392 |
| 132 | Ga0207643_10156684 | 3300025908 | Unclassified | 1368 |
| 133 | Ga0207707_10004059 | 3300025912 | Bacteria | 12972 |
| 134 | Ga0207671_10030303 | 3300025914 | Bacteria | 4035 |
| 135 | Ga0207649_10122303 | 3300025920 | Bacteria | 1756 |
| 136 | Ga0207659_10016028 | 3300025926 | Bacteria | 4870 |
| 137 | Ga0207644_10018554 | 3300025931 | Bacteria | 4709 |
| 138 | Ga0207704_10082385 | 3300025938 | Bacteria | 2084 |
| 139 | Ga0207691_10020447 | 3300025940 | Bacteria | 6257 |
| 140 | Ga0207711_10011873 | 3300025941 | Bacteria | 7240 |
| 141 | Ga0207689_10002155 | 3300025942 | Bacteria | 18523 |
| 142 | Ga0207689_10008289 | 3300025942 | Bacteria | 9057 |
| 143 | Ga0207651_10088657 | 3300025960 | Bacteria | 2256 |
| 144 | Ga0207658_10076525 | 3300025986 | Bacteria | 2550 |
| 145 | Ga0207658_10081464 | 3300025986 | Bacteria | 2482 |
| 146 | Ga0207703_10029243 | 3300026035 | Bacteria | 4346 |
| 147 | Ga0207702_10117862 | 3300026078 | Bacteria | 2371 |
| 148 | Ga0207641_10464779 | 3300026088 | Unclassified | 1224 |
| 149 | Ga0207648_10009359 | 3300026089 | Bacteria | 9387 |
| 150 | Ga0207648_10044399 | 3300026089 | Bacteria | 3899 |
| 151 | Ga0207674_10008485 | 3300026116 | Bacteria | 11865 |
| 152 | Ga0207683_10131090 | 3300026121 | Unclassified | 2255 |
| 153 | Ga0209973_1009732 | 3300027252 | Bacteria | 1124 |
| 154 | Ga0209970_1001339 | 3300027614 | Bacteria | 4310 |
| 155 | Ga0209971_1009120 | 3300027682 | Bacteria | 2353 |
| 156 | Ga0209974_10000874 | 3300027876 | Bacteria | 10431 |
| 157 | Ga0209974_10003264 | 3300027876 | Bacteria | 5865 |
| 158 | Ga0209974_10076487 | 3300027876 | Bacteria | 1147 |
| 159 | Ga0268266_10017475 | 3300028379 | Bacteria | 6118 |
| 160 | Ga0268264_10169475 | 3300028381 | Bacteria | 1973 |
| 161 | Ga0265323_10008234 | 3300028653 | Bacteria | 4309 |
| 162 | Ga0265336_10001259 | 3300028666 | Bacteria | 11998 |
| 163 | Ga0307515_10000650 | 3300028794 | Bacteria | 80300 |
| 164 | Ga0307515_10001727 | 3300028794 | Bacteria | 48647 |
| 165 | Ga0307515_10030061 | 3300028794 | Bacteria | 9147 |
| 166 | Ga0307515_10041599 | 3300028794 | Bacteria | 7217 |
| 167 | Ga0307515_10064529 | 3300028794 | Bacteria | 5118 |
| 168 | Ga0307515_10316735 | 3300028794 | Bacteria | 1230 |
| 169 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 170 | Ga0265324_10000753 | 3300029957 | Bacteria | 21463 |
| 171 | Ga0265324_10016285 | 3300029957 | Bacteria | 2718 |
| 172 | Ga0265332_10000009 | 3300031238 | Bacteria | 295760 |
| 173 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 174 | Ga0265331_10003248 | 3300031250 | Bacteria | 10594 |
| 175 | Ga0265331_10011512 | 3300031250 | Bacteria | 4841 |
| 176 | Ga0265327_10002575 | 3300031251 | Bacteria | 18772 |
| 177 | Ga0265327_10005523 | 3300031251 | Bacteria | 10511 |
| 178 | Ga0265316_10014574 | 3300031344 | Bacteria | 6913 |
| 179 | Ga0265316_10025294 | 3300031344 | Bacteria | 4956 |
| 180 | Ga0265316_10287626 | 3300031344 | Bacteria | 1200 |
| 181 | Ga0265316_10304533 | 3300031344 | Bacteria | 1160 |
| 182 | Ga0265316_10394693 | 3300031344 | Bacteria | 997 |
| 183 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 184 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 185 | Ga0307513_10031813 | 3300031456 | Bacteria | 5966 |
| 186 | Ga0307513_10031881 | 3300031456 | Bacteria | 5957 |
| 187 | Ga0307509_10079394 | 3300031507 | Bacteria | 3397 |
| 188 | Ga0307408_100000186 | 3300031548 | Bacteria | 68520 |
| 189 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 190 | Ga0307508_10032898 | 3300031616 | Bacteria | 4682 |
| 191 | Ga0307514_10002799 | 3300031649 | Bacteria | 17514 |
| 192 | Ga0307514_10007132 | 3300031649 | Bacteria | 9647 |
| 193 | Ga0316575_10000027 | 3300031665 | Bacteria | 35516 |
| 194 | Ga0265314_10000397 | 3300031711 | Bacteria | 59137 |
| 195 | Ga0265314_10061258 | 3300031711 | Bacteria | 2563 |
| 196 | Ga0307516_10009209 | 3300031730 | Bacteria | 11050 |
| 197 | Ga0307516_10014861 | 3300031730 | Bacteria | 8218 |
| 198 | Ga0307406_10002742 | 3300031901 | Bacteria | 9611 |
| 199 | Ga0373931_0042169 | 3300035691 | Bacteria | 2399 |
| 200 | Ga0373937_0027185 | 3300036401 | Bacteria | 5172 |
| 201 | Ga0373925_0173158 | 3300037068 | Bacteria | 1705 |
| 202 | Ga0395899_0007462 | 3300037312 | Bacteria | 8449 |
| 203 | Ga0395898_0195450 | 3300037466 | Bacteria | 1932 |
| 204 | Ga0395901_0053168 | 3300038443 | Bacteria | 4208 |
| 205 | Ga0436361_0215157 | 3300039447 | Bacteria | 166868 |
| 206 | Ga0436361_0436655 | 3300039447 | Bacteria | 19070 |
| 207 | Ga0436361_0588251 | 3300039447 | Bacteria | 1915 |
| 208 | Ga0436361_0610098 | 3300039447 | Bacteria | 9675 |
| 209 | Ga0436361_0632651 | 3300039447 | Bacteria | 49929 |
| 210 | Ga0436361_0971261 | 3300039447 | Bacteria | 2262 |
| 211 | Ga0436361_1043948 | 3300039447 | Bacteria | 4310 |
| 212 | Ga0439436_0057432 | 3300041404 | Bacteria | 1092 |
| 213 | Ga0439453_0012463 | 3300041408 | Bacteria | 1432 |
| 214 | Ga0451791_1537883 | 3300041451 | Bacteria | 1648 |
| 215 | Ga0451793_1806592 | 3300041452 | Bacteria | 2165 |
| 216 | Ga0451795_0797898 | 3300041456 | Bacteria | 1727 |
| 217 | Ga0451833_0442280 | 3300041491 | Bacteria | 1063 |
| 218 | Ga0439462_0004907 | 3300042015 | Bacteria | 3283 |
| 219 | Ga0450919_002650 | 3300042121 | Bacteria | 2311 |
| 220 | Ga0439446_0015610 | 3300042156 | Bacteria | 2108 |
| 221 | Ga0439464_0003813 | 3300042439 | Bacteria | 3831 |
| 222 | Ga0450918_000104 | 3300042531 | Bacteria | 18155 |
| 223 | Ga0451577_0000080 | 3300042876 | Bacteria | 218034 |
| 224 | Ga0451577_0001963 | 3300042876 | Bacteria | 25875 |
| 225 | Ga0451577_0037839 | 3300042876 | Bacteria | 4342 |
| 226 | Ga0451577_0040604 | 3300042876 | Bacteria | 4178 |
| 227 | Ga0466969_0057891 | 3300044656 | Bacteria | 1888 |
| 228 | Ga0453683_0000049 | 3300044673 | Bacteria | 206697 |
| 229 | Ga0453683_0149586 | 3300044673 | Bacteria | 1475 |
| 230 | Ga0466965_0010229 | 3300044683 | Bacteria | 4370 |
| 231 | Ga0466966_0084564 | 3300044684 | Bacteria | 1973 |
| 232 | Ga0466966_0187531 | 3300044684 | Bacteria | 1254 |
| 233 | Ga0466961_0000461 | 3300044693 | Bacteria | 25685 |
| 234 | Ga0453684_0000237 | 3300044712 | Bacteria | 236999 |
| 235 | Ga0453684_0000286 | 3300044712 | Bacteria | 218034 |
| 236 | Ga0453684_0030539 | 3300044712 | Bacteria | 7610 |
| 237 | Ga0453684_0036557 | 3300044712 | Bacteria | 6767 |
| 238 | Ga0453684_0190658 | 3300044712 | Bacteria | 2398 |
| 239 | Ga0453684_0375641 | 3300044712 | Bacteria | 1597 |
| 240 | Ga0466959_0013399 | 3300045049 | Bacteria | 5943 |
| 241 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 242 | Ga0451576_0000102 | 3300045051 | Bacteria | 218034 |
| 243 | Ga0451576_0003674 | 3300045051 | Bacteria | 20819 |
| 244 | Ga0451576_0185290 | 3300045051 | Bacteria | 2174 |
| 245 | Ga0451576_0563096 | 3300045051 | Bacteria | 1197 |
| 246 | Ga0495610_0012778 | 3300046512 | Bacteria | 5025 |
| 247 | Ga0495632_0016953 | 3300046519 | Bacteria | 4036 |
| 248 | Ga0495652_0163711 | 3300046529 | Bacteria | 1724 |
| 249 | Ga0495654_0002766 | 3300046530 | Bacteria | 11055 |
| 250 | Ga0495597_0000505 | 3300046542 | Bacteria | 32423 |
| 251 | Ga0495625_0016606 | 3300046660 | Bacteria | 5785 |
| 252 | Ga0495658_0078370 | 3300046683 | Bacteria | 1934 |
| 253 | Ga0495686_0020831 | 3300047472 | Bacteria | 4369 |
| 254 | Ga0495686_0105451 | 3300047472 | Bacteria | 1696 |
| 255 | Ga0496123_0117909 | 3300048926 | Bacteria | 1500 |
| 256 | Ga0501031_0006785 | 3300049568 | Bacteria | 7470 |
| 257 | Ga0501034_0153919 | 3300049571 | Bacteria | 2274 |
| 258 | Ga0501037_0097820 | 3300049573 | Bacteria | 2120 |
| 259 | Ga0501046_0026850 | 3300049580 | Bacteria | 4703 |
| 260 | Ga0501047_0150124 | 3300049581 | Bacteria | 2207 |
| 261 | Ga0501068_0001829 | 3300049584 | Bacteria | 11295 |
| 262 | Ga0501074_0036860 | 3300049590 | Bacteria | 3543 |
| 263 | Ga0501080_0052223 | 3300049742 | Bacteria | 3804 |
| 264 | Ga0501080_0086066 | 3300049742 | Bacteria | 2920 |
| 265 | Ga0501035_0440356 | 3300049822 | Bacteria | 1079 |
| 266 | Ga0501044_0197647 | 3300049823 | Bacteria | 1970 |
| 267 | nmdc:mga00v17_152148_c1 | 3300050491 | Bacteria | 1487 |
| 268 | nmdc:mga0k408_14455_c1 | 3300050493 | Bacteria | 4350 |
| 269 | nmdc:mga0k408_166144_c1 | 3300050493 | Bacteria | 1315 |
| 270 | nmdc:mga0k408_683_c1 | 3300050493 | Bacteria | 11515 |
| 271 | nmdc:mga06z11_44312_c1 | 3300050494 | Bacteria | 2243 |
| 272 | nmdc:mga07m45_36124_c1 | 3300050496 | Bacteria | 2750 |
| 273 | nmdc:mga07m45_3744_c1 | 3300050496 | Bacteria | 7362 |
| 274 | Ga0500644_0014472 | 3300053088 | Bacteria | 2228 |
| 275 | Ga0500644_0036302 | 3300053088 | Bacteria | 1603 |
| 276 | Ga0500651_0031169 | 3300053093 | Bacteria | 3358 |
| 277 | Ga0500566_0037777 | 3300053094 | Bacteria | 2797 |
| 278 | Ga0500562_002177 | 3300053108 | Bacteria | 4898 |
| 279 | Ga0500593_000742 | 3300053117 | Bacteria | 12287 |
| 280 | Ga0500658_0012210 | 3300053134 | Bacteria | 3165 |
| 281 | Ga0500559_0056790 | 3300053136 | Bacteria | 1738 |
| 282 | Ga0500645_000855 | 3300053730 | Bacteria | 17844 |
| 283 | Ga0500661_001583 | 3300055283 | Bacteria | 4294 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100015545 | Ga0068869_1000155453 | 232 |
| 2 | 3300005441 | Ga0070700_100290020 | Ga0070700_1002900202 | 232 |
| 3 | 3300005548 | Ga0070665_100033280 | Ga0070665_1000332804 | 232 |
| 4 | 3300005844 | Ga0068862_100029477 | Ga0068862_1000294774 | 232 |
| 5 | 3300006358 | Ga0068871_100019653 | Ga0068871_1000196533 | 232 |
| 6 | 3300021361 | Ga0213872_10000114 | Ga0213872_1000011477 | 232 |
| 7 | 3300025908 | Ga0207643_10156684 | Ga0207643_101566841 | 232 |
| 8 | 3300025986 | Ga0207658_10076525 | Ga0207658_100765252 | 232 |
| 9 | 3300026089 | Ga0207648_10044399 | Ga0207648_100443993 | 232 |
| 10 | 3300039447 | Ga0436361_0215157 | Ga0436361_0215157_101819_102688 | 232 |
| 11 | 3300025941 | Ga0207711_10011873 | Ga0207711_100118735 | 239 |
| 12 | 3300028379 | Ga0268266_10017475 | Ga0268266_100174752 | 239 |
| 13 | 3300044656 | Ga0466969_0057891 | Ga0466969_0057891_933_1799 | 239 |
| 14 | 3300044683 | Ga0466965_0010229 | Ga0466965_0010229_549_1415 | 239 |
| 15 | 3300044684 | Ga0466966_0084564 | Ga0466966_0084564_996_1862 | 239 |
| 16 | 3300044693 | Ga0466961_0000461 | Ga0466961_0000461_16768_17634 | 239 |
| 17 | 3300005459 | Ga0068867_100157011 | Ga0068867_1001570112 | 240 |
| 18 | 3300005842 | Ga0068858_100101791 | Ga0068858_1001017912 | 240 |
| 19 | 3300006237 | Ga0097621_100005867 | Ga0097621_1000058679 | 240 |
| 20 | 3300006881 | Ga0068865_100183927 | Ga0068865_1001839272 | 240 |
| 21 | 3300025942 | Ga0207689_10002155 | Ga0207689_100021554 | 240 |
| 22 | 3300025960 | Ga0207651_10088657 | Ga0207651_100886572 | 240 |
| 23 | 3300026088 | Ga0207641_10464779 | Ga0207641_104647792 | 240 |
| 24 | 3300026121 | Ga0207683_10131090 | Ga0207683_101310901 | 240 |
| 25 | 3300028381 | Ga0268264_10169475 | Ga0268264_101694752 | 240 |
| 26 | 3300042121 | Ga0450919_002650 | Ga0450919_002650_1522_2301 | 243 |
| 27 | 3300031250 | Ga0265331_10011512 | Ga0265331_100115126 | 248 |
| 28 | 3300031251 | Ga0265327_10002575 | Ga0265327_1000257514 | 248 |
| 29 | 3300045049 | Ga0466959_0013399 | Ga0466959_0013399_3399_4265 | 254 |
| 30 | 3300044673 | Ga0453683_0149586 | Ga0453683_0149586_43_993 | 260 |
| 31 | 3300049568 | Ga0501031_0006785 | Ga0501031_0006785_1487_2428 | 261 |
| 32 | 3300028794 | Ga0307515_10316735 | Ga0307515_103167352 | 262 |
| 33 | 3300035691 | Ga0373931_0042169 | Ga0373931_0042169_493_1362 | 262 |
| 34 | 3300044712 | Ga0453684_0000237 | Ga0453684_0000237_107096_107950 | 264 |
| 35 | 3300028794 | Ga0307515_10064529 | Ga0307515_100645295 | 265 |
| 36 | 3300053108 | Ga0500562_002177 | Ga0500562_002177_2007_2897 | 265 |
| 37 | 3300028666 | Ga0265336_10001259 | Ga0265336_100012592 | 266 |
| 38 | 3300029957 | Ga0265324_10000006 | Ga0265324_10000006168 | 266 |
| 39 | 3300037068 | Ga0373925_0173158 | Ga0373925_0173158_649_1503 | 266 |
| 40 | 3300042876 | Ga0451577_0000080 | Ga0451577_0000080_90483_91334 | 266 |
| 41 | 3300044673 | Ga0453683_0000049 | Ga0453683_0000049_90483_91334 | 266 |
| 42 | 3300044712 | Ga0453684_0000286 | Ga0453684_0000286_126701_127552 | 266 |
| 43 | 3300045051 | Ga0451576_0000102 | Ga0451576_0000102_90483_91334 | 266 |
| 44 | iso_pu_bacteria | 2846037992 | 2846041046 | 266 |
| 45 | iso_pu_bacteria | 2998344455 | 2998347314 | 267 |
| 46 | 3300031344 | Ga0265316_10014574 | Ga0265316_100145745 | 268 |
| 47 | 3300031344 | Ga0265316_10304533 | Ga0265316_103045332 | 268 |
| 48 | 3300031344 | Ga0265316_10394693 | Ga0265316_103946932 | 268 |
| 49 | 3300042876 | Ga0451577_0037839 | Ga0451577_0037839_619_1479 | 268 |
| 50 | 3300044712 | Ga0453684_0030539 | Ga0453684_0030539_83_943 | 268 |
| 51 | 3300021361 | Ga0213872_10004245 | Ga0213872_100042454 | 269 |
| 52 | 3300029957 | Ga0265324_10000753 | Ga0265324_100007536 | 269 |
| 53 | 3300031344 | Ga0265316_10287626 | Ga0265316_102876262 | 269 |
| 54 | 3300031711 | Ga0265314_10000397 | Ga0265314_1000039711 | 269 |
| 55 | 3300031711 | Ga0265314_10061258 | Ga0265314_100612582 | 269 |
| 56 | 3300039447 | Ga0436361_0436655 | Ga0436361_0436655_5387_6256 | 269 |
| 57 | iso_pu_bacteria | 2547132103 | 2547373842 | 269 |
| 58 | iso_pu_bacteria | 2843690924 | 2843693424 | 269 |
| 59 | iso_pu_bacteria | 2846033681 | 2846036674 | 269 |
| 60 | 3300031250 | Ga0265331_10003248 | Ga0265331_100032486 | 270 |
| 61 | 3300031251 | Ga0265327_10005523 | Ga0265327_1000552311 | 270 |
| 62 | 3300031344 | Ga0265316_10025294 | Ga0265316_100252943 | 270 |
| 63 | 3300039447 | Ga0436361_0588251 | Ga0436361_0588251_344_1210 | 270 |
| 64 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_451680_452570 | 270 |
| 65 | 3300045051 | Ga0451576_0563096 | Ga0451576_0563096_34_900 | 270 |
| 66 | iso_pu_bacteria | 2526164512 | 2526213084 | 270 |
| 67 | 3300005563 | Ga0068855_100173483 | Ga0068855_1001734832 | 271 |
| 68 | 3300005614 | Ga0068856_100149118 | Ga0068856_1001491181 | 271 |
| 69 | 3300005842 | Ga0068858_100043018 | Ga0068858_1000430182 | 271 |
| 70 | 3300014325 | Ga0163163_10294570 | Ga0163163_102945702 | 271 |
| 71 | 3300014968 | Ga0157379_10165776 | Ga0157379_101657762 | 271 |
| 72 | 3300021361 | Ga0213872_10001692 | Ga0213872_1000169216 | 271 |
| 73 | 3300026035 | Ga0207703_10029243 | Ga0207703_100292434 | 271 |
| 74 | 3300028794 | Ga0307515_10000650 | Ga0307515_1000065063 | 271 |
| 75 | 3300031456 | Ga0307513_10031813 | Ga0307513_100318134 | 271 |
| 76 | 3300031616 | Ga0307508_10032898 | Ga0307508_100328985 | 271 |
| 77 | 3300031649 | Ga0307514_10002799 | Ga0307514_1000279910 | 271 |
| 78 | 3300039447 | Ga0436361_0632651 | Ga0436361_0632651_425_1306 | 271 |
| 79 | 3300039447 | Ga0436361_0971261 | Ga0436361_0971261_1201_2082 | 271 |
| 80 | 3300049580 | Ga0501046_0026850 | Ga0501046_0026850_1014_1916 | 271 |
| 81 | 3300049742 | Ga0501080_0086066 | Ga0501080_0086066_1541_2443 | 271 |
| 82 | 3300049822 | Ga0501035_0440356 | Ga0501035_0440356_95_997 | 271 |
| 83 | iso_pu_bacteria | 2547132512 | 2548848096 | 271 |
| 84 | 3300003187 | JGI25151J46595_10026625 | JGI25151J46595_100266253 | 272 |
| 85 | 3300003322 | rootL2_10003045 | rootL2_100030456 | 272 |
| 86 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001605 | 272 |
| 87 | 3300025292 | Ga0209676_1006872 | Ga0209676_10068724 | 272 |
| 88 | 3300025294 | Ga0209025_1001921 | Ga0209025_100192110 | 272 |
| 89 | 3300025295 | Ga0209564_1008103 | Ga0209564_10081032 | 272 |
| 90 | 3300025298 | Ga0209050_1016246 | Ga0209050_10162462 | 272 |
| 91 | 3300029957 | Ga0265324_10016285 | Ga0265324_100162852 | 273 |
| 92 | 3300044712 | Ga0453684_0036557 | Ga0453684_0036557_4434_5309 | 273 |
| 93 | 3300050491 | nmdc:mga00v17_152148_c1 | nmdc:mga00v17_152148_c1_501_1427 | 273 |
| 94 | 3300003794 | Ga0055531_10000192 | Ga0055531_1000019217 | 274 |
| 95 | 3300005539 | Ga0068853_100369135 | Ga0068853_1003691351 | 274 |
| 96 | 3300005549 | Ga0070704_100132164 | Ga0070704_1001321643 | 274 |
| 97 | 3300005578 | Ga0068854_100008521 | Ga0068854_1000085215 | 274 |
| 98 | 3300005614 | Ga0068856_100019270 | Ga0068856_1000192703 | 274 |
| 99 | 3300009551 | Ga0105238_10051939 | Ga0105238_100519393 | 274 |
| 100 | 3300015683 | Ga0183362_10001 | Ga0183362_10001153 | 274 |
| 101 | 3300021361 | Ga0213872_10015112 | Ga0213872_100151124 | 274 |
| 102 | 3300025303 | Ga0209051_1000317 | Ga0209051_100031738 | 274 |
| 103 | 3300025304 | Ga0209257_1000039 | Ga0209257_100003945 | 274 |
| 104 | 3300025321 | Ga0207656_10015773 | Ga0207656_100157732 | 274 |
| 105 | 3300025920 | Ga0207649_10122303 | Ga0207649_101223031 | 274 |
| 106 | 3300026078 | Ga0207702_10117862 | Ga0207702_101178622 | 274 |
| 107 | 3300031238 | Ga0265332_10000013 | Ga0265332_10000013180 | 274 |
| 108 | 3300031665 | Ga0316575_10000027 | Ga0316575_1000002732 | 274 |
| 109 | 3300038443 | Ga0395901_0053168 | Ga0395901_0053168_1081_2001 | 274 |
| 110 | 3300039447 | Ga0436361_0610098 | Ga0436361_0610098_3089_3973 | 274 |
| 111 | 3300039447 | Ga0436361_1043948 | Ga0436361_1043948_521_1405 | 274 |
| 112 | 3300044712 | Ga0453684_0375641 | Ga0453684_0375641_317_1198 | 274 |
| 113 | 3300048926 | Ga0496123_0117909 | Ga0496123_0117909_314_1273 | 274 |
| 114 | 3300053093 | Ga0500651_0031169 | Ga0500651_0031169_1169_2080 | 274 |
| 115 | 3300025273 | Ga0209673_1014451 | Ga0209673_10144513 | 275 |
| 116 | 3300037312 | Ga0395899_0007462 | Ga0395899_0007462_3537_4457 | 275 |
| 117 | 3300037466 | Ga0395898_0195450 | Ga0395898_0195450_976_1896 | 275 |
| 118 | 3300041404 | Ga0439436_0057432 | Ga0439436_0057432_122_1048 | 275 |
| 119 | 3300041408 | Ga0439453_0012463 | Ga0439453_0012463_413_1339 | 275 |
| 120 | 3300042156 | Ga0439446_0015610 | Ga0439446_0015610_613_1539 | 275 |
| 121 | 3300042439 | Ga0439464_0003813 | Ga0439464_0003813_250_1176 | 275 |
| 122 | 3300006847 | Ga0075431_100136272 | Ga0075431_1001362722 | 276 |
| 123 | 3300006847 | Ga0075431_100191219 | Ga0075431_1001912192 | 276 |
| 124 | 3300025294 | Ga0209025_1021665 | Ga0209025_10216652 | 276 |
| 125 | 3300028653 | Ga0265323_10008234 | Ga0265323_100082342 | 276 |
| 126 | 3300042876 | Ga0451577_0001963 | Ga0451577_0001963_23671_24558 | 276 |
| 127 | 3300042876 | Ga0451577_0040604 | Ga0451577_0040604_1242_2129 | 276 |
| 128 | 3300044684 | Ga0466966_0187531 | Ga0466966_0187531_289_1218 | 276 |
| 129 | 3300044712 | Ga0453684_0190658 | Ga0453684_0190658_1441_2328 | 276 |
| 130 | 3300045051 | Ga0451576_0003674 | Ga0451576_0003674_13578_14465 | 276 |
| 131 | 3300049581 | Ga0501047_0150124 | Ga0501047_0150124_673_1587 | 276 |
| 132 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004237 | 277 |
| 133 | iso_pu_bacteria | 2511231002 | 2511243933 | 277 |
| 134 | 3300005366 | Ga0070659_100100556 | Ga0070659_1001005562 | 278 |
| 135 | 3300005441 | Ga0070700_100026714 | Ga0070700_1000267144 | 278 |
| 136 | 3300005458 | Ga0070681_10008962 | Ga0070681_100089622 | 278 |
| 137 | 3300005530 | Ga0070679_100031482 | Ga0070679_1000314822 | 278 |
| 138 | 3300005577 | Ga0068857_100004780 | Ga0068857_1000047807 | 278 |
| 139 | 3300006195 | Ga0075366_10045562 | Ga0075366_100455622 | 278 |
| 140 | 3300009174 | Ga0105241_10004042 | Ga0105241_100040423 | 278 |
| 141 | 3300009174 | Ga0105241_10092763 | Ga0105241_100927632 | 278 |
| 142 | 3300009177 | Ga0105248_10033181 | Ga0105248_100331812 | 278 |
| 143 | 3300009545 | Ga0105237_10020797 | Ga0105237_100207973 | 278 |
| 144 | 3300010375 | Ga0105239_10111318 | Ga0105239_101113182 | 278 |
| 145 | 3300010375 | Ga0105239_10226339 | Ga0105239_102263393 | 278 |
| 146 | 3300011119 | Ga0105246_10276034 | Ga0105246_102760342 | 278 |
| 147 | 3300013297 | Ga0157378_10106355 | Ga0157378_101063554 | 278 |
| 148 | 3300013308 | Ga0157375_10066616 | Ga0157375_100666163 | 278 |
| 149 | 3300014325 | Ga0163163_10237872 | Ga0163163_102378722 | 278 |
| 150 | 3300014969 | Ga0157376_10015342 | Ga0157376_100153423 | 278 |
| 151 | 3300025912 | Ga0207707_10004059 | Ga0207707_100040596 | 278 |
| 152 | 3300025914 | Ga0207671_10030303 | Ga0207671_100303033 | 278 |
| 153 | 3300026116 | Ga0207674_10008485 | Ga0207674_100084857 | 278 |
| 154 | 3300027614 | Ga0209970_1001339 | Ga0209970_10013393 | 278 |
| 155 | 3300027876 | Ga0209974_10076487 | Ga0209974_100764872 | 278 |
| 156 | 3300049571 | Ga0501034_0153919 | Ga0501034_0153919_792_1691 | 278 |
| 157 | 3300049584 | Ga0501068_0001829 | Ga0501068_0001829_4177_5076 | 278 |
| 158 | 3300049590 | Ga0501074_0036860 | Ga0501074_0036860_1135_2034 | 278 |
| 159 | 3300049742 | Ga0501080_0052223 | Ga0501080_0052223_2030_2929 | 278 |
| 160 | 3300050493 | nmdc:mga0k408_683_c1 | nmdc:mga0k408_683_c1_6863_7786 | 278 |
| 161 | iso_pu_bacteria | 2547132374 | 2548499829 | 279 |
| 162 | iso_pu_bacteria | 2643221570 | 2643868068 | 279 |
| 163 | iso_pu_bacteria | 2643221596 | 2643993927 | 279 |
| 164 | iso_pu_bacteria | 2643221609 | 2644059630 | 279 |
| 165 | iso_pu_bacteria | 2643221611 | 2644074771 | 279 |
| 166 | iso_pu_bacteria | 2643221652 | 2644293679 | 279 |
| 167 | iso_pu_bacteria | 2643221717 | 2644644844 | 279 |
| 168 | iso_pu_bacteria | 2738543012 | 2739241162 | 279 |
| 169 | iso_pu_bacteria | 2816332133 | 2816473325 | 279 |
| 170 | iso_pu_bacteria | 2990710928 | 2990713573 | 279 |
| 171 | 3300002704 | JGI25155J39150_1000005 | JGI25155J39150_1000005181 | 280 |
| 172 | 3300002705 | JGI25156J39149_1000006 | JGI25156J39149_1000006181 | 280 |
| 173 | 3300002738 | JGI25154J39366_1000015 | JGI25154J39366_100001565 | 280 |
| 174 | 3300002741 | JGI25157J39369_1000111 | JGI25157J39369_10001112 | 280 |
| 175 | 3300002774 | JGI25150J39212_1002104 | JGI25150J39212_10021042 | 280 |
| 176 | 3300002987 | JGI25159J45721_1001885 | JGI25159J45721_10018859 | 280 |
| 177 | 3300003187 | JGI25151J46595_10003864 | JGI25151J46595_1000386410 | 280 |
| 178 | 3300003771 | Ga0055526_1012404 | Ga0055526_10124043 | 280 |
| 179 | 3300003771 | Ga0055526_1012696 | Ga0055526_10126963 | 280 |
| 180 | 3300003773 | Ga0055537_1000182 | Ga0055537_100018218 | 280 |
| 181 | 3300003775 | Ga0055524_1000107 | Ga0055524_100010714 | 280 |
| 182 | 3300003775 | Ga0055524_1000126 | Ga0055524_10001263 | 280 |
| 183 | 3300003781 | Ga0055536_1004968 | Ga0055536_10049682 | 280 |
| 184 | 3300003784 | Ga0055534_1001254 | Ga0055534_10012549 | 280 |
| 185 | 3300003790 | Ga0055528_1000606 | Ga0055528_100060617 | 280 |
| 186 | 3300003791 | Ga0055530_10000302 | Ga0055530_1000030229 | 280 |
| 187 | 3300003791 | Ga0055530_10000490 | Ga0055530_1000049010 | 280 |
| 188 | 3300003792 | Ga0055540_1000021 | Ga0055540_1000021116 | 280 |
| 189 | 3300003794 | Ga0055531_10001001 | Ga0055531_1000100119 | 280 |
| 190 | 3300005262 | Ga0065165_1008387 | Ga0065165_10083873 | 280 |
| 191 | 3300025206 | Ga0209435_100010 | Ga0209435_100010192 | 280 |
| 192 | 3300025245 | Ga0207425_1002648 | Ga0207425_10026485 | 280 |
| 193 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011950 | 280 |
| 194 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011581 | 280 |
| 195 | 3300025263 | Ga0209565_1000028 | Ga0209565_1000028279 | 280 |
| 196 | 3300025273 | Ga0209673_1000035 | Ga0209673_100003556 | 280 |
| 197 | 3300025284 | Ga0209130_1000112 | Ga0209130_100011250 | 280 |
| 198 | 3300025291 | Ga0209675_1000153 | Ga0209675_100015365 | 280 |
| 199 | 3300025292 | Ga0209676_1000069 | Ga0209676_1000069181 | 280 |
| 200 | 3300025294 | Ga0209025_1036681 | Ga0209025_10366812 | 280 |
| 201 | 3300025295 | Ga0209564_1000583 | Ga0209564_10005833 | 280 |
| 202 | 3300025295 | Ga0209564_1002659 | Ga0209564_100265916 | 280 |
| 203 | 3300025298 | Ga0209050_1000023 | Ga0209050_1000023356 | 280 |
| 204 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031073 | 280 |
| 205 | 3300025302 | Ga0207426_1002916 | Ga0207426_100291610 | 280 |
| 206 | 3300025303 | Ga0209051_1000017 | Ga0209051_1000017356 | 280 |
| 207 | 3300025304 | Ga0209257_1000041 | Ga0209257_1000041356 | 280 |
| 208 | 3300053088 | Ga0500644_0036302 | Ga0500644_0036302_295_1245 | 280 |
| 209 | 3300053094 | Ga0500566_0037777 | Ga0500566_0037777_123_1073 | 280 |
| 210 | 3300053117 | Ga0500593_000742 | Ga0500593_000742_7418_8368 | 280 |
| 211 | 3300055283 | Ga0500661_001583 | Ga0500661_001583_3319_4269 | 280 |
| 212 | 3300045051 | Ga0451576_0185290 | Ga0451576_0185290_977_1906 | 281 |
| 213 | 3300046529 | Ga0495652_0163711 | Ga0495652_0163711_241_1170 | 281 |
| 214 | iso_pu_bacteria | 2585428062 | 2587755443 | 281 |
| 215 | iso_pu_bacteria | 2643221644 | 2644248743 | 281 |
| 216 | iso_pu_bacteria | 2721755523 | 2722882129 | 281 |
| 217 | iso_pu_bacteria | 2839138175 | 2839142643 | 281 |
| 218 | iso_pu_bacteria | 2842718218 | 2842721462 | 281 |
| 219 | 3300005367 | Ga0070667_100068800 | Ga0070667_1000688003 | 282 |
| 220 | 3300005459 | Ga0068867_100054017 | Ga0068867_1000540173 | 282 |
| 221 | 3300006358 | Ga0068871_100384883 | Ga0068871_1003848832 | 282 |
| 222 | 3300009148 | Ga0105243_10312730 | Ga0105243_103127302 | 282 |
| 223 | 3300009545 | Ga0105237_10186992 | Ga0105237_101869921 | 282 |
| 224 | 3300013308 | Ga0157375_10045918 | Ga0157375_100459183 | 282 |
| 225 | 3300014497 | Ga0182008_10000207 | Ga0182008_100002072 | 282 |
| 226 | 3300025926 | Ga0207659_10016028 | Ga0207659_100160283 | 282 |
| 227 | 3300025931 | Ga0207644_10018554 | Ga0207644_100185543 | 282 |
| 228 | 3300025938 | Ga0207704_10082385 | Ga0207704_100823853 | 282 |
| 229 | 3300025940 | Ga0207691_10020447 | Ga0207691_100204477 | 282 |
| 230 | 3300025942 | Ga0207689_10008289 | Ga0207689_100082895 | 282 |
| 231 | 3300025986 | Ga0207658_10081464 | Ga0207658_100814643 | 282 |
| 232 | 3300026089 | Ga0207648_10009359 | Ga0207648_1000935910 | 282 |
| 233 | 3300027252 | Ga0209973_1009732 | Ga0209973_10097321 | 282 |
| 234 | 3300027876 | Ga0209974_10003264 | Ga0209974_100032642 | 282 |
| 235 | 3300031548 | Ga0307408_100000186 | Ga0307408_10000018614 | 282 |
| 236 | 3300031901 | Ga0307406_10002742 | Ga0307406_1000274210 | 282 |
| 237 | 3300046530 | Ga0495654_0002766 | Ga0495654_0002766_1489_2430 | 282 |
| 238 | 3300047472 | Ga0495686_0020831 | Ga0495686_0020831_811_1725 | 282 |
| 239 | 3300050496 | nmdc:mga07m45_36124_c1 | nmdc:mga07m45_36124_c1_1737_2639 | 282 |
| 240 | 3300053136 | Ga0500559_0056790 | Ga0500559_0056790_87_1019 | 282 |
| 241 | 3300002774 | JGI25150J39212_1001950 | JGI25150J39212_10019505 | 283 |
| 242 | 3300002987 | JGI25159J45721_1000135 | JGI25159J45721_100013529 | 283 |
| 243 | 3300003354 | JGI25160J50197_1000045 | JGI25160J50197_100004560 | 283 |
| 244 | 3300003374 | JGI25161J50226_1000008 | JGI25161J50226_1000008160 | 283 |
| 245 | 3300004625 | Ga0055543_1000318 | Ga0055543_100031833 | 283 |
| 246 | 3300005262 | Ga0065165_1023662 | Ga0065165_10236622 | 283 |
| 247 | 3300005262 | Ga0065165_1023663 | Ga0065165_10236632 | 283 |
| 248 | 3300005328 | Ga0070676_10215649 | Ga0070676_102156491 | 283 |
| 249 | 3300005457 | Ga0070662_100015503 | Ga0070662_1000155033 | 283 |
| 250 | 3300006058 | Ga0075432_10033074 | Ga0075432_100330742 | 283 |
| 251 | 3300006177 | Ga0075362_10024286 | Ga0075362_100242863 | 283 |
| 252 | 3300006195 | Ga0075366_10132460 | Ga0075366_101324603 | 283 |
| 253 | 3300006353 | Ga0075370_10002144 | Ga0075370_100021445 | 283 |
| 254 | 3300009148 | Ga0105243_10370442 | Ga0105243_103704422 | 283 |
| 255 | 3300009176 | Ga0105242_10001629 | Ga0105242_100016297 | 283 |
| 256 | 3300010375 | Ga0105239_10065333 | Ga0105239_100653334 | 283 |
| 257 | 3300025263 | Ga0209565_1000433 | Ga0209565_100043329 | 283 |
| 258 | 3300025284 | Ga0209130_1000186 | Ga0209130_100018613 | 283 |
| 259 | 3300025291 | Ga0209675_1008419 | Ga0209675_10084193 | 283 |
| 260 | 3300025294 | Ga0209025_1004787 | Ga0209025_10047875 | 283 |
| 261 | 3300025297 | Ga0209758_1002912 | Ga0209758_100291212 | 283 |
| 262 | 3300025298 | Ga0209050_1004606 | Ga0209050_10046062 | 283 |
| 263 | 3300025302 | Ga0207426_1000153 | Ga0207426_1000153111 | 283 |
| 264 | 3300027682 | Ga0209971_1009120 | Ga0209971_10091203 | 283 |
| 265 | 3300031238 | Ga0265332_10000009 | Ga0265332_10000009101 | 283 |
| 266 | 3300031456 | Ga0307513_10000015 | Ga0307513_1000001573 | 283 |
| 267 | 3300031730 | Ga0307516_10009209 | Ga0307516_1000920911 | 283 |
| 268 | 3300041451 | Ga0451791_1537883 | Ga0451791_1537883_205_1152 | 283 |
| 269 | 3300046542 | Ga0495597_0000505 | Ga0495597_0000505_25876_26832 | 283 |
| 270 | 3300049573 | Ga0501037_0097820 | Ga0501037_0097820_604_1572 | 283 |
| 271 | 3300049823 | Ga0501044_0197647 | Ga0501044_0197647_380_1348 | 283 |
| 272 | 3300050493 | nmdc:mga0k408_14455_c1 | nmdc:mga0k408_14455_c1_3325_4236 | 283 |
| 273 | 3300050493 | nmdc:mga0k408_166144_c1 | nmdc:mga0k408_166144_c1_317_1300 | 283 |
| 274 | 3300050496 | nmdc:mga07m45_3744_c1 | nmdc:mga07m45_3744_c1_4116_5027 | 283 |
| 275 | 3300053730 | Ga0500645_000855 | Ga0500645_000855_2264_3247 | 283 |
| 276 | 3300001979 | JGI24740J21852_10001708 | JGI24740J21852_100017088 | 284 |
| 277 | 3300005455 | Ga0070663_100002204 | Ga0070663_1000022043 | 284 |
| 278 | 3300005564 | Ga0070664_100027643 | Ga0070664_1000276433 | 284 |
| 279 | 3300006048 | Ga0075363_100029362 | Ga0075363_1000293623 | 284 |
| 280 | 3300006177 | Ga0075362_10045703 | Ga0075362_100457033 | 284 |
| 281 | 3300006178 | Ga0075367_10061222 | Ga0075367_100612223 | 284 |
| 282 | 3300013296 | Ga0157374_10038464 | Ga0157374_100384643 | 284 |
| 283 | 3300025907 | Ga0207645_10010381 | Ga0207645_100103811 | 284 |
| 284 | 3300027876 | Ga0209974_10000874 | Ga0209974_100008749 | 284 |
| 285 | 3300028794 | Ga0307515_10001727 | Ga0307515_100017276 | 284 |
| 286 | 3300028794 | Ga0307515_10030061 | Ga0307515_100300616 | 284 |
| 287 | 3300028794 | Ga0307515_10041599 | Ga0307515_100415997 | 284 |
| 288 | 3300031456 | Ga0307513_10031881 | Ga0307513_100318813 | 284 |
| 289 | 3300031507 | Ga0307509_10079394 | Ga0307509_100793942 | 284 |
| 290 | 3300031616 | Ga0307508_10000007 | Ga0307508_10000007173 | 284 |
| 291 | 3300031649 | Ga0307514_10007132 | Ga0307514_100071328 | 284 |
| 292 | 3300031730 | Ga0307516_10014861 | Ga0307516_100148619 | 284 |
| 293 | 3300036401 | Ga0373937_0027185 | Ga0373937_0027185_4132_5040 | 284 |
| 294 | 3300041452 | Ga0451793_1806592 | Ga0451793_1806592_746_1651 | 284 |
| 295 | 3300041456 | Ga0451795_0797898 | Ga0451795_0797898_221_1126 | 284 |
| 296 | 3300041491 | Ga0451833_0442280 | Ga0451833_0442280_79_984 | 284 |
| 297 | 3300042015 | Ga0439462_0004907 | Ga0439462_0004907_586_1599 | 284 |
| 298 | 3300042531 | Ga0450918_000104 | Ga0450918_000104_1467_2372 | 284 |
| 299 | 3300046512 | Ga0495610_0012778 | Ga0495610_0012778_2545_3450 | 284 |
| 300 | 3300046519 | Ga0495632_0016953 | Ga0495632_0016953_1523_2428 | 284 |
| 301 | 3300046660 | Ga0495625_0016606 | Ga0495625_0016606_1803_2708 | 284 |
| 302 | 3300046683 | Ga0495658_0078370 | Ga0495658_0078370_36_941 | 284 |
| 303 | 3300047472 | Ga0495686_0105451 | Ga0495686_0105451_751_1656 | 284 |
| 304 | 3300050494 | nmdc:mga06z11_44312_c1 | nmdc:mga06z11_44312_c1_349_1254 | 284 |
| 305 | 3300053088 | Ga0500644_0014472 | Ga0500644_0014472_1244_2149 | 284 |
| 306 | 3300053134 | Ga0500658_0012210 | Ga0500658_0012210_1439_2344 | 284 |
| 307 | iso_pu_bacteria | 2919704043 | 2919704332 | 284 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zp4-assembly1.cif.gz_G | sars-cov-2 nsp1 bound to a human 43s preinitiation ribosome complex - state 2 | 0.8221 | 1 | 62 |
| 6nf8-assembly1.cif.gz_L | structure of human mitochondrial translation initiation factor 3 bound to the small ribosomal subunit -class i | 0.7962 | 4 | 58 |
| 2eif-assembly1.cif.gz_A | eukaryotic translation initiation factor 5a from methanococcus jannaschii | 0.7833 | 6 | 61 |
| 7pnw-assembly1.cif.gz_J | mouse mitochondrial ribosome small subunit lacking m5u modification | 0.7744 | 2 | 58 |
| 8cai-assembly1.cif.gz_L | streptomycin and hygromycin b bound to the 30s body | 0.7726 | 2 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t9hA03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 | 0.9648 | 221 | 282 | 1.10.40.50 |
| 2rcnA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9177 | 6 | 62 | 2.40.50.140 |
| 2rcnA03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 | 0.9173 | 221 | 279 | 1.10.40.50 |
| 1t9hA03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 | 0.8702 | 221 | 282 | 1.10.40.50 |
| 2rcnA03 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Probable gtpase engc; domain 3 | 0.8638 | 221 | 279 | 1.10.40.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3QD92-F1-model_v4 | deleted | 0.96 | 1 | 87 |
|
| AF-I4Z580-F1-model_v4 | EngC GTPase domain-containing protein | 0.9213 | 1 | 130 |
GO:0003924
GO:0005525 GO:0005737 GO:0019843 GO:0042254 GO:0046872 |
| AF-A0A4Q3HVN2-F1-model_v4 | deleted | 0.9171 | 1 | 146 |
|
| AF-A0A1W6LBN1-F1-model_v4 | Small ribosomal subunit biogenesis GTPase RsgA (EC 3.6.1.-) | 0.9044 | 1 | 280 |
GO:0003924
GO:0005525 GO:0005737 GO:0019843 GO:0042274 GO:0046872 |
| AF-A0A6L5DAW3-F1-model_v4 | deleted | 0.8994 | 1 | 280 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar