F399043

General Info

Members Datasets Scaffolds Average Seq Length
307 228 280 364

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100004698|Ga0070714_1000046986
Length 420
Sequence MPHYDQNKDDKHEDSLPVNRRDNPADASAAPHKTAGQSMSGSTGQSAIRTQCQCEHDREVPEVDLLSPLTLRGVTLPNRIAMSPMCMYSAQGGFANDFHLVHLGSRAVGGVGLVMVEATAITPDGRISPADMGIWKDEHIEPLARIARFVEAQGAVPGIQLAHAGRKASCDMPWAGGRSLKTAAEGGWPVIGPSPLPFDTGDPVPTPLSAVEIEQCIDAWEAAARRALTAGFKVIELHAAHGYLMHQFLSPLSNHRTDEYGGSPENRMRLLLRVAGRLREIIPQQLPFFVRISATDWADGGWDIEQAVILAKELKALGVDLIDVSSGGTTPDARIPVARGYQIPFARRIRDEAGIRTGGVGLITDPRYADEIITSGQADLVFLGRELLREPYWAVKAQHFMEEEPAWPIQYGYAVKRRAK

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
4 2643221597 Microbacterium sp. Root180 Isolate Unclassified
5 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
6 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
7 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2739367700 Dyella sp. YR388 Isolate Unclassified
11 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
12 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
13 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
14 2884411467 Dyella sp. AD56 Isolate Rhizosphere
15 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
16 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
17 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
18 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
19 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
20 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
21 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
22 2928963466 Dyella japonica 1073 Isolate Unclassified
23 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
24 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
99 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
227 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
228 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.21
Metatranscriptomes 0
Isolates 8.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.98
Nodule 0.98
Rhizoplane 6.84
Rhizosphere 60.59
Stem 0
Stem Tuber 0
Unclassified 16.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000138 3300002737 Bacteria 78713
2 JGI25162J39368_1001926 3300002737 Bacteria 9418
3 JGI25157J39369_1000441 3300002741 Bacteria 26541
4 JGI25163J39215_1001476 3300002771 Bacteria 3803
5 JGI25164J39214_1000375 3300002772 Bacteria 26542
6 JGI25164J39214_1000548 3300002772 Bacteria 17287
7 JGI25152J39213_1000016 3300002773 Bacteria 110433
8 JGI25150J39212_1000003 3300002774 Bacteria 508651
9 JGI25150J39212_1000004 3300002774 Bacteria 417320
10 JGI25151J46595_10000002 3300003187 Bacteria 731381
11 JGI25165J46597_1000224 3300003214 Bacteria 78713
12 JGI25153J46596_10000015 3300003215 Bacteria 289820
13 rootL2_10058274 3300003322 Bacteria 12909
14 rootL2_10086611 3300003322 Bacteria 1573
15 Ga0055533_1001231 3300003756 Bacteria 7104
16 Ga0055535_1001013 3300003761 Bacteria 17885
17 Ga0055542_1000136 3300003762 Bacteria 93218
18 Ga0055542_1000179 3300003762 Bacteria 78713
19 Ga0055529_1000189 3300003763 Bacteria 84123
20 Ga0065165_1001279 3300005262 Bacteria 28419
21 Ga0065714_10028039 3300005288 Bacteria 1431
22 Ga0065714_10064558 3300005288 Bacteria 36374
23 Ga0070658_10006716 3300005327 Bacteria 9319
24 Ga0070658_10127591 3300005327 Bacteria 2118
25 Ga0070676_10010919 3300005328 Bacteria 4934
26 Ga0070690_100076895 3300005330 Bacteria 2178
27 Ga0070670_100047469 3300005331 Bacteria 3695
28 Ga0070670_100176575 3300005331 Bacteria 1854
29 Ga0070677_10032153 3300005333 Bacteria 2010
30 Ga0070666_10000003 3300005335 Bacteria 463666
31 Ga0070666_10149766 3300005335 Bacteria 1628
32 Ga0068868_100048172 3300005338 Bacteria 3342
33 Ga0068868_100098389 3300005338 Bacteria 2365
34 Ga0070689_100001969 3300005340 Bacteria 13326
35 Ga0070689_100057218 3300005340 Bacteria 3026
36 Ga0070687_100054701 3300005343 Bacteria 2081
37 Ga0070661_100025601 3300005344 Bacteria 4241
38 Ga0070669_100042608 3300005353 Bacteria 3303
39 Ga0070675_100021292 3300005354 Bacteria 5180
40 Ga0070675_100190391 3300005354 Bacteria 1777
41 Ga0070671_100013637 3300005355 Bacteria 6554
42 Ga0070671_100015039 3300005355 Bacteria 6250
43 Ga0070671_100119326 3300005355 Bacteria 2219
44 Ga0070673_100027150 3300005364 Bacteria 4241
45 Ga0070667_100039172 3300005367 Bacteria 3972
46 Ga0070667_100160405 3300005367 Bacteria 1980
47 Ga0070714_100004698 3300005435 Bacteria 10327
48 Ga0070701_10014951 3300005438 Bacteria 3571
49 Ga0070700_100076062 3300005441 Unclassified 2155
50 Ga0070663_100264110 3300005455 Bacteria 1366
51 Ga0070678_100010718 3300005456 Bacteria 5614
52 Ga0070678_100028019 3300005456 Unclassified 3835
53 Ga0070685_10045810 3300005466 Bacteria 2509
54 Ga0070672_100067339 3300005543 Bacteria 2837
55 Ga0070672_100091194 3300005543 Bacteria 2458
56 Ga0070686_100048988 3300005544 Bacteria 2679
57 Ga0070665_100001114 3300005548 Bacteria 33120
58 Ga0070665_100022792 3300005548 Bacteria 6304
59 Ga0070702_100085516 3300005615 Bacteria 1900
60 Ga0068864_100006602 3300005618 Bacteria 9495
61 Ga0068861_100320006 3300005719 Bacteria 1351
62 Ga0068863_100030121 3300005841 Bacteria 5183
63 Ga0068863_100256076 3300005841 Bacteria 1691
64 Ga0068858_100111246 3300005842 Bacteria 2558
65 Ga0068860_100184797 3300005843 Bacteria 2015
66 Ga0068862_100074596 3300005844 Bacteria 2932
67 Ga0068862_100093395 3300005844 Bacteria 2623
68 Ga0068862_100170238 3300005844 Bacteria 1950
69 Ga0070717_10110913 3300006028 Bacteria 2340
70 Ga0075365_10004848 3300006038 Bacteria 7185
71 Ga0075364_10021308 3300006051 Bacteria 4083
72 Ga0075364_10203566 3300006051 Bacteria 1342
73 Ga0075432_10001341 3300006058 Bacteria 7976
74 Ga0070712_100000001 3300006175 Bacteria 343916
75 Ga0079104_1000570 3300006946 Bacteria 37376
76 Ga0099826_10007095 3300006948 Bacteria 8228
77 Ga0099794_10003504 3300007265 Bacteria 6004
78 Ga0105240_10159304 3300009093 Bacteria 2683
79 Ga0111539_10017471 3300009094 Bacteria 8881
80 Ga0105245_10172280 3300009098 Bacteria 2062
81 Ga0105243_10135888 3300009148 Bacteria 2092
82 Ga0105248_10162892 3300009177 Bacteria 2515
83 Ga0105238_10001342 3300009551 Bacteria 24719
84 Ga0105238_10103636 3300009551 Bacteria 2826
85 Ga0157371_10000296 3300013102 Bacteria 66267
86 Ga0157371_10031303 3300013102 Bacteria 3832
87 Ga0157370_10011116 3300013104 Bacteria 9437
88 Ga0157369_10016956 3300013105 Bacteria 8185
89 Ga0157369_10214918 3300013105 Bacteria 2014
90 Ga0157374_10102240 3300013296 Bacteria 2748
91 Ga0157378_10008742 3300013297 Bacteria 8816
92 Ga0157378_10412980 3300013297 Bacteria 1332
93 Ga0163162_10000065 3300013306 Bacteria 102191
94 Ga0163162_10003166 3300013306 Bacteria 15729
95 Ga0157375_10008720 3300013308 Bacteria 8884
96 Ga0163163_10114937 3300014325 Bacteria 2723
97 Ga0163163_10459474 3300014325 Bacteria 1333
98 Ga0182008_10000167 3300014497 Bacteria 51397
99 Ga0157379_10034979 3300014968 Bacteria 4478
100 Ga0157379_10069812 3300014968 Bacteria 3143
101 Ga0157376_10087718 3300014969 Bacteria 2686
102 Ga0182006_1000351 3300015261 Bacteria 38720
103 Ga0182006_1019416 3300015261 Bacteria 2860
104 Ga0183373_1002 3300015682 Bacteria 990153
105 Ga0183368_1003 3300015687 Bacteria 1276390
106 Ga0213874_10002932 3300021377 Bacteria 3727
107 Ga0209435_102286 3300025206 Bacteria 2262
108 Ga0209435_106555 3300025206 Bacteria 1295
109 Ga0209760_100421 3300025207 Bacteria 10126
110 Ga0209784_100068 3300025224 Bacteria 152526
111 Ga0209566_105010 3300025225 Bacteria 1721
112 Ga0209674_100012 3300025226 Bacteria 950162
113 Ga0209672_101694 3300025228 Bacteria 7117
114 Ga0207427_100140 3300025231 Bacteria 84637
115 Ga0207427_100736 3300025231 Bacteria 15098
116 Ga0209437_100147 3300025233 Bacteria 161997
117 Ga0209437_101065 3300025233 Bacteria 8959
118 Ga0209437_104532 3300025233 Bacteria 2440
119 Ga0209258_100049 3300025242 Bacteria 358328
120 Ga0209258_101180 3300025242 Bacteria 10571
121 Ga0207425_1000003 3300025245 Bacteria 1145342
122 Ga0209646_1000134 3300025246 Bacteria 124492
123 Ga0209646_1000534 3300025246 Bacteria 16626
124 Ga0209026_1000099 3300025250 Bacteria 161750
125 Ga0209026_1003107 3300025250 Bacteria 5658
126 Ga0209148_1000002 3300025254 Bacteria 2399500
127 Ga0209148_1000010 3300025254 Bacteria 1265567
128 Ga0209759_1006253 3300025256 Bacteria 4033
129 Ga0209759_1009155 3300025256 Bacteria 3021
130 Ga0209129_1000014 3300025258 Bacteria 509018
131 Ga0209233_1000009 3300025261 Bacteria 1265567
132 Ga0209455_1000086 3300025272 Bacteria 244650
133 Ga0209455_1002424 3300025272 Bacteria 7218
134 Ga0209025_1000007 3300025294 Bacteria 1145109
135 Ga0209758_1000012 3300025297 Bacteria 949866
136 Ga0209758_1005069 3300025297 Bacteria 10438
137 Ga0207697_10038120 3300025315 Bacteria 1970
138 Ga0207682_10004020 3300025893 Bacteria 6257
139 Ga0207680_10000006 3300025903 Bacteria 635950
140 Ga0207645_10008822 3300025907 Bacteria 7006
141 Ga0207643_10017508 3300025908 Bacteria 3919
142 Ga0207705_10005875 3300025909 Bacteria 9131
143 Ga0207693_10000003 3300025915 Bacteria 245977
144 Ga0207662_10024471 3300025918 Bacteria 3474
145 Ga0207681_10044772 3300025923 Bacteria 2967
146 Ga0207694_10001494 3300025924 Bacteria 19968
147 Ga0207694_10147221 3300025924 Bacteria 1896
148 Ga0207650_10000719 3300025925 Bacteria 25725
149 Ga0207659_10121368 3300025926 Bacteria 2003
150 Ga0207664_10021344 3300025929 Bacteria 4812
151 Ga0207644_10051477 3300025931 Bacteria 2956
152 Ga0207644_10161215 3300025931 Bacteria 1743
153 Ga0207706_10056388 3300025933 Bacteria 3464
154 Ga0207709_10120122 3300025935 Bacteria 1773
155 Ga0207670_10003012 3300025936 Bacteria 8891
156 Ga0207704_10119759 3300025938 Bacteria 1799
157 Ga0207691_10052198 3300025940 Bacteria 3735
158 Ga0207711_10142512 3300025941 Bacteria 2157
159 Ga0207651_10016592 3300025960 Bacteria 4320
160 Ga0207651_10026192 3300025960 Bacteria 3638
161 Ga0207651_10087311 3300025960 Unclassified 2270
162 Ga0207668_10158036 3300025972 Bacteria 1763
163 Ga0207658_10080998 3300025986 Bacteria 2488
164 Ga0207703_10188218 3300026035 Bacteria 1826
165 Ga0207703_10313260 3300026035 Bacteria 1435
166 Ga0207678_10006312 3300026067 Bacteria 10527
167 Ga0207678_10071321 3300026067 Bacteria 2978
168 Ga0207678_10245344 3300026067 Bacteria 1534
169 Ga0207641_10012415 3300026088 Bacteria 6984
170 Ga0207648_10071772 3300026089 Bacteria 3018
171 Ga0207676_10001872 3300026095 Bacteria 15409
172 Ga0207675_100014661 3300026118 Bacteria 7309
173 Ga0207683_10003667 3300026121 Bacteria 13353
174 Ga0207683_10042187 3300026121 Bacteria 3984
175 Ga0209281_1000392 3300027111 Bacteria 68425
176 Ga0207428_10051127 3300027907 Bacteria 3304
177 Ga0268266_10000021 3300028379 Bacteria 522453
178 Ga0268266_10004254 3300028379 Bacteria 13770
179 Ga0268265_10067340 3300028380 Bacteria 2772
180 Ga0268264_10077977 3300028381 Bacteria 2823
181 Ga0268264_10102628 3300028381 Bacteria 2489
182 Ga0265340_10010886 3300031247 Bacteria 4853
183 Ga0265316_10080426 3300031344 Bacteria 2499
184 Ga0307408_100001580 3300031548 Bacteria 16814
185 Ga0265314_10130655 3300031711 Bacteria 1567
186 Ga0316576_10126445 3300031727 Bacteria 1921
187 Ga0307405_10080557 3300031731 Bacteria 2126
188 Ga0307413_10091387 3300031824 Bacteria 1983
189 Ga0307410_10000139 3300031852 Bacteria 25698
190 Ga0307410_10080791 3300031852 Bacteria 2282
191 Ga0307406_10000042 3300031901 Bacteria 72211
192 Ga0307406_10173374 3300031901 Bacteria 1563
193 Ga0307407_10001299 3300031903 Bacteria 8922
194 Ga0307412_10039739 3300031911 Bacteria 3040
195 Ga0307416_100000194 3300032002 Bacteria 32452
196 Ga0307414_10000022 3300032004 Bacteria 212123
197 Ga0307414_10151469 3300032004 Bacteria 1830
198 Ga0307510_10003097 3300033180 Bacteria 19232
199 Ga0307510_10062203 3300033180 Bacteria 3817
200 Ga0395901_0407588 3300038443 Bacteria 1396
201 Ga0436365_1675866 3300039437 Bacteria 1158
202 Ga0436361_0835627 3300039447 Bacteria 1487
203 Ga0436363_0386426 3300039450 Bacteria 19811
204 Ga0436363_1639024 3300039450 Bacteria 4122
205 Ga0439466_0008136 3300041411 Bacteria 3953
206 Ga0451577_0097705 3300042876 Bacteria 2623
207 Ga0466963_0055007 3300044694 Bacteria 2646
208 Ga0495638_0000213 3300046460 Bacteria 81547
209 Ga0495638_0001101 3300046460 Bacteria 26323
210 Ga0495650_0002413 3300046471 Bacteria 15207
211 Ga0495606_0001151 3300046507 Bacteria 37509
212 Ga0495610_0000048 3300046512 Bacteria 150249
213 Ga0495643_0000155 3300046522 Bacteria 111716
214 Ga0495644_0008353 3300046523 Bacteria 3989
215 Ga0495648_0002535 3300046524 Bacteria 16749
216 Ga0495597_0039336 3300046542 Bacteria 2118
217 Ga0495661_0042131 3300046665 Bacteria 2817
218 Ga0495647_0056731 3300046681 Bacteria 1536
219 Ga0495658_0020559 3300046683 Bacteria 3466
220 Ga0495649_0010636 3300046694 Bacteria 5419
221 Ga0496100_0052391 3300048903 Bacteria 2653
222 Ga0496104_0000357 3300048907 Bacteria 40808
223 Ga0496104_0011841 3300048907 Bacteria 7827
224 Ga0496105_0000118 3300048908 Bacteria 54166
225 Ga0496105_0002248 3300048908 Bacteria 13985
226 Ga0496108_0072767 3300048911 Bacteria 2902
227 Ga0496108_0111061 3300048911 Bacteria 2344
228 Ga0496109_0065581 3300048912 Bacteria 3324
229 Ga0496110_0008707 3300048913 Bacteria 8172
230 Ga0496111_0086689 3300048914 Bacteria 2291
231 Ga0496112_0002023 3300048915 Bacteria 16054
232 Ga0496112_0036713 3300048915 Bacteria 4780
233 Ga0496113_0031488 3300048916 Bacteria 3849
234 Ga0496113_0047971 3300048916 Bacteria 3176
235 Ga0496114_0034890 3300048917 Bacteria 4153
236 Ga0496114_0054755 3300048917 Bacteria 3326
237 Ga0496114_0286903 3300048917 Bacteria 1452
238 Ga0496115_0000341 3300048918 Bacteria 39503
239 Ga0496115_0024613 3300048918 Bacteria 4682
240 Ga0496115_0029113 3300048918 Bacteria 4335
241 Ga0496115_0214052 3300048918 Bacteria 1591
242 Ga0496116_0000002 3300048919 Bacteria 920291
243 Ga0496117_0015943 3300048920 Bacteria 6368
244 Ga0496118_0006936 3300048921 Bacteria 12250
245 Ga0496119_0001566 3300048922 Bacteria 27219
246 Ga0496119_0065962 3300048922 Bacteria 2141
247 Ga0496120_0005275 3300048923 Bacteria 10376
248 Ga0496121_0003083 3300048924 Bacteria 24135
249 Ga0496121_0068120 3300048924 Bacteria 2881
250 Ga0496121_0295158 3300048924 Bacteria 1102
251 Ga0496122_0000055 3300048925 Bacteria 258485
252 Ga0496122_0084061 3300048925 Bacteria 2204
253 Ga0496123_0000003 3300048926 Bacteria 866556
254 Ga0496124_0037445 3300048927 Bacteria 4218
255 Ga0496125_0000108 3300048928 Bacteria 196060
256 Ga0496125_0030275 3300048928 Bacteria 4845
257 Ga0496125_0031755 3300048928 Bacteria 4701
258 Ga0496126_0005445 3300048929 Bacteria 14518
259 Ga0496126_0020214 3300048929 Bacteria 6534
260 Ga0496126_0122507 3300048929 Bacteria 2253
261 Ga0496126_0184801 3300048929 Bacteria 1768
262 Ga0501032_0078991 3300049569 Bacteria 2190
263 Ga0501037_0026171 3300049573 Bacteria 4312
264 Ga0501037_0105585 3300049573 Bacteria 2030
265 Ga0501038_0108741 3300049574 Bacteria 2298
266 Ga0501039_0024228 3300049575 Bacteria 4660
267 Ga0501043_0109646 3300049579 Bacteria 2167
268 Ga0501047_0044474 3300049581 Bacteria 4291
269 Ga0501047_0137578 3300049581 Bacteria 2322
270 Ga0501070_0036095 3300049586 Bacteria 4128
271 Ga0501073_0155589 3300049589 Bacteria 1584
272 Ga0501223_000319 3300049663 Bacteria 11990
273 Ga0501249_000002 3300049679 Bacteria 262756
274 Ga0501035_0000375 3300049822 Bacteria 51358
275 Ga0501035_0008804 3300049822 Bacteria 9400
276 nmdc:mga00v17_30158_c1 3300050491 Bacteria 3189
277 Ga0495595_0110090 3300053084 Bacteria 1335
278 Ga0500641_0038765 3300053096 Bacteria 1916
279 Ga0500595_000988 3300053119 Bacteria 15955
280 Ga0500628_000690 3300053129 Bacteria 6064

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100000001 Ga0070712_100000001297 318
2 3300025915 Ga0207693_10000003 Ga0207693_1000000322 318
3 3300048911 Ga0496108_0111061 Ga0496108_0111061_248_1534 319
4 3300048912 Ga0496109_0065581 Ga0496109_0065581_217_1503 319
5 3300048917 Ga0496114_0054755 Ga0496114_0054755_1273_2559 319
6 3300048918 Ga0496115_0214052 Ga0496115_0214052_88_1374 319
7 3300039447 Ga0436361_0835627 Ga0436361_0835627_67_1200 321
8 3300053084 Ga0495595_0110090 Ga0495595_0110090_50_1183 323
9 3300039437 Ga0436365_1675866 Ga0436365_1675866_11_1147 326
10 3300048924 Ga0496121_0003083 Ga0496121_0003083_3874_4890 326
11 3300053119 Ga0500595_000988 Ga0500595_000988_5345_6361 326
12 3300025938 Ga0207704_10119759 Ga0207704_101197593 328
13 3300005355 Ga0070671_100013637 Ga0070671_1000136376 330
14 3300005842 Ga0068858_100111246 Ga0068858_1001112463 330
15 3300014325 Ga0163163_10114937 Ga0163163_101149372 330
16 3300014968 Ga0157379_10034979 Ga0157379_100349792 330
17 3300025931 Ga0207644_10161215 Ga0207644_101612152 330
18 3300026035 Ga0207703_10313260 Ga0207703_103132601 330
19 3300031247 Ga0265340_10010886 Ga0265340_100108863 330
20 3300048924 Ga0496121_0295158 Ga0496121_0295158_87_1079 330
21 3300048929 Ga0496126_0020214 Ga0496126_0020214_2519_3535 330
22 3300005438 Ga0070701_10014951 Ga0070701_100149513 335
23 3300009094 Ga0111539_10017471 Ga0111539_100174716 340
24 3300021377 Ga0213874_10002932 Ga0213874_100029322 341
25 3300039450 Ga0436363_0386426 Ga0436363_0386426_13730_14893 341
26 3300031727 Ga0316576_10126445 Ga0316576_101264452 342
27 3300049569 Ga0501032_0078991 Ga0501032_0078991_714_1940 346
28 3300049573 Ga0501037_0105585 Ga0501037_0105585_539_1777 346
29 3300049574 Ga0501038_0108741 Ga0501038_0108741_102_1340 346
30 3300049575 Ga0501039_0024228 Ga0501039_0024228_517_1755 346
31 3300049822 Ga0501035_0000375 Ga0501035_0000375_47681_48919 346
32 iso_pu_bacteria 2585428157 2588106725 346
33 iso_pu_bacteria 2643221597 2643996430 347
34 3300013297 Ga0157378_10412980 Ga0157378_104129802 348
35 3300048921 Ga0496118_0006936 Ga0496118_0006936_9240_10304 348
36 3300048923 Ga0496120_0005275 Ga0496120_0005275_5051_6115 348
37 3300048925 Ga0496122_0000055 Ga0496122_0000055_9325_10389 348
38 3300048926 Ga0496123_0000003 Ga0496123_0000003_626150_627214 348
39 iso_pu_bacteria 2739367700 2739731986 348
40 iso_pu_bacteria 2884411467 2884413876 348
41 iso_pu_bacteria 2928963466 2928964679 348
42 3300006038 Ga0075365_10004848 Ga0075365_100048482 349
43 3300006051 Ga0075364_10021308 Ga0075364_100213083 349
44 3300050491 nmdc:mga00v17_30158_c1 nmdc:mga00v17_30158_c1_1896_2960 349
45 iso_pu_bacteria 2643221681 2644454691 349
46 iso_pu_bacteria 2739367656 2739614804 349
47 iso_pu_bacteria 2739367663 2739646253 349
48 iso_pu_bacteria 2821136567 2821142499 349
49 iso_pu_bacteria 2904445276 2904447819 349
50 iso_pu_bacteria 2904467357 2904470333 349
51 iso_pu_bacteria 2929219909 2929221275 349
52 3300025297 Ga0209758_1005069 Ga0209758_10050695 350
53 3300031901 Ga0307406_10173374 Ga0307406_101733741 350
54 3300048913 Ga0496110_0008707 Ga0496110_0008707_6564_7628 350
55 3300048915 Ga0496112_0002023 Ga0496112_0002023_12648_13754 350
56 3300048922 Ga0496119_0001566 Ga0496119_0001566_25512_26585 350
57 iso_pu_bacteria 2513020052 2513234801 350
58 iso_pu_bacteria 2519899754 2520880598 350
59 iso_pu_bacteria 2643221600 2644012015 350
60 iso_pu_bacteria 2643221716 2644641289 350
61 iso_pu_bacteria 2816332280 2817414242 350
62 iso_pu_bacteria 2857613821 2857618210 350
63 iso_pu_bacteria 2887375801 2887376169 350
64 iso_pu_bacteria 2904419702 2904420283 350
65 iso_pu_bacteria 2919191525 2919192512 350
66 iso_pu_bacteria 2919683626 2919684086 350
67 iso_pu_bacteria 2958458903 2958459660 350
68 iso_pu_bacteria 8055419101 8055420003 350
69 iso_pu_bacteria 8055592153 8055596897 350
70 iso_pu_bacteria 8056440228 8056444281 350
71 3300005262 Ga0065165_1001279 Ga0065165_100127910 351
72 3300005288 Ga0065714_10028039 Ga0065714_100280392 351
73 3300009098 Ga0105245_10172280 Ga0105245_101722802 351
74 3300025246 Ga0209646_1000134 Ga0209646_100013474 351
75 3300039450 Ga0436363_1639024 Ga0436363_1639024_2430_3602 351
76 3300046523 Ga0495644_0008353 Ga0495644_0008353_2426_3505 351
77 3300048903 Ga0496100_0052391 Ga0496100_0052391_128_1240 351
78 3300048907 Ga0496104_0000357 Ga0496104_0000357_16083_17300 351
79 3300048907 Ga0496104_0011841 Ga0496104_0011841_5545_6738 351
80 3300048908 Ga0496105_0000118 Ga0496105_0000118_36867_38084 351
81 3300048908 Ga0496105_0002248 Ga0496105_0002248_7259_8452 351
82 3300048911 Ga0496108_0072767 Ga0496108_0072767_268_1380 351
83 3300048914 Ga0496111_0086689 Ga0496111_0086689_653_1765 351
84 3300048915 Ga0496112_0036713 Ga0496112_0036713_1926_3038 351
85 3300048916 Ga0496113_0031488 Ga0496113_0031488_2027_3139 351
86 3300048917 Ga0496114_0034890 Ga0496114_0034890_2761_3873 351
87 3300048918 Ga0496115_0024613 Ga0496115_0024613_1803_3020 351
88 3300048922 Ga0496119_0065962 Ga0496119_0065962_791_1984 351
89 3300048928 Ga0496125_0030275 Ga0496125_0030275_3458_4570 351
90 iso_pu_bacteria 2889415604 2889421688 351
91 3300002737 JGI25162J39368_1000138 JGI25162J39368_100013817 352
92 3300002737 JGI25162J39368_1001926 JGI25162J39368_10019268 352
93 3300002741 JGI25157J39369_1000441 JGI25157J39369_100044127 352
94 3300002771 JGI25163J39215_1001476 JGI25163J39215_10014763 352
95 3300002772 JGI25164J39214_1000375 JGI25164J39214_100037527 352
96 3300002772 JGI25164J39214_1000548 JGI25164J39214_100054817 352
97 3300002773 JGI25152J39213_1000016 JGI25152J39213_100001632 352
98 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003363 352
99 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004261 352
100 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002363 352
101 3300003214 JGI25165J46597_1000224 JGI25165J46597_100022467 352
102 3300003215 JGI25153J46596_10000015 JGI25153J46596_10000015174 352
103 3300003322 rootL2_10058274 rootL2_100582747 352
104 3300003322 rootL2_10086611 rootL2_100866111 352
105 3300003756 Ga0055533_1001231 Ga0055533_10012311 352
106 3300003761 Ga0055535_1001013 Ga0055535_100101317 352
107 3300003762 Ga0055542_1000136 Ga0055542_100013676 352
108 3300003762 Ga0055542_1000179 Ga0055542_100017967 352
109 3300003763 Ga0055529_1000189 Ga0055529_100018967 352
110 3300005288 Ga0065714_10064558 Ga0065714_1006455822 352
111 3300005327 Ga0070658_10006716 Ga0070658_100067164 352
112 3300005327 Ga0070658_10127591 Ga0070658_101275911 352
113 3300005328 Ga0070676_10010919 Ga0070676_100109194 352
114 3300005330 Ga0070690_100076895 Ga0070690_1000768952 352
115 3300005331 Ga0070670_100047469 Ga0070670_1000474695 352
116 3300005331 Ga0070670_100176575 Ga0070670_1001765752 352
117 3300005333 Ga0070677_10032153 Ga0070677_100321532 352
118 3300005335 Ga0070666_10000003 Ga0070666_10000003339 352
119 3300005335 Ga0070666_10149766 Ga0070666_101497662 352
120 3300005338 Ga0068868_100048172 Ga0068868_1000481722 352
121 3300005338 Ga0068868_100098389 Ga0068868_1000983893 352
122 3300005340 Ga0070689_100001969 Ga0070689_10000196915 352
123 3300005340 Ga0070689_100057218 Ga0070689_1000572182 352
124 3300005343 Ga0070687_100054701 Ga0070687_1000547012 352
125 3300005344 Ga0070661_100025601 Ga0070661_1000256012 352
126 3300005353 Ga0070669_100042608 Ga0070669_1000426082 352
127 3300005354 Ga0070675_100021292 Ga0070675_1000212926 352
128 3300005354 Ga0070675_100190391 Ga0070675_1001903913 352
129 3300005355 Ga0070671_100015039 Ga0070671_1000150392 352
130 3300005355 Ga0070671_100119326 Ga0070671_1001193262 352
131 3300005364 Ga0070673_100027150 Ga0070673_1000271502 352
132 3300005367 Ga0070667_100039172 Ga0070667_1000391724 352
133 3300005367 Ga0070667_100160405 Ga0070667_1001604052 352
134 3300005435 Ga0070714_100004698 Ga0070714_1000046986 352
135 3300005441 Ga0070700_100076062 Ga0070700_1000760621 352
136 3300005455 Ga0070663_100264110 Ga0070663_1002641102 352
137 3300005456 Ga0070678_100010718 Ga0070678_1000107183 352
138 3300005456 Ga0070678_100028019 Ga0070678_1000280193 352
139 3300005466 Ga0070685_10045810 Ga0070685_100458103 352
140 3300005543 Ga0070672_100067339 Ga0070672_1000673395 352
141 3300005543 Ga0070672_100091194 Ga0070672_1000911942 352
142 3300005544 Ga0070686_100048988 Ga0070686_1000489883 352
143 3300005548 Ga0070665_100001114 Ga0070665_1000011148 352
144 3300005548 Ga0070665_100022792 Ga0070665_1000227925 352
145 3300005615 Ga0070702_100085516 Ga0070702_1000855163 352
146 3300005618 Ga0068864_100006602 Ga0068864_1000066024 352
147 3300005719 Ga0068861_100320006 Ga0068861_1003200061 352
148 3300005841 Ga0068863_100030121 Ga0068863_1000301215 352
149 3300005841 Ga0068863_100256076 Ga0068863_1002560763 352
150 3300005843 Ga0068860_100184797 Ga0068860_1001847973 352
151 3300005844 Ga0068862_100074596 Ga0068862_1000745962 352
152 3300005844 Ga0068862_100093395 Ga0068862_1000933954 352
153 3300005844 Ga0068862_100170238 Ga0068862_1001702384 352
154 3300006028 Ga0070717_10110913 Ga0070717_101109132 352
155 3300006051 Ga0075364_10203566 Ga0075364_102035661 352
156 3300006058 Ga0075432_10001341 Ga0075432_100013414 352
157 3300006946 Ga0079104_1000570 Ga0079104_100057037 352
158 3300006948 Ga0099826_10007095 Ga0099826_100070954 352
159 3300007265 Ga0099794_10003504 Ga0099794_100035042 352
160 3300009093 Ga0105240_10159304 Ga0105240_101593043 352
161 3300009148 Ga0105243_10135888 Ga0105243_101358883 352
162 3300009177 Ga0105248_10162892 Ga0105248_101628922 352
163 3300009551 Ga0105238_10001342 Ga0105238_1000134216 352
164 3300009551 Ga0105238_10103636 Ga0105238_101036362 352
165 3300013102 Ga0157371_10000296 Ga0157371_1000029645 352
166 3300013102 Ga0157371_10031303 Ga0157371_100313034 352
167 3300013104 Ga0157370_10011116 Ga0157370_100111168 352
168 3300013105 Ga0157369_10016956 Ga0157369_100169565 352
169 3300013105 Ga0157369_10214918 Ga0157369_102149183 352
170 3300013296 Ga0157374_10102240 Ga0157374_101022403 352
171 3300013297 Ga0157378_10008742 Ga0157378_100087424 352
172 3300013306 Ga0163162_10000065 Ga0163162_1000006548 352
173 3300013306 Ga0163162_10003166 Ga0163162_1000316610 352
174 3300013308 Ga0157375_10008720 Ga0157375_100087205 352
175 3300014325 Ga0163163_10459474 Ga0163163_104594741 352
176 3300014497 Ga0182008_10000167 Ga0182008_100001673 352
177 3300014968 Ga0157379_10069812 Ga0157379_100698123 352
178 3300014969 Ga0157376_10087718 Ga0157376_100877182 352
179 3300015261 Ga0182006_1000351 Ga0182006_100035124 352
180 3300015261 Ga0182006_1019416 Ga0182006_10194161 352
181 3300015682 Ga0183373_1002 Ga0183373_1002633 352
182 3300015687 Ga0183368_1003 Ga0183368_1003820 352
183 3300025206 Ga0209435_102286 Ga0209435_1022862 352
184 3300025206 Ga0209435_106555 Ga0209435_1065552 352
185 3300025207 Ga0209760_100421 Ga0209760_1004217 352
186 3300025224 Ga0209784_100068 Ga0209784_10006867 352
187 3300025225 Ga0209566_105010 Ga0209566_1050101 352
188 3300025226 Ga0209674_100012 Ga0209674_100012573 352
189 3300025228 Ga0209672_101694 Ga0209672_1016945 352
190 3300025231 Ga0207427_100140 Ga0207427_10014067 352
191 3300025231 Ga0207427_100736 Ga0207427_10073616 352
192 3300025233 Ga0209437_100147 Ga0209437_100147104 352
193 3300025233 Ga0209437_101065 Ga0209437_1010659 352
194 3300025233 Ga0209437_104532 Ga0209437_1045321 352
195 3300025242 Ga0209258_100049 Ga0209258_1000494 352
196 3300025242 Ga0209258_101180 Ga0209258_1011804 352
197 3300025245 Ga0207425_1000003 Ga0207425_1000003482 352
198 3300025246 Ga0209646_1000534 Ga0209646_10005345 352
199 3300025250 Ga0209026_1000099 Ga0209026_100009967 352
200 3300025250 Ga0209026_1003107 Ga0209026_10031072 352
201 3300025254 Ga0209148_1000002 Ga0209148_10000021425 352
202 3300025254 Ga0209148_1000010 Ga0209148_10000101016 352
203 3300025256 Ga0209759_1006253 Ga0209759_10062535 352
204 3300025256 Ga0209759_1009155 Ga0209759_10091553 352
205 3300025258 Ga0209129_1000014 Ga0209129_1000014351 352
206 3300025261 Ga0209233_1000009 Ga0209233_1000009154 352
207 3300025272 Ga0209455_1000086 Ga0209455_1000086155 352
208 3300025272 Ga0209455_1002424 Ga0209455_10024246 352
209 3300025294 Ga0209025_1000007 Ga0209025_1000007481 352
210 3300025297 Ga0209758_1000012 Ga0209758_1000012482 352
211 3300025315 Ga0207697_10038120 Ga0207697_100381202 352
212 3300025893 Ga0207682_10004020 Ga0207682_100040205 352
213 3300025903 Ga0207680_10000006 Ga0207680_10000006486 352
214 3300025907 Ga0207645_10008822 Ga0207645_100088229 352
215 3300025908 Ga0207643_10017508 Ga0207643_100175081 352
216 3300025909 Ga0207705_10005875 Ga0207705_100058754 352
217 3300025918 Ga0207662_10024471 Ga0207662_100244712 352
218 3300025923 Ga0207681_10044772 Ga0207681_100447724 352
219 3300025924 Ga0207694_10001494 Ga0207694_1000149414 352
220 3300025924 Ga0207694_10147221 Ga0207694_101472212 352
221 3300025925 Ga0207650_10000719 Ga0207650_100007195 352
222 3300025926 Ga0207659_10121368 Ga0207659_101213682 352
223 3300025929 Ga0207664_10021344 Ga0207664_100213444 352
224 3300025931 Ga0207644_10051477 Ga0207644_100514775 352
225 3300025933 Ga0207706_10056388 Ga0207706_100563882 352
226 3300025935 Ga0207709_10120122 Ga0207709_101201222 352
227 3300025936 Ga0207670_10003012 Ga0207670_100030127 352
228 3300025940 Ga0207691_10052198 Ga0207691_100521982 352
229 3300025941 Ga0207711_10142512 Ga0207711_101425124 352
230 3300025960 Ga0207651_10016592 Ga0207651_100165925 352
231 3300025960 Ga0207651_10026192 Ga0207651_100261922 352
232 3300025960 Ga0207651_10087311 Ga0207651_100873111 352
233 3300025972 Ga0207668_10158036 Ga0207668_101580362 352
234 3300025986 Ga0207658_10080998 Ga0207658_100809982 352
235 3300026035 Ga0207703_10188218 Ga0207703_101882182 352
236 3300026067 Ga0207678_10006312 Ga0207678_100063129 352
237 3300026067 Ga0207678_10071321 Ga0207678_100713212 352
238 3300026067 Ga0207678_10245344 Ga0207678_102453442 352
239 3300026088 Ga0207641_10012415 Ga0207641_100124153 352
240 3300026089 Ga0207648_10071772 Ga0207648_100717724 352
241 3300026095 Ga0207676_10001872 Ga0207676_100018729 352
242 3300026118 Ga0207675_100014661 Ga0207675_1000146616 352
243 3300026121 Ga0207683_10003667 Ga0207683_100036675 352
244 3300026121 Ga0207683_10042187 Ga0207683_100421873 352
245 3300027111 Ga0209281_1000392 Ga0209281_100039245 352
246 3300027907 Ga0207428_10051127 Ga0207428_100511273 352
247 3300028379 Ga0268266_10000021 Ga0268266_10000021331 352
248 3300028379 Ga0268266_10004254 Ga0268266_100042548 352
249 3300028380 Ga0268265_10067340 Ga0268265_100673402 352
250 3300028381 Ga0268264_10077977 Ga0268264_100779772 352
251 3300028381 Ga0268264_10102628 Ga0268264_101026282 352
252 3300031344 Ga0265316_10080426 Ga0265316_100804262 352
253 3300031548 Ga0307408_100001580 Ga0307408_1000015805 352
254 3300031711 Ga0265314_10130655 Ga0265314_101306551 352
255 3300031731 Ga0307405_10080557 Ga0307405_100805572 352
256 3300031824 Ga0307413_10091387 Ga0307413_100913872 352
257 3300031852 Ga0307410_10000139 Ga0307410_100001392 352
258 3300031852 Ga0307410_10080791 Ga0307410_100807912 352
259 3300031901 Ga0307406_10000042 Ga0307406_1000004220 352
260 3300031903 Ga0307407_10001299 Ga0307407_100012992 352
261 3300031911 Ga0307412_10039739 Ga0307412_100397392 352
262 3300032002 Ga0307416_100000194 Ga0307416_10000019411 352
263 3300032004 Ga0307414_10000022 Ga0307414_10000022163 352
264 3300032004 Ga0307414_10151469 Ga0307414_101514691 352
265 3300033180 Ga0307510_10003097 Ga0307510_1000309714 352
266 3300033180 Ga0307510_10062203 Ga0307510_100622033 352
267 3300038443 Ga0395901_0407588 Ga0395901_0407588_94_1251 352
268 3300041411 Ga0439466_0008136 Ga0439466_0008136_2669_3739 352
269 3300042876 Ga0451577_0097705 Ga0451577_0097705_176_1243 352
270 3300044694 Ga0466963_0055007 Ga0466963_0055007_421_1488 352
271 3300046460 Ga0495638_0000213 Ga0495638_0000213_75675_76733 352
272 3300046460 Ga0495638_0001101 Ga0495638_0001101_1317_2375 352
273 3300046471 Ga0495650_0002413 Ga0495650_0002413_11364_12422 352
274 3300046507 Ga0495606_0001151 Ga0495606_0001151_5832_6890 352
275 3300046512 Ga0495610_0000048 Ga0495610_0000048_110675_111799 352
276 3300046522 Ga0495643_0000155 Ga0495643_0000155_74149_75225 352
277 3300046524 Ga0495648_0002535 Ga0495648_0002535_5900_7072 352
278 3300046542 Ga0495597_0039336 Ga0495597_0039336_940_1998 352
279 3300046665 Ga0495661_0042131 Ga0495661_0042131_1456_2628 352
280 3300046681 Ga0495647_0056731 Ga0495647_0056731_186_1328 352
281 3300046683 Ga0495658_0020559 Ga0495658_0020559_1295_2437 352
282 3300046694 Ga0495649_0010636 Ga0495649_0010636_1967_3025 352
283 3300048916 Ga0496113_0047971 Ga0496113_0047971_816_1874 352
284 3300048917 Ga0496114_0286903 Ga0496114_0286903_50_1108 352
285 3300048918 Ga0496115_0000341 Ga0496115_0000341_6831_7889 352
286 3300048918 Ga0496115_0029113 Ga0496115_0029113_1936_2994 352
287 3300048919 Ga0496116_0000002 Ga0496116_0000002_757876_758946 352
288 3300048920 Ga0496117_0015943 Ga0496117_0015943_4130_5200 352
289 3300048924 Ga0496121_0068120 Ga0496121_0068120_951_2009 352
290 3300048925 Ga0496122_0084061 Ga0496122_0084061_25_1083 352
291 3300048927 Ga0496124_0037445 Ga0496124_0037445_1288_2358 352
292 3300048928 Ga0496125_0000108 Ga0496125_0000108_149379_150449 352
293 3300048928 Ga0496125_0031755 Ga0496125_0031755_2687_3745 352
294 3300048929 Ga0496126_0005445 Ga0496126_0005445_2819_3889 352
295 3300048929 Ga0496126_0122507 Ga0496126_0122507_476_1534 352
296 3300048929 Ga0496126_0184801 Ga0496126_0184801_43_1101 352
297 3300049573 Ga0501037_0026171 Ga0501037_0026171_1228_2487 352
298 3300049579 Ga0501043_0109646 Ga0501043_0109646_660_1805 352
299 3300049581 Ga0501047_0044474 Ga0501047_0044474_2559_3818 352
300 3300049581 Ga0501047_0137578 Ga0501047_0137578_468_1679 352
301 3300049586 Ga0501070_0036095 Ga0501070_0036095_680_1939 352
302 3300049589 Ga0501073_0155589 Ga0501073_0155589_186_1349 352
303 3300049663 Ga0501223_000319 Ga0501223_000319_2685_3755 352
304 3300049679 Ga0501249_000002 Ga0501249_000002_127332_128405 352
305 3300049822 Ga0501035_0008804 Ga0501035_0008804_2527_3738 352
306 3300053096 Ga0500641_0038765 Ga0500641_0038765_92_1165 352
307 3300053129 Ga0500628_000690 Ga0500628_000690_4879_5952 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

64

404

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o0t-assembly2.cif.gz_D-2 crystal structure of chloroflexus aggregans ene-reductase caoye holoenzyme 0.9849 1 352
7o0t-assembly2.cif.gz_D-2 crystal structure of chloroflexus aggregans ene-reductase caoye holoenzyme 0.9821 1 352
8pun-assembly1.cif.gz_D old yellow enzyme from the thermophilic ferrovum sp. ja12 0.9808 2 352
3hf3-assembly1.cif.gz_D old yellow enzyme from thermus scotoductus sa-01 0.9796 1 352
1z41-assembly1.cif.gz_A crystal structure of oxidized yqjm from bacillus subtilis 0.9794 2 352
ID Description Score Start End Superfamily
af_Q54K64_32_404_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9862 2 350 3.20.20.70
af_O94467_31_394_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9835 1 351 3.20.20.70
af_O94467_31_394_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.978 1 351 3.20.20.70
5ocsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9767 3 352 3.20.20.70
af_Q54JW3_30_435_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9766 2 348 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7R9Q813-F1-model_v4 NADH:flavin oxidoreductase/NADH oxidase N-terminal domain-containing protein 0.9922 2 246 GO:0003959
GO:0010181
GO:0050661
AF-A0A3M5B811-F1-model_v4 deleted 0.9911 2 216
AF-A0A7Y8KBU0-F1-model_v4 Oxidoreductase 0.9905 1 111 GO:0003959
GO:0010181
GO:0050661
AF-A0A840RRB5-F1-model_v4 2,4-dienoyl-CoA reductase-like NADH-dependent reductase (Old Yellow Enzyme family) 0.9889 2 352 GO:0003959
GO:0010181
GO:0050661
AF-A0A6I4I0G1-F1-model_v4 NADPH dehydrogenase NamA (EC 1.6.99.1) 0.9878 2 352 GO:0003959
GO:0010181
GO:0050661

Feature Viewer

pLDDT pTM Quality
95.31 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map