F399043
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 228 | 280 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100004698|Ga0070714_1000046986 |
| Length | 420 |
| Sequence | MPHYDQNKDDKHEDSLPVNRRDNPADASAAPHKTAGQSMSGSTGQSAIRTQCQCEHDREVPEVDLLSPLTLRGVTLPNRIAMSPMCMYSAQGGFANDFHLVHLGSRAVGGVGLVMVEATAITPDGRISPADMGIWKDEHIEPLARIARFVEAQGAVPGIQLAHAGRKASCDMPWAGGRSLKTAAEGGWPVIGPSPLPFDTGDPVPTPLSAVEIEQCIDAWEAAARRALTAGFKVIELHAAHGYLMHQFLSPLSNHRTDEYGGSPENRMRLLLRVAGRLREIIPQQLPFFVRISATDWADGGWDIEQAVILAKELKALGVDLIDVSSGGTTPDARIPVARGYQIPFARRIRDEAGIRTGGVGLITDPRYADEIITSGQADLVFLGRELLREPYWAVKAQHFMEEEPAWPIQYGYAVKRRAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 4 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 5 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 6 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 7 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 8 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 9 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 10 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 11 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 12 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 13 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 14 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 15 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 16 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 17 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 18 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 19 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 20 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 21 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 22 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 23 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 24 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 28 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 78 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 99 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 203 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 204 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 205 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 206 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 207 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 208 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 209 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 210 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 226 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 227 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 228 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.21 |
| Metatranscriptomes | 0 |
| Isolates | 8.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.98 |
| Nodule | 0.98 |
| Rhizoplane | 6.84 |
| Rhizosphere | 60.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000138 | 3300002737 | Bacteria | 78713 |
| 2 | JGI25162J39368_1001926 | 3300002737 | Bacteria | 9418 |
| 3 | JGI25157J39369_1000441 | 3300002741 | Bacteria | 26541 |
| 4 | JGI25163J39215_1001476 | 3300002771 | Bacteria | 3803 |
| 5 | JGI25164J39214_1000375 | 3300002772 | Bacteria | 26542 |
| 6 | JGI25164J39214_1000548 | 3300002772 | Bacteria | 17287 |
| 7 | JGI25152J39213_1000016 | 3300002773 | Bacteria | 110433 |
| 8 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 9 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 10 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 11 | JGI25165J46597_1000224 | 3300003214 | Bacteria | 78713 |
| 12 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 13 | rootL2_10058274 | 3300003322 | Bacteria | 12909 |
| 14 | rootL2_10086611 | 3300003322 | Bacteria | 1573 |
| 15 | Ga0055533_1001231 | 3300003756 | Bacteria | 7104 |
| 16 | Ga0055535_1001013 | 3300003761 | Bacteria | 17885 |
| 17 | Ga0055542_1000136 | 3300003762 | Bacteria | 93218 |
| 18 | Ga0055542_1000179 | 3300003762 | Bacteria | 78713 |
| 19 | Ga0055529_1000189 | 3300003763 | Bacteria | 84123 |
| 20 | Ga0065165_1001279 | 3300005262 | Bacteria | 28419 |
| 21 | Ga0065714_10028039 | 3300005288 | Bacteria | 1431 |
| 22 | Ga0065714_10064558 | 3300005288 | Bacteria | 36374 |
| 23 | Ga0070658_10006716 | 3300005327 | Bacteria | 9319 |
| 24 | Ga0070658_10127591 | 3300005327 | Bacteria | 2118 |
| 25 | Ga0070676_10010919 | 3300005328 | Bacteria | 4934 |
| 26 | Ga0070690_100076895 | 3300005330 | Bacteria | 2178 |
| 27 | Ga0070670_100047469 | 3300005331 | Bacteria | 3695 |
| 28 | Ga0070670_100176575 | 3300005331 | Bacteria | 1854 |
| 29 | Ga0070677_10032153 | 3300005333 | Bacteria | 2010 |
| 30 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 31 | Ga0070666_10149766 | 3300005335 | Bacteria | 1628 |
| 32 | Ga0068868_100048172 | 3300005338 | Bacteria | 3342 |
| 33 | Ga0068868_100098389 | 3300005338 | Bacteria | 2365 |
| 34 | Ga0070689_100001969 | 3300005340 | Bacteria | 13326 |
| 35 | Ga0070689_100057218 | 3300005340 | Bacteria | 3026 |
| 36 | Ga0070687_100054701 | 3300005343 | Bacteria | 2081 |
| 37 | Ga0070661_100025601 | 3300005344 | Bacteria | 4241 |
| 38 | Ga0070669_100042608 | 3300005353 | Bacteria | 3303 |
| 39 | Ga0070675_100021292 | 3300005354 | Bacteria | 5180 |
| 40 | Ga0070675_100190391 | 3300005354 | Bacteria | 1777 |
| 41 | Ga0070671_100013637 | 3300005355 | Bacteria | 6554 |
| 42 | Ga0070671_100015039 | 3300005355 | Bacteria | 6250 |
| 43 | Ga0070671_100119326 | 3300005355 | Bacteria | 2219 |
| 44 | Ga0070673_100027150 | 3300005364 | Bacteria | 4241 |
| 45 | Ga0070667_100039172 | 3300005367 | Bacteria | 3972 |
| 46 | Ga0070667_100160405 | 3300005367 | Bacteria | 1980 |
| 47 | Ga0070714_100004698 | 3300005435 | Bacteria | 10327 |
| 48 | Ga0070701_10014951 | 3300005438 | Bacteria | 3571 |
| 49 | Ga0070700_100076062 | 3300005441 | Unclassified | 2155 |
| 50 | Ga0070663_100264110 | 3300005455 | Bacteria | 1366 |
| 51 | Ga0070678_100010718 | 3300005456 | Bacteria | 5614 |
| 52 | Ga0070678_100028019 | 3300005456 | Unclassified | 3835 |
| 53 | Ga0070685_10045810 | 3300005466 | Bacteria | 2509 |
| 54 | Ga0070672_100067339 | 3300005543 | Bacteria | 2837 |
| 55 | Ga0070672_100091194 | 3300005543 | Bacteria | 2458 |
| 56 | Ga0070686_100048988 | 3300005544 | Bacteria | 2679 |
| 57 | Ga0070665_100001114 | 3300005548 | Bacteria | 33120 |
| 58 | Ga0070665_100022792 | 3300005548 | Bacteria | 6304 |
| 59 | Ga0070702_100085516 | 3300005615 | Bacteria | 1900 |
| 60 | Ga0068864_100006602 | 3300005618 | Bacteria | 9495 |
| 61 | Ga0068861_100320006 | 3300005719 | Bacteria | 1351 |
| 62 | Ga0068863_100030121 | 3300005841 | Bacteria | 5183 |
| 63 | Ga0068863_100256076 | 3300005841 | Bacteria | 1691 |
| 64 | Ga0068858_100111246 | 3300005842 | Bacteria | 2558 |
| 65 | Ga0068860_100184797 | 3300005843 | Bacteria | 2015 |
| 66 | Ga0068862_100074596 | 3300005844 | Bacteria | 2932 |
| 67 | Ga0068862_100093395 | 3300005844 | Bacteria | 2623 |
| 68 | Ga0068862_100170238 | 3300005844 | Bacteria | 1950 |
| 69 | Ga0070717_10110913 | 3300006028 | Bacteria | 2340 |
| 70 | Ga0075365_10004848 | 3300006038 | Bacteria | 7185 |
| 71 | Ga0075364_10021308 | 3300006051 | Bacteria | 4083 |
| 72 | Ga0075364_10203566 | 3300006051 | Bacteria | 1342 |
| 73 | Ga0075432_10001341 | 3300006058 | Bacteria | 7976 |
| 74 | Ga0070712_100000001 | 3300006175 | Bacteria | 343916 |
| 75 | Ga0079104_1000570 | 3300006946 | Bacteria | 37376 |
| 76 | Ga0099826_10007095 | 3300006948 | Bacteria | 8228 |
| 77 | Ga0099794_10003504 | 3300007265 | Bacteria | 6004 |
| 78 | Ga0105240_10159304 | 3300009093 | Bacteria | 2683 |
| 79 | Ga0111539_10017471 | 3300009094 | Bacteria | 8881 |
| 80 | Ga0105245_10172280 | 3300009098 | Bacteria | 2062 |
| 81 | Ga0105243_10135888 | 3300009148 | Bacteria | 2092 |
| 82 | Ga0105248_10162892 | 3300009177 | Bacteria | 2515 |
| 83 | Ga0105238_10001342 | 3300009551 | Bacteria | 24719 |
| 84 | Ga0105238_10103636 | 3300009551 | Bacteria | 2826 |
| 85 | Ga0157371_10000296 | 3300013102 | Bacteria | 66267 |
| 86 | Ga0157371_10031303 | 3300013102 | Bacteria | 3832 |
| 87 | Ga0157370_10011116 | 3300013104 | Bacteria | 9437 |
| 88 | Ga0157369_10016956 | 3300013105 | Bacteria | 8185 |
| 89 | Ga0157369_10214918 | 3300013105 | Bacteria | 2014 |
| 90 | Ga0157374_10102240 | 3300013296 | Bacteria | 2748 |
| 91 | Ga0157378_10008742 | 3300013297 | Bacteria | 8816 |
| 92 | Ga0157378_10412980 | 3300013297 | Bacteria | 1332 |
| 93 | Ga0163162_10000065 | 3300013306 | Bacteria | 102191 |
| 94 | Ga0163162_10003166 | 3300013306 | Bacteria | 15729 |
| 95 | Ga0157375_10008720 | 3300013308 | Bacteria | 8884 |
| 96 | Ga0163163_10114937 | 3300014325 | Bacteria | 2723 |
| 97 | Ga0163163_10459474 | 3300014325 | Bacteria | 1333 |
| 98 | Ga0182008_10000167 | 3300014497 | Bacteria | 51397 |
| 99 | Ga0157379_10034979 | 3300014968 | Bacteria | 4478 |
| 100 | Ga0157379_10069812 | 3300014968 | Bacteria | 3143 |
| 101 | Ga0157376_10087718 | 3300014969 | Bacteria | 2686 |
| 102 | Ga0182006_1000351 | 3300015261 | Bacteria | 38720 |
| 103 | Ga0182006_1019416 | 3300015261 | Bacteria | 2860 |
| 104 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 105 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 106 | Ga0213874_10002932 | 3300021377 | Bacteria | 3727 |
| 107 | Ga0209435_102286 | 3300025206 | Bacteria | 2262 |
| 108 | Ga0209435_106555 | 3300025206 | Bacteria | 1295 |
| 109 | Ga0209760_100421 | 3300025207 | Bacteria | 10126 |
| 110 | Ga0209784_100068 | 3300025224 | Bacteria | 152526 |
| 111 | Ga0209566_105010 | 3300025225 | Bacteria | 1721 |
| 112 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 113 | Ga0209672_101694 | 3300025228 | Bacteria | 7117 |
| 114 | Ga0207427_100140 | 3300025231 | Bacteria | 84637 |
| 115 | Ga0207427_100736 | 3300025231 | Bacteria | 15098 |
| 116 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 117 | Ga0209437_101065 | 3300025233 | Bacteria | 8959 |
| 118 | Ga0209437_104532 | 3300025233 | Bacteria | 2440 |
| 119 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 120 | Ga0209258_101180 | 3300025242 | Bacteria | 10571 |
| 121 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 122 | Ga0209646_1000134 | 3300025246 | Bacteria | 124492 |
| 123 | Ga0209646_1000534 | 3300025246 | Bacteria | 16626 |
| 124 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 125 | Ga0209026_1003107 | 3300025250 | Bacteria | 5658 |
| 126 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 127 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 128 | Ga0209759_1006253 | 3300025256 | Bacteria | 4033 |
| 129 | Ga0209759_1009155 | 3300025256 | Bacteria | 3021 |
| 130 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 131 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 132 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 133 | Ga0209455_1002424 | 3300025272 | Bacteria | 7218 |
| 134 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 135 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 136 | Ga0209758_1005069 | 3300025297 | Bacteria | 10438 |
| 137 | Ga0207697_10038120 | 3300025315 | Bacteria | 1970 |
| 138 | Ga0207682_10004020 | 3300025893 | Bacteria | 6257 |
| 139 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 140 | Ga0207645_10008822 | 3300025907 | Bacteria | 7006 |
| 141 | Ga0207643_10017508 | 3300025908 | Bacteria | 3919 |
| 142 | Ga0207705_10005875 | 3300025909 | Bacteria | 9131 |
| 143 | Ga0207693_10000003 | 3300025915 | Bacteria | 245977 |
| 144 | Ga0207662_10024471 | 3300025918 | Bacteria | 3474 |
| 145 | Ga0207681_10044772 | 3300025923 | Bacteria | 2967 |
| 146 | Ga0207694_10001494 | 3300025924 | Bacteria | 19968 |
| 147 | Ga0207694_10147221 | 3300025924 | Bacteria | 1896 |
| 148 | Ga0207650_10000719 | 3300025925 | Bacteria | 25725 |
| 149 | Ga0207659_10121368 | 3300025926 | Bacteria | 2003 |
| 150 | Ga0207664_10021344 | 3300025929 | Bacteria | 4812 |
| 151 | Ga0207644_10051477 | 3300025931 | Bacteria | 2956 |
| 152 | Ga0207644_10161215 | 3300025931 | Bacteria | 1743 |
| 153 | Ga0207706_10056388 | 3300025933 | Bacteria | 3464 |
| 154 | Ga0207709_10120122 | 3300025935 | Bacteria | 1773 |
| 155 | Ga0207670_10003012 | 3300025936 | Bacteria | 8891 |
| 156 | Ga0207704_10119759 | 3300025938 | Bacteria | 1799 |
| 157 | Ga0207691_10052198 | 3300025940 | Bacteria | 3735 |
| 158 | Ga0207711_10142512 | 3300025941 | Bacteria | 2157 |
| 159 | Ga0207651_10016592 | 3300025960 | Bacteria | 4320 |
| 160 | Ga0207651_10026192 | 3300025960 | Bacteria | 3638 |
| 161 | Ga0207651_10087311 | 3300025960 | Unclassified | 2270 |
| 162 | Ga0207668_10158036 | 3300025972 | Bacteria | 1763 |
| 163 | Ga0207658_10080998 | 3300025986 | Bacteria | 2488 |
| 164 | Ga0207703_10188218 | 3300026035 | Bacteria | 1826 |
| 165 | Ga0207703_10313260 | 3300026035 | Bacteria | 1435 |
| 166 | Ga0207678_10006312 | 3300026067 | Bacteria | 10527 |
| 167 | Ga0207678_10071321 | 3300026067 | Bacteria | 2978 |
| 168 | Ga0207678_10245344 | 3300026067 | Bacteria | 1534 |
| 169 | Ga0207641_10012415 | 3300026088 | Bacteria | 6984 |
| 170 | Ga0207648_10071772 | 3300026089 | Bacteria | 3018 |
| 171 | Ga0207676_10001872 | 3300026095 | Bacteria | 15409 |
| 172 | Ga0207675_100014661 | 3300026118 | Bacteria | 7309 |
| 173 | Ga0207683_10003667 | 3300026121 | Bacteria | 13353 |
| 174 | Ga0207683_10042187 | 3300026121 | Bacteria | 3984 |
| 175 | Ga0209281_1000392 | 3300027111 | Bacteria | 68425 |
| 176 | Ga0207428_10051127 | 3300027907 | Bacteria | 3304 |
| 177 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 178 | Ga0268266_10004254 | 3300028379 | Bacteria | 13770 |
| 179 | Ga0268265_10067340 | 3300028380 | Bacteria | 2772 |
| 180 | Ga0268264_10077977 | 3300028381 | Bacteria | 2823 |
| 181 | Ga0268264_10102628 | 3300028381 | Bacteria | 2489 |
| 182 | Ga0265340_10010886 | 3300031247 | Bacteria | 4853 |
| 183 | Ga0265316_10080426 | 3300031344 | Bacteria | 2499 |
| 184 | Ga0307408_100001580 | 3300031548 | Bacteria | 16814 |
| 185 | Ga0265314_10130655 | 3300031711 | Bacteria | 1567 |
| 186 | Ga0316576_10126445 | 3300031727 | Bacteria | 1921 |
| 187 | Ga0307405_10080557 | 3300031731 | Bacteria | 2126 |
| 188 | Ga0307413_10091387 | 3300031824 | Bacteria | 1983 |
| 189 | Ga0307410_10000139 | 3300031852 | Bacteria | 25698 |
| 190 | Ga0307410_10080791 | 3300031852 | Bacteria | 2282 |
| 191 | Ga0307406_10000042 | 3300031901 | Bacteria | 72211 |
| 192 | Ga0307406_10173374 | 3300031901 | Bacteria | 1563 |
| 193 | Ga0307407_10001299 | 3300031903 | Bacteria | 8922 |
| 194 | Ga0307412_10039739 | 3300031911 | Bacteria | 3040 |
| 195 | Ga0307416_100000194 | 3300032002 | Bacteria | 32452 |
| 196 | Ga0307414_10000022 | 3300032004 | Bacteria | 212123 |
| 197 | Ga0307414_10151469 | 3300032004 | Bacteria | 1830 |
| 198 | Ga0307510_10003097 | 3300033180 | Bacteria | 19232 |
| 199 | Ga0307510_10062203 | 3300033180 | Bacteria | 3817 |
| 200 | Ga0395901_0407588 | 3300038443 | Bacteria | 1396 |
| 201 | Ga0436365_1675866 | 3300039437 | Bacteria | 1158 |
| 202 | Ga0436361_0835627 | 3300039447 | Bacteria | 1487 |
| 203 | Ga0436363_0386426 | 3300039450 | Bacteria | 19811 |
| 204 | Ga0436363_1639024 | 3300039450 | Bacteria | 4122 |
| 205 | Ga0439466_0008136 | 3300041411 | Bacteria | 3953 |
| 206 | Ga0451577_0097705 | 3300042876 | Bacteria | 2623 |
| 207 | Ga0466963_0055007 | 3300044694 | Bacteria | 2646 |
| 208 | Ga0495638_0000213 | 3300046460 | Bacteria | 81547 |
| 209 | Ga0495638_0001101 | 3300046460 | Bacteria | 26323 |
| 210 | Ga0495650_0002413 | 3300046471 | Bacteria | 15207 |
| 211 | Ga0495606_0001151 | 3300046507 | Bacteria | 37509 |
| 212 | Ga0495610_0000048 | 3300046512 | Bacteria | 150249 |
| 213 | Ga0495643_0000155 | 3300046522 | Bacteria | 111716 |
| 214 | Ga0495644_0008353 | 3300046523 | Bacteria | 3989 |
| 215 | Ga0495648_0002535 | 3300046524 | Bacteria | 16749 |
| 216 | Ga0495597_0039336 | 3300046542 | Bacteria | 2118 |
| 217 | Ga0495661_0042131 | 3300046665 | Bacteria | 2817 |
| 218 | Ga0495647_0056731 | 3300046681 | Bacteria | 1536 |
| 219 | Ga0495658_0020559 | 3300046683 | Bacteria | 3466 |
| 220 | Ga0495649_0010636 | 3300046694 | Bacteria | 5419 |
| 221 | Ga0496100_0052391 | 3300048903 | Bacteria | 2653 |
| 222 | Ga0496104_0000357 | 3300048907 | Bacteria | 40808 |
| 223 | Ga0496104_0011841 | 3300048907 | Bacteria | 7827 |
| 224 | Ga0496105_0000118 | 3300048908 | Bacteria | 54166 |
| 225 | Ga0496105_0002248 | 3300048908 | Bacteria | 13985 |
| 226 | Ga0496108_0072767 | 3300048911 | Bacteria | 2902 |
| 227 | Ga0496108_0111061 | 3300048911 | Bacteria | 2344 |
| 228 | Ga0496109_0065581 | 3300048912 | Bacteria | 3324 |
| 229 | Ga0496110_0008707 | 3300048913 | Bacteria | 8172 |
| 230 | Ga0496111_0086689 | 3300048914 | Bacteria | 2291 |
| 231 | Ga0496112_0002023 | 3300048915 | Bacteria | 16054 |
| 232 | Ga0496112_0036713 | 3300048915 | Bacteria | 4780 |
| 233 | Ga0496113_0031488 | 3300048916 | Bacteria | 3849 |
| 234 | Ga0496113_0047971 | 3300048916 | Bacteria | 3176 |
| 235 | Ga0496114_0034890 | 3300048917 | Bacteria | 4153 |
| 236 | Ga0496114_0054755 | 3300048917 | Bacteria | 3326 |
| 237 | Ga0496114_0286903 | 3300048917 | Bacteria | 1452 |
| 238 | Ga0496115_0000341 | 3300048918 | Bacteria | 39503 |
| 239 | Ga0496115_0024613 | 3300048918 | Bacteria | 4682 |
| 240 | Ga0496115_0029113 | 3300048918 | Bacteria | 4335 |
| 241 | Ga0496115_0214052 | 3300048918 | Bacteria | 1591 |
| 242 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 243 | Ga0496117_0015943 | 3300048920 | Bacteria | 6368 |
| 244 | Ga0496118_0006936 | 3300048921 | Bacteria | 12250 |
| 245 | Ga0496119_0001566 | 3300048922 | Bacteria | 27219 |
| 246 | Ga0496119_0065962 | 3300048922 | Bacteria | 2141 |
| 247 | Ga0496120_0005275 | 3300048923 | Bacteria | 10376 |
| 248 | Ga0496121_0003083 | 3300048924 | Bacteria | 24135 |
| 249 | Ga0496121_0068120 | 3300048924 | Bacteria | 2881 |
| 250 | Ga0496121_0295158 | 3300048924 | Bacteria | 1102 |
| 251 | Ga0496122_0000055 | 3300048925 | Bacteria | 258485 |
| 252 | Ga0496122_0084061 | 3300048925 | Bacteria | 2204 |
| 253 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 254 | Ga0496124_0037445 | 3300048927 | Bacteria | 4218 |
| 255 | Ga0496125_0000108 | 3300048928 | Bacteria | 196060 |
| 256 | Ga0496125_0030275 | 3300048928 | Bacteria | 4845 |
| 257 | Ga0496125_0031755 | 3300048928 | Bacteria | 4701 |
| 258 | Ga0496126_0005445 | 3300048929 | Bacteria | 14518 |
| 259 | Ga0496126_0020214 | 3300048929 | Bacteria | 6534 |
| 260 | Ga0496126_0122507 | 3300048929 | Bacteria | 2253 |
| 261 | Ga0496126_0184801 | 3300048929 | Bacteria | 1768 |
| 262 | Ga0501032_0078991 | 3300049569 | Bacteria | 2190 |
| 263 | Ga0501037_0026171 | 3300049573 | Bacteria | 4312 |
| 264 | Ga0501037_0105585 | 3300049573 | Bacteria | 2030 |
| 265 | Ga0501038_0108741 | 3300049574 | Bacteria | 2298 |
| 266 | Ga0501039_0024228 | 3300049575 | Bacteria | 4660 |
| 267 | Ga0501043_0109646 | 3300049579 | Bacteria | 2167 |
| 268 | Ga0501047_0044474 | 3300049581 | Bacteria | 4291 |
| 269 | Ga0501047_0137578 | 3300049581 | Bacteria | 2322 |
| 270 | Ga0501070_0036095 | 3300049586 | Bacteria | 4128 |
| 271 | Ga0501073_0155589 | 3300049589 | Bacteria | 1584 |
| 272 | Ga0501223_000319 | 3300049663 | Bacteria | 11990 |
| 273 | Ga0501249_000002 | 3300049679 | Bacteria | 262756 |
| 274 | Ga0501035_0000375 | 3300049822 | Bacteria | 51358 |
| 275 | Ga0501035_0008804 | 3300049822 | Bacteria | 9400 |
| 276 | nmdc:mga00v17_30158_c1 | 3300050491 | Bacteria | 3189 |
| 277 | Ga0495595_0110090 | 3300053084 | Bacteria | 1335 |
| 278 | Ga0500641_0038765 | 3300053096 | Bacteria | 1916 |
| 279 | Ga0500595_000988 | 3300053119 | Bacteria | 15955 |
| 280 | Ga0500628_000690 | 3300053129 | Bacteria | 6064 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_100000001 | Ga0070712_100000001297 | 318 |
| 2 | 3300025915 | Ga0207693_10000003 | Ga0207693_1000000322 | 318 |
| 3 | 3300048911 | Ga0496108_0111061 | Ga0496108_0111061_248_1534 | 319 |
| 4 | 3300048912 | Ga0496109_0065581 | Ga0496109_0065581_217_1503 | 319 |
| 5 | 3300048917 | Ga0496114_0054755 | Ga0496114_0054755_1273_2559 | 319 |
| 6 | 3300048918 | Ga0496115_0214052 | Ga0496115_0214052_88_1374 | 319 |
| 7 | 3300039447 | Ga0436361_0835627 | Ga0436361_0835627_67_1200 | 321 |
| 8 | 3300053084 | Ga0495595_0110090 | Ga0495595_0110090_50_1183 | 323 |
| 9 | 3300039437 | Ga0436365_1675866 | Ga0436365_1675866_11_1147 | 326 |
| 10 | 3300048924 | Ga0496121_0003083 | Ga0496121_0003083_3874_4890 | 326 |
| 11 | 3300053119 | Ga0500595_000988 | Ga0500595_000988_5345_6361 | 326 |
| 12 | 3300025938 | Ga0207704_10119759 | Ga0207704_101197593 | 328 |
| 13 | 3300005355 | Ga0070671_100013637 | Ga0070671_1000136376 | 330 |
| 14 | 3300005842 | Ga0068858_100111246 | Ga0068858_1001112463 | 330 |
| 15 | 3300014325 | Ga0163163_10114937 | Ga0163163_101149372 | 330 |
| 16 | 3300014968 | Ga0157379_10034979 | Ga0157379_100349792 | 330 |
| 17 | 3300025931 | Ga0207644_10161215 | Ga0207644_101612152 | 330 |
| 18 | 3300026035 | Ga0207703_10313260 | Ga0207703_103132601 | 330 |
| 19 | 3300031247 | Ga0265340_10010886 | Ga0265340_100108863 | 330 |
| 20 | 3300048924 | Ga0496121_0295158 | Ga0496121_0295158_87_1079 | 330 |
| 21 | 3300048929 | Ga0496126_0020214 | Ga0496126_0020214_2519_3535 | 330 |
| 22 | 3300005438 | Ga0070701_10014951 | Ga0070701_100149513 | 335 |
| 23 | 3300009094 | Ga0111539_10017471 | Ga0111539_100174716 | 340 |
| 24 | 3300021377 | Ga0213874_10002932 | Ga0213874_100029322 | 341 |
| 25 | 3300039450 | Ga0436363_0386426 | Ga0436363_0386426_13730_14893 | 341 |
| 26 | 3300031727 | Ga0316576_10126445 | Ga0316576_101264452 | 342 |
| 27 | 3300049569 | Ga0501032_0078991 | Ga0501032_0078991_714_1940 | 346 |
| 28 | 3300049573 | Ga0501037_0105585 | Ga0501037_0105585_539_1777 | 346 |
| 29 | 3300049574 | Ga0501038_0108741 | Ga0501038_0108741_102_1340 | 346 |
| 30 | 3300049575 | Ga0501039_0024228 | Ga0501039_0024228_517_1755 | 346 |
| 31 | 3300049822 | Ga0501035_0000375 | Ga0501035_0000375_47681_48919 | 346 |
| 32 | iso_pu_bacteria | 2585428157 | 2588106725 | 346 |
| 33 | iso_pu_bacteria | 2643221597 | 2643996430 | 347 |
| 34 | 3300013297 | Ga0157378_10412980 | Ga0157378_104129802 | 348 |
| 35 | 3300048921 | Ga0496118_0006936 | Ga0496118_0006936_9240_10304 | 348 |
| 36 | 3300048923 | Ga0496120_0005275 | Ga0496120_0005275_5051_6115 | 348 |
| 37 | 3300048925 | Ga0496122_0000055 | Ga0496122_0000055_9325_10389 | 348 |
| 38 | 3300048926 | Ga0496123_0000003 | Ga0496123_0000003_626150_627214 | 348 |
| 39 | iso_pu_bacteria | 2739367700 | 2739731986 | 348 |
| 40 | iso_pu_bacteria | 2884411467 | 2884413876 | 348 |
| 41 | iso_pu_bacteria | 2928963466 | 2928964679 | 348 |
| 42 | 3300006038 | Ga0075365_10004848 | Ga0075365_100048482 | 349 |
| 43 | 3300006051 | Ga0075364_10021308 | Ga0075364_100213083 | 349 |
| 44 | 3300050491 | nmdc:mga00v17_30158_c1 | nmdc:mga00v17_30158_c1_1896_2960 | 349 |
| 45 | iso_pu_bacteria | 2643221681 | 2644454691 | 349 |
| 46 | iso_pu_bacteria | 2739367656 | 2739614804 | 349 |
| 47 | iso_pu_bacteria | 2739367663 | 2739646253 | 349 |
| 48 | iso_pu_bacteria | 2821136567 | 2821142499 | 349 |
| 49 | iso_pu_bacteria | 2904445276 | 2904447819 | 349 |
| 50 | iso_pu_bacteria | 2904467357 | 2904470333 | 349 |
| 51 | iso_pu_bacteria | 2929219909 | 2929221275 | 349 |
| 52 | 3300025297 | Ga0209758_1005069 | Ga0209758_10050695 | 350 |
| 53 | 3300031901 | Ga0307406_10173374 | Ga0307406_101733741 | 350 |
| 54 | 3300048913 | Ga0496110_0008707 | Ga0496110_0008707_6564_7628 | 350 |
| 55 | 3300048915 | Ga0496112_0002023 | Ga0496112_0002023_12648_13754 | 350 |
| 56 | 3300048922 | Ga0496119_0001566 | Ga0496119_0001566_25512_26585 | 350 |
| 57 | iso_pu_bacteria | 2513020052 | 2513234801 | 350 |
| 58 | iso_pu_bacteria | 2519899754 | 2520880598 | 350 |
| 59 | iso_pu_bacteria | 2643221600 | 2644012015 | 350 |
| 60 | iso_pu_bacteria | 2643221716 | 2644641289 | 350 |
| 61 | iso_pu_bacteria | 2816332280 | 2817414242 | 350 |
| 62 | iso_pu_bacteria | 2857613821 | 2857618210 | 350 |
| 63 | iso_pu_bacteria | 2887375801 | 2887376169 | 350 |
| 64 | iso_pu_bacteria | 2904419702 | 2904420283 | 350 |
| 65 | iso_pu_bacteria | 2919191525 | 2919192512 | 350 |
| 66 | iso_pu_bacteria | 2919683626 | 2919684086 | 350 |
| 67 | iso_pu_bacteria | 2958458903 | 2958459660 | 350 |
| 68 | iso_pu_bacteria | 8055419101 | 8055420003 | 350 |
| 69 | iso_pu_bacteria | 8055592153 | 8055596897 | 350 |
| 70 | iso_pu_bacteria | 8056440228 | 8056444281 | 350 |
| 71 | 3300005262 | Ga0065165_1001279 | Ga0065165_100127910 | 351 |
| 72 | 3300005288 | Ga0065714_10028039 | Ga0065714_100280392 | 351 |
| 73 | 3300009098 | Ga0105245_10172280 | Ga0105245_101722802 | 351 |
| 74 | 3300025246 | Ga0209646_1000134 | Ga0209646_100013474 | 351 |
| 75 | 3300039450 | Ga0436363_1639024 | Ga0436363_1639024_2430_3602 | 351 |
| 76 | 3300046523 | Ga0495644_0008353 | Ga0495644_0008353_2426_3505 | 351 |
| 77 | 3300048903 | Ga0496100_0052391 | Ga0496100_0052391_128_1240 | 351 |
| 78 | 3300048907 | Ga0496104_0000357 | Ga0496104_0000357_16083_17300 | 351 |
| 79 | 3300048907 | Ga0496104_0011841 | Ga0496104_0011841_5545_6738 | 351 |
| 80 | 3300048908 | Ga0496105_0000118 | Ga0496105_0000118_36867_38084 | 351 |
| 81 | 3300048908 | Ga0496105_0002248 | Ga0496105_0002248_7259_8452 | 351 |
| 82 | 3300048911 | Ga0496108_0072767 | Ga0496108_0072767_268_1380 | 351 |
| 83 | 3300048914 | Ga0496111_0086689 | Ga0496111_0086689_653_1765 | 351 |
| 84 | 3300048915 | Ga0496112_0036713 | Ga0496112_0036713_1926_3038 | 351 |
| 85 | 3300048916 | Ga0496113_0031488 | Ga0496113_0031488_2027_3139 | 351 |
| 86 | 3300048917 | Ga0496114_0034890 | Ga0496114_0034890_2761_3873 | 351 |
| 87 | 3300048918 | Ga0496115_0024613 | Ga0496115_0024613_1803_3020 | 351 |
| 88 | 3300048922 | Ga0496119_0065962 | Ga0496119_0065962_791_1984 | 351 |
| 89 | 3300048928 | Ga0496125_0030275 | Ga0496125_0030275_3458_4570 | 351 |
| 90 | iso_pu_bacteria | 2889415604 | 2889421688 | 351 |
| 91 | 3300002737 | JGI25162J39368_1000138 | JGI25162J39368_100013817 | 352 |
| 92 | 3300002737 | JGI25162J39368_1001926 | JGI25162J39368_10019268 | 352 |
| 93 | 3300002741 | JGI25157J39369_1000441 | JGI25157J39369_100044127 | 352 |
| 94 | 3300002771 | JGI25163J39215_1001476 | JGI25163J39215_10014763 | 352 |
| 95 | 3300002772 | JGI25164J39214_1000375 | JGI25164J39214_100037527 | 352 |
| 96 | 3300002772 | JGI25164J39214_1000548 | JGI25164J39214_100054817 | 352 |
| 97 | 3300002773 | JGI25152J39213_1000016 | JGI25152J39213_100001632 | 352 |
| 98 | 3300002774 | JGI25150J39212_1000003 | JGI25150J39212_1000003363 | 352 |
| 99 | 3300002774 | JGI25150J39212_1000004 | JGI25150J39212_1000004261 | 352 |
| 100 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002363 | 352 |
| 101 | 3300003214 | JGI25165J46597_1000224 | JGI25165J46597_100022467 | 352 |
| 102 | 3300003215 | JGI25153J46596_10000015 | JGI25153J46596_10000015174 | 352 |
| 103 | 3300003322 | rootL2_10058274 | rootL2_100582747 | 352 |
| 104 | 3300003322 | rootL2_10086611 | rootL2_100866111 | 352 |
| 105 | 3300003756 | Ga0055533_1001231 | Ga0055533_10012311 | 352 |
| 106 | 3300003761 | Ga0055535_1001013 | Ga0055535_100101317 | 352 |
| 107 | 3300003762 | Ga0055542_1000136 | Ga0055542_100013676 | 352 |
| 108 | 3300003762 | Ga0055542_1000179 | Ga0055542_100017967 | 352 |
| 109 | 3300003763 | Ga0055529_1000189 | Ga0055529_100018967 | 352 |
| 110 | 3300005288 | Ga0065714_10064558 | Ga0065714_1006455822 | 352 |
| 111 | 3300005327 | Ga0070658_10006716 | Ga0070658_100067164 | 352 |
| 112 | 3300005327 | Ga0070658_10127591 | Ga0070658_101275911 | 352 |
| 113 | 3300005328 | Ga0070676_10010919 | Ga0070676_100109194 | 352 |
| 114 | 3300005330 | Ga0070690_100076895 | Ga0070690_1000768952 | 352 |
| 115 | 3300005331 | Ga0070670_100047469 | Ga0070670_1000474695 | 352 |
| 116 | 3300005331 | Ga0070670_100176575 | Ga0070670_1001765752 | 352 |
| 117 | 3300005333 | Ga0070677_10032153 | Ga0070677_100321532 | 352 |
| 118 | 3300005335 | Ga0070666_10000003 | Ga0070666_10000003339 | 352 |
| 119 | 3300005335 | Ga0070666_10149766 | Ga0070666_101497662 | 352 |
| 120 | 3300005338 | Ga0068868_100048172 | Ga0068868_1000481722 | 352 |
| 121 | 3300005338 | Ga0068868_100098389 | Ga0068868_1000983893 | 352 |
| 122 | 3300005340 | Ga0070689_100001969 | Ga0070689_10000196915 | 352 |
| 123 | 3300005340 | Ga0070689_100057218 | Ga0070689_1000572182 | 352 |
| 124 | 3300005343 | Ga0070687_100054701 | Ga0070687_1000547012 | 352 |
| 125 | 3300005344 | Ga0070661_100025601 | Ga0070661_1000256012 | 352 |
| 126 | 3300005353 | Ga0070669_100042608 | Ga0070669_1000426082 | 352 |
| 127 | 3300005354 | Ga0070675_100021292 | Ga0070675_1000212926 | 352 |
| 128 | 3300005354 | Ga0070675_100190391 | Ga0070675_1001903913 | 352 |
| 129 | 3300005355 | Ga0070671_100015039 | Ga0070671_1000150392 | 352 |
| 130 | 3300005355 | Ga0070671_100119326 | Ga0070671_1001193262 | 352 |
| 131 | 3300005364 | Ga0070673_100027150 | Ga0070673_1000271502 | 352 |
| 132 | 3300005367 | Ga0070667_100039172 | Ga0070667_1000391724 | 352 |
| 133 | 3300005367 | Ga0070667_100160405 | Ga0070667_1001604052 | 352 |
| 134 | 3300005435 | Ga0070714_100004698 | Ga0070714_1000046986 | 352 |
| 135 | 3300005441 | Ga0070700_100076062 | Ga0070700_1000760621 | 352 |
| 136 | 3300005455 | Ga0070663_100264110 | Ga0070663_1002641102 | 352 |
| 137 | 3300005456 | Ga0070678_100010718 | Ga0070678_1000107183 | 352 |
| 138 | 3300005456 | Ga0070678_100028019 | Ga0070678_1000280193 | 352 |
| 139 | 3300005466 | Ga0070685_10045810 | Ga0070685_100458103 | 352 |
| 140 | 3300005543 | Ga0070672_100067339 | Ga0070672_1000673395 | 352 |
| 141 | 3300005543 | Ga0070672_100091194 | Ga0070672_1000911942 | 352 |
| 142 | 3300005544 | Ga0070686_100048988 | Ga0070686_1000489883 | 352 |
| 143 | 3300005548 | Ga0070665_100001114 | Ga0070665_1000011148 | 352 |
| 144 | 3300005548 | Ga0070665_100022792 | Ga0070665_1000227925 | 352 |
| 145 | 3300005615 | Ga0070702_100085516 | Ga0070702_1000855163 | 352 |
| 146 | 3300005618 | Ga0068864_100006602 | Ga0068864_1000066024 | 352 |
| 147 | 3300005719 | Ga0068861_100320006 | Ga0068861_1003200061 | 352 |
| 148 | 3300005841 | Ga0068863_100030121 | Ga0068863_1000301215 | 352 |
| 149 | 3300005841 | Ga0068863_100256076 | Ga0068863_1002560763 | 352 |
| 150 | 3300005843 | Ga0068860_100184797 | Ga0068860_1001847973 | 352 |
| 151 | 3300005844 | Ga0068862_100074596 | Ga0068862_1000745962 | 352 |
| 152 | 3300005844 | Ga0068862_100093395 | Ga0068862_1000933954 | 352 |
| 153 | 3300005844 | Ga0068862_100170238 | Ga0068862_1001702384 | 352 |
| 154 | 3300006028 | Ga0070717_10110913 | Ga0070717_101109132 | 352 |
| 155 | 3300006051 | Ga0075364_10203566 | Ga0075364_102035661 | 352 |
| 156 | 3300006058 | Ga0075432_10001341 | Ga0075432_100013414 | 352 |
| 157 | 3300006946 | Ga0079104_1000570 | Ga0079104_100057037 | 352 |
| 158 | 3300006948 | Ga0099826_10007095 | Ga0099826_100070954 | 352 |
| 159 | 3300007265 | Ga0099794_10003504 | Ga0099794_100035042 | 352 |
| 160 | 3300009093 | Ga0105240_10159304 | Ga0105240_101593043 | 352 |
| 161 | 3300009148 | Ga0105243_10135888 | Ga0105243_101358883 | 352 |
| 162 | 3300009177 | Ga0105248_10162892 | Ga0105248_101628922 | 352 |
| 163 | 3300009551 | Ga0105238_10001342 | Ga0105238_1000134216 | 352 |
| 164 | 3300009551 | Ga0105238_10103636 | Ga0105238_101036362 | 352 |
| 165 | 3300013102 | Ga0157371_10000296 | Ga0157371_1000029645 | 352 |
| 166 | 3300013102 | Ga0157371_10031303 | Ga0157371_100313034 | 352 |
| 167 | 3300013104 | Ga0157370_10011116 | Ga0157370_100111168 | 352 |
| 168 | 3300013105 | Ga0157369_10016956 | Ga0157369_100169565 | 352 |
| 169 | 3300013105 | Ga0157369_10214918 | Ga0157369_102149183 | 352 |
| 170 | 3300013296 | Ga0157374_10102240 | Ga0157374_101022403 | 352 |
| 171 | 3300013297 | Ga0157378_10008742 | Ga0157378_100087424 | 352 |
| 172 | 3300013306 | Ga0163162_10000065 | Ga0163162_1000006548 | 352 |
| 173 | 3300013306 | Ga0163162_10003166 | Ga0163162_1000316610 | 352 |
| 174 | 3300013308 | Ga0157375_10008720 | Ga0157375_100087205 | 352 |
| 175 | 3300014325 | Ga0163163_10459474 | Ga0163163_104594741 | 352 |
| 176 | 3300014497 | Ga0182008_10000167 | Ga0182008_100001673 | 352 |
| 177 | 3300014968 | Ga0157379_10069812 | Ga0157379_100698123 | 352 |
| 178 | 3300014969 | Ga0157376_10087718 | Ga0157376_100877182 | 352 |
| 179 | 3300015261 | Ga0182006_1000351 | Ga0182006_100035124 | 352 |
| 180 | 3300015261 | Ga0182006_1019416 | Ga0182006_10194161 | 352 |
| 181 | 3300015682 | Ga0183373_1002 | Ga0183373_1002633 | 352 |
| 182 | 3300015687 | Ga0183368_1003 | Ga0183368_1003820 | 352 |
| 183 | 3300025206 | Ga0209435_102286 | Ga0209435_1022862 | 352 |
| 184 | 3300025206 | Ga0209435_106555 | Ga0209435_1065552 | 352 |
| 185 | 3300025207 | Ga0209760_100421 | Ga0209760_1004217 | 352 |
| 186 | 3300025224 | Ga0209784_100068 | Ga0209784_10006867 | 352 |
| 187 | 3300025225 | Ga0209566_105010 | Ga0209566_1050101 | 352 |
| 188 | 3300025226 | Ga0209674_100012 | Ga0209674_100012573 | 352 |
| 189 | 3300025228 | Ga0209672_101694 | Ga0209672_1016945 | 352 |
| 190 | 3300025231 | Ga0207427_100140 | Ga0207427_10014067 | 352 |
| 191 | 3300025231 | Ga0207427_100736 | Ga0207427_10073616 | 352 |
| 192 | 3300025233 | Ga0209437_100147 | Ga0209437_100147104 | 352 |
| 193 | 3300025233 | Ga0209437_101065 | Ga0209437_1010659 | 352 |
| 194 | 3300025233 | Ga0209437_104532 | Ga0209437_1045321 | 352 |
| 195 | 3300025242 | Ga0209258_100049 | Ga0209258_1000494 | 352 |
| 196 | 3300025242 | Ga0209258_101180 | Ga0209258_1011804 | 352 |
| 197 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003482 | 352 |
| 198 | 3300025246 | Ga0209646_1000534 | Ga0209646_10005345 | 352 |
| 199 | 3300025250 | Ga0209026_1000099 | Ga0209026_100009967 | 352 |
| 200 | 3300025250 | Ga0209026_1003107 | Ga0209026_10031072 | 352 |
| 201 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021425 | 352 |
| 202 | 3300025254 | Ga0209148_1000010 | Ga0209148_10000101016 | 352 |
| 203 | 3300025256 | Ga0209759_1006253 | Ga0209759_10062535 | 352 |
| 204 | 3300025256 | Ga0209759_1009155 | Ga0209759_10091553 | 352 |
| 205 | 3300025258 | Ga0209129_1000014 | Ga0209129_1000014351 | 352 |
| 206 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009154 | 352 |
| 207 | 3300025272 | Ga0209455_1000086 | Ga0209455_1000086155 | 352 |
| 208 | 3300025272 | Ga0209455_1002424 | Ga0209455_10024246 | 352 |
| 209 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007481 | 352 |
| 210 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012482 | 352 |
| 211 | 3300025315 | Ga0207697_10038120 | Ga0207697_100381202 | 352 |
| 212 | 3300025893 | Ga0207682_10004020 | Ga0207682_100040205 | 352 |
| 213 | 3300025903 | Ga0207680_10000006 | Ga0207680_10000006486 | 352 |
| 214 | 3300025907 | Ga0207645_10008822 | Ga0207645_100088229 | 352 |
| 215 | 3300025908 | Ga0207643_10017508 | Ga0207643_100175081 | 352 |
| 216 | 3300025909 | Ga0207705_10005875 | Ga0207705_100058754 | 352 |
| 217 | 3300025918 | Ga0207662_10024471 | Ga0207662_100244712 | 352 |
| 218 | 3300025923 | Ga0207681_10044772 | Ga0207681_100447724 | 352 |
| 219 | 3300025924 | Ga0207694_10001494 | Ga0207694_1000149414 | 352 |
| 220 | 3300025924 | Ga0207694_10147221 | Ga0207694_101472212 | 352 |
| 221 | 3300025925 | Ga0207650_10000719 | Ga0207650_100007195 | 352 |
| 222 | 3300025926 | Ga0207659_10121368 | Ga0207659_101213682 | 352 |
| 223 | 3300025929 | Ga0207664_10021344 | Ga0207664_100213444 | 352 |
| 224 | 3300025931 | Ga0207644_10051477 | Ga0207644_100514775 | 352 |
| 225 | 3300025933 | Ga0207706_10056388 | Ga0207706_100563882 | 352 |
| 226 | 3300025935 | Ga0207709_10120122 | Ga0207709_101201222 | 352 |
| 227 | 3300025936 | Ga0207670_10003012 | Ga0207670_100030127 | 352 |
| 228 | 3300025940 | Ga0207691_10052198 | Ga0207691_100521982 | 352 |
| 229 | 3300025941 | Ga0207711_10142512 | Ga0207711_101425124 | 352 |
| 230 | 3300025960 | Ga0207651_10016592 | Ga0207651_100165925 | 352 |
| 231 | 3300025960 | Ga0207651_10026192 | Ga0207651_100261922 | 352 |
| 232 | 3300025960 | Ga0207651_10087311 | Ga0207651_100873111 | 352 |
| 233 | 3300025972 | Ga0207668_10158036 | Ga0207668_101580362 | 352 |
| 234 | 3300025986 | Ga0207658_10080998 | Ga0207658_100809982 | 352 |
| 235 | 3300026035 | Ga0207703_10188218 | Ga0207703_101882182 | 352 |
| 236 | 3300026067 | Ga0207678_10006312 | Ga0207678_100063129 | 352 |
| 237 | 3300026067 | Ga0207678_10071321 | Ga0207678_100713212 | 352 |
| 238 | 3300026067 | Ga0207678_10245344 | Ga0207678_102453442 | 352 |
| 239 | 3300026088 | Ga0207641_10012415 | Ga0207641_100124153 | 352 |
| 240 | 3300026089 | Ga0207648_10071772 | Ga0207648_100717724 | 352 |
| 241 | 3300026095 | Ga0207676_10001872 | Ga0207676_100018729 | 352 |
| 242 | 3300026118 | Ga0207675_100014661 | Ga0207675_1000146616 | 352 |
| 243 | 3300026121 | Ga0207683_10003667 | Ga0207683_100036675 | 352 |
| 244 | 3300026121 | Ga0207683_10042187 | Ga0207683_100421873 | 352 |
| 245 | 3300027111 | Ga0209281_1000392 | Ga0209281_100039245 | 352 |
| 246 | 3300027907 | Ga0207428_10051127 | Ga0207428_100511273 | 352 |
| 247 | 3300028379 | Ga0268266_10000021 | Ga0268266_10000021331 | 352 |
| 248 | 3300028379 | Ga0268266_10004254 | Ga0268266_100042548 | 352 |
| 249 | 3300028380 | Ga0268265_10067340 | Ga0268265_100673402 | 352 |
| 250 | 3300028381 | Ga0268264_10077977 | Ga0268264_100779772 | 352 |
| 251 | 3300028381 | Ga0268264_10102628 | Ga0268264_101026282 | 352 |
| 252 | 3300031344 | Ga0265316_10080426 | Ga0265316_100804262 | 352 |
| 253 | 3300031548 | Ga0307408_100001580 | Ga0307408_1000015805 | 352 |
| 254 | 3300031711 | Ga0265314_10130655 | Ga0265314_101306551 | 352 |
| 255 | 3300031731 | Ga0307405_10080557 | Ga0307405_100805572 | 352 |
| 256 | 3300031824 | Ga0307413_10091387 | Ga0307413_100913872 | 352 |
| 257 | 3300031852 | Ga0307410_10000139 | Ga0307410_100001392 | 352 |
| 258 | 3300031852 | Ga0307410_10080791 | Ga0307410_100807912 | 352 |
| 259 | 3300031901 | Ga0307406_10000042 | Ga0307406_1000004220 | 352 |
| 260 | 3300031903 | Ga0307407_10001299 | Ga0307407_100012992 | 352 |
| 261 | 3300031911 | Ga0307412_10039739 | Ga0307412_100397392 | 352 |
| 262 | 3300032002 | Ga0307416_100000194 | Ga0307416_10000019411 | 352 |
| 263 | 3300032004 | Ga0307414_10000022 | Ga0307414_10000022163 | 352 |
| 264 | 3300032004 | Ga0307414_10151469 | Ga0307414_101514691 | 352 |
| 265 | 3300033180 | Ga0307510_10003097 | Ga0307510_1000309714 | 352 |
| 266 | 3300033180 | Ga0307510_10062203 | Ga0307510_100622033 | 352 |
| 267 | 3300038443 | Ga0395901_0407588 | Ga0395901_0407588_94_1251 | 352 |
| 268 | 3300041411 | Ga0439466_0008136 | Ga0439466_0008136_2669_3739 | 352 |
| 269 | 3300042876 | Ga0451577_0097705 | Ga0451577_0097705_176_1243 | 352 |
| 270 | 3300044694 | Ga0466963_0055007 | Ga0466963_0055007_421_1488 | 352 |
| 271 | 3300046460 | Ga0495638_0000213 | Ga0495638_0000213_75675_76733 | 352 |
| 272 | 3300046460 | Ga0495638_0001101 | Ga0495638_0001101_1317_2375 | 352 |
| 273 | 3300046471 | Ga0495650_0002413 | Ga0495650_0002413_11364_12422 | 352 |
| 274 | 3300046507 | Ga0495606_0001151 | Ga0495606_0001151_5832_6890 | 352 |
| 275 | 3300046512 | Ga0495610_0000048 | Ga0495610_0000048_110675_111799 | 352 |
| 276 | 3300046522 | Ga0495643_0000155 | Ga0495643_0000155_74149_75225 | 352 |
| 277 | 3300046524 | Ga0495648_0002535 | Ga0495648_0002535_5900_7072 | 352 |
| 278 | 3300046542 | Ga0495597_0039336 | Ga0495597_0039336_940_1998 | 352 |
| 279 | 3300046665 | Ga0495661_0042131 | Ga0495661_0042131_1456_2628 | 352 |
| 280 | 3300046681 | Ga0495647_0056731 | Ga0495647_0056731_186_1328 | 352 |
| 281 | 3300046683 | Ga0495658_0020559 | Ga0495658_0020559_1295_2437 | 352 |
| 282 | 3300046694 | Ga0495649_0010636 | Ga0495649_0010636_1967_3025 | 352 |
| 283 | 3300048916 | Ga0496113_0047971 | Ga0496113_0047971_816_1874 | 352 |
| 284 | 3300048917 | Ga0496114_0286903 | Ga0496114_0286903_50_1108 | 352 |
| 285 | 3300048918 | Ga0496115_0000341 | Ga0496115_0000341_6831_7889 | 352 |
| 286 | 3300048918 | Ga0496115_0029113 | Ga0496115_0029113_1936_2994 | 352 |
| 287 | 3300048919 | Ga0496116_0000002 | Ga0496116_0000002_757876_758946 | 352 |
| 288 | 3300048920 | Ga0496117_0015943 | Ga0496117_0015943_4130_5200 | 352 |
| 289 | 3300048924 | Ga0496121_0068120 | Ga0496121_0068120_951_2009 | 352 |
| 290 | 3300048925 | Ga0496122_0084061 | Ga0496122_0084061_25_1083 | 352 |
| 291 | 3300048927 | Ga0496124_0037445 | Ga0496124_0037445_1288_2358 | 352 |
| 292 | 3300048928 | Ga0496125_0000108 | Ga0496125_0000108_149379_150449 | 352 |
| 293 | 3300048928 | Ga0496125_0031755 | Ga0496125_0031755_2687_3745 | 352 |
| 294 | 3300048929 | Ga0496126_0005445 | Ga0496126_0005445_2819_3889 | 352 |
| 295 | 3300048929 | Ga0496126_0122507 | Ga0496126_0122507_476_1534 | 352 |
| 296 | 3300048929 | Ga0496126_0184801 | Ga0496126_0184801_43_1101 | 352 |
| 297 | 3300049573 | Ga0501037_0026171 | Ga0501037_0026171_1228_2487 | 352 |
| 298 | 3300049579 | Ga0501043_0109646 | Ga0501043_0109646_660_1805 | 352 |
| 299 | 3300049581 | Ga0501047_0044474 | Ga0501047_0044474_2559_3818 | 352 |
| 300 | 3300049581 | Ga0501047_0137578 | Ga0501047_0137578_468_1679 | 352 |
| 301 | 3300049586 | Ga0501070_0036095 | Ga0501070_0036095_680_1939 | 352 |
| 302 | 3300049589 | Ga0501073_0155589 | Ga0501073_0155589_186_1349 | 352 |
| 303 | 3300049663 | Ga0501223_000319 | Ga0501223_000319_2685_3755 | 352 |
| 304 | 3300049679 | Ga0501249_000002 | Ga0501249_000002_127332_128405 | 352 |
| 305 | 3300049822 | Ga0501035_0008804 | Ga0501035_0008804_2527_3738 | 352 |
| 306 | 3300053096 | Ga0500641_0038765 | Ga0500641_0038765_92_1165 | 352 |
| 307 | 3300053129 | Ga0500628_000690 | Ga0500628_000690_4879_5952 | 352 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o0t-assembly2.cif.gz_D-2 | crystal structure of chloroflexus aggregans ene-reductase caoye holoenzyme | 0.9849 | 1 | 352 |
| 7o0t-assembly2.cif.gz_D-2 | crystal structure of chloroflexus aggregans ene-reductase caoye holoenzyme | 0.9821 | 1 | 352 |
| 8pun-assembly1.cif.gz_D | old yellow enzyme from the thermophilic ferrovum sp. ja12 | 0.9808 | 2 | 352 |
| 3hf3-assembly1.cif.gz_D | old yellow enzyme from thermus scotoductus sa-01 | 0.9796 | 1 | 352 |
| 1z41-assembly1.cif.gz_A | crystal structure of oxidized yqjm from bacillus subtilis | 0.9794 | 2 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54K64_32_404_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9862 | 2 | 350 | 3.20.20.70 |
| af_O94467_31_394_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9835 | 1 | 351 | 3.20.20.70 |
| af_O94467_31_394_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.978 | 1 | 351 | 3.20.20.70 |
| 5ocsA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9767 | 3 | 352 | 3.20.20.70 |
| af_Q54JW3_30_435_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9766 | 2 | 348 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7R9Q813-F1-model_v4 | NADH:flavin oxidoreductase/NADH oxidase N-terminal domain-containing protein | 0.9922 | 2 | 246 |
GO:0003959
GO:0010181 GO:0050661 |
| AF-A0A3M5B811-F1-model_v4 | deleted | 0.9911 | 2 | 216 |
|
| AF-A0A7Y8KBU0-F1-model_v4 | Oxidoreductase | 0.9905 | 1 | 111 |
GO:0003959
GO:0010181 GO:0050661 |
| AF-A0A840RRB5-F1-model_v4 | 2,4-dienoyl-CoA reductase-like NADH-dependent reductase (Old Yellow Enzyme family) | 0.9889 | 2 | 352 |
GO:0003959
GO:0010181 GO:0050661 |
| AF-A0A6I4I0G1-F1-model_v4 | NADPH dehydrogenase NamA (EC 1.6.99.1) | 0.9878 | 2 | 352 |
GO:0003959
GO:0010181 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar