F398831

General Info

Members Datasets Scaffolds Average Seq Length
306 207 306 322

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0031546|Ga0495632_0031546_376_1440
Length 354
Sequence MLRRLASCSAFLTYRNTPGYAGHVTFLRSEFAMPKTTSLAVVMDPIAKIKFAKDSTLAMLLAAASRGWQLTYFEQSDLFLRDGIAYGRARDLRVFADPARWFELGEPKVVRLGEFDCVFMRKDPPFDAEYIYTTYVLERAEIQGALVVNRPQGLRDMNEKVFTAWFPQCCAPTLITRNAGDITAFATEHGKIVVKPLDGMGGKSIFVTEKGDKNLPVIIETLTDMGNRFAIAQRYVPDIAATGDSRVLLIDGQPVPYALARIPAPHDNRGNLAAGATGVGRELNERDRWLAAEIGPTLAEKGMVLVGIDVIGGFVTEINVTSPTGIRELDKQFGLNIGDMVIAAIERRLGAKKG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 2.61
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100153208 3300005331 Bacteria 1995
2 Ga0070677_10002356 3300005333 Bacteria 6039
3 Ga0070677_10003653 3300005333 Bacteria 4970
4 Ga0068869_100048801 3300005334 Bacteria 3063
5 Ga0070682_100012736 3300005337 Bacteria 4827
6 Ga0070682_100092797 3300005337 Bacteria 1978
7 Ga0070682_100144218 3300005337 Bacteria 1627
8 Ga0070682_100214256 3300005337 Bacteria 1367
9 Ga0070692_10084932 3300005345 Bacteria 1712
10 Ga0070668_100008997 3300005347 Bacteria 7416
11 Ga0070668_100037548 3300005347 Bacteria 3699
12 Ga0070669_100094170 3300005353 Bacteria 2251
13 Ga0070675_100159388 3300005354 Bacteria 1939
14 Ga0070675_100202372 3300005354 Bacteria 1724
15 Ga0070674_100003114 3300005356 Bacteria 9235
16 Ga0070674_100021676 3300005356 Bacteria 4131
17 Ga0070709_10016254 3300005434 Bacteria 4245
18 Ga0070714_100039412 3300005435 Bacteria 3977
19 Ga0070701_10032210 3300005438 Bacteria 2609
20 Ga0070711_100003459 3300005439 Bacteria 9206
21 Ga0070700_100007280 3300005441 Bacteria 5963
22 Ga0070700_100090204 3300005441 Bacteria 1999
23 Ga0070663_100078687 3300005455 Bacteria 2417
24 Ga0070678_100031684 3300005456 Bacteria 3651
25 Ga0070678_100032755 3300005456 Bacteria 3600
26 Ga0070662_100027828 3300005457 Bacteria 3930
27 Ga0068867_100007569 3300005459 Bacteria 7685
28 Ga0068867_100025017 3300005459 Bacteria 4281
29 Ga0070672_100017646 3300005543 Bacteria 5141
30 Ga0070672_100068104 3300005543 Bacteria 2823
31 Ga0070672_100091289 3300005543 Bacteria 2457
32 Ga0070695_100008677 3300005545 Bacteria 6041
33 Ga0070696_100030651 3300005546 Bacteria 3684
34 Ga0068855_100001758 3300005563 Bacteria 27060
35 Ga0070664_100187531 3300005564 Bacteria 1841
36 Ga0068857_100132473 3300005577 Bacteria 2249
37 Ga0068854_100154717 3300005578 Bacteria 1771
38 Ga0070702_100022564 3300005615 Bacteria 3330
39 Ga0070702_100194768 3300005615 Unclassified 1337
40 Ga0068859_100024476 3300005617 Bacteria 6057
41 Ga0068864_100051067 3300005618 Bacteria 3561
42 Ga0068861_100002198 3300005719 Bacteria 12658
43 Ga0068861_100009183 3300005719 Bacteria 6819
44 Ga0068861_100013894 3300005719 Bacteria 5643
45 Ga0068861_100174852 3300005719 Bacteria 1782
46 Ga0068870_10016246 3300005840 Bacteria 3552
47 Ga0068863_100013079 3300005841 Bacteria 8006
48 Ga0068860_100032735 3300005843 Bacteria 4994
49 Ga0081455_10001360 3300005937 Bacteria 30237
50 Ga0081455_10020730 3300005937 Bacteria 6182
51 Ga0070716_100006687 3300006173 Bacteria 5646
52 Ga0068871_100007480 3300006358 Bacteria 7811
53 Ga0075428_100007063 3300006844 Bacteria 12443
54 Ga0075430_100246610 3300006846 Bacteria 1480
55 Ga0075431_100000064 3300006847 Bacteria 61023
56 Ga0075431_100070460 3300006847 Bacteria 3608
57 Ga0075429_100008499 3300006880 Bacteria 8933
58 Ga0068865_100115472 3300006881 Bacteria 1987
59 Ga0068865_100253259 3300006881 Bacteria 1390
60 Ga0097620_100024476 3300006931 Bacteria 6057
61 Ga0099794_10074358 3300007265 Bacteria 1669
62 Ga0099795_10000372 3300007788 Bacteria 8097
63 Ga0105240_10003246 3300009093 Bacteria 25453
64 Ga0105240_10033167 3300009093 Bacteria 6674
65 Ga0111539_10002612 3300009094 Bacteria 23873
66 Ga0111539_10130193 3300009094 Bacteria 2947
67 Ga0111539_10374038 3300009094 Bacteria 1658
68 Ga0105243_10266072 3300009148 Bacteria 1537
69 Ga0105248_10127282 3300009177 Bacteria 2873
70 Ga0105237_10062987 3300009545 Bacteria 3707
71 Ga0105237_10517597 3300009545 Bacteria 1200
72 Ga0105238_10071290 3300009551 Bacteria 3472
73 Ga0105238_10469353 3300009551 Bacteria 1257
74 Ga0105249_10057034 3300009553 Bacteria 3577
75 Ga0099796_10000028 3300010159 Bacteria 35631
76 Ga0157369_10006257 3300013105 Bacteria 13815
77 Ga0157378_10256025 3300013297 Bacteria 1677
78 Ga0157375_10007538 3300013308 Bacteria 9514
79 Ga0157375_10123569 3300013308 Bacteria 2701
80 Ga0163163_10024438 3300014325 Bacteria 5751
81 Ga0157380_10066615 3300014326 Bacteria 2897
82 Ga0157380_10224077 3300014326 Bacteria 1684
83 Ga0157379_10000588 3300014968 Bacteria 29446
84 Ga0157376_10502857 3300014969 Bacteria 1191
85 Ga0207682_10004182 3300025893 Bacteria 6098
86 Ga0207699_10000973 3300025906 Bacteria 13637
87 Ga0207645_10000594 3300025907 Bacteria 30011
88 Ga0207645_10152108 3300025907 Bacteria 1511
89 Ga0207643_10020976 3300025908 Bacteria 3587
90 Ga0207707_10036587 3300025912 Bacteria 4291
91 Ga0207695_10017216 3300025913 Bacteria 8419
92 Ga0207695_10033369 3300025913 Bacteria 5615
93 Ga0207695_10092422 3300025913 Bacteria 3036
94 Ga0207663_10004735 3300025916 Bacteria 6797
95 Ga0207660_10039440 3300025917 Bacteria 3302
96 Ga0207660_10066722 3300025917 Bacteria 2604
97 Ga0207662_10087360 3300025918 Bacteria 1913
98 Ga0207681_10023649 3300025923 Bacteria 3933
99 Ga0207659_10069164 3300025926 Bacteria 2570
100 Ga0207659_10082582 3300025926 Bacteria 2379
101 Ga0207659_10101824 3300025926 Bacteria 2167
102 Ga0207659_10224439 3300025926 Bacteria 1512
103 Ga0207700_10072835 3300025928 Bacteria 2651
104 Ga0207664_10195234 3300025929 Bacteria 1744
105 Ga0207706_10015520 3300025933 Bacteria 6882
106 Ga0207709_10043560 3300025935 Bacteria 2706
107 Ga0207670_10026409 3300025936 Bacteria 3658
108 Ga0207704_10028471 3300025938 Bacteria 3100
109 Ga0207704_10167139 3300025938 Bacteria 1573
110 Ga0207665_10031118 3300025939 Bacteria 3530
111 Ga0207691_10002419 3300025940 Bacteria 18265
112 Ga0207691_10005609 3300025940 Bacteria 12132
113 Ga0207691_10007621 3300025940 Bacteria 10416
114 Ga0207691_10034113 3300025940 Bacteria 4736
115 Ga0207691_10082707 3300025940 Bacteria 2883
116 Ga0207711_10049450 3300025941 Bacteria 3600
117 Ga0207689_10003161 3300025942 Bacteria 15096
118 Ga0207689_10107822 3300025942 Bacteria 2289
119 Ga0207689_10116390 3300025942 Bacteria 2197
120 Ga0207679_10070944 3300025945 Bacteria 2626
121 Ga0207679_10087690 3300025945 Bacteria 2397
122 Ga0207679_10266736 3300025945 Bacteria 1463
123 Ga0207667_10017041 3300025949 Bacteria 8196
124 Ga0207667_10190297 3300025949 Bacteria 2106
125 Ga0207651_10011291 3300025960 Bacteria 4994
126 Ga0207651_10013697 3300025960 Bacteria 4652
127 Ga0207651_10180591 3300025960 Bacteria 1674
128 Ga0207712_10163760 3300025961 Bacteria 1731
129 Ga0207668_10084310 3300025972 Bacteria 2315
130 Ga0207668_10279140 3300025972 Bacteria 1369
131 Ga0207678_10066406 3300026067 Bacteria 3098
132 Ga0207708_10012686 3300026075 Bacteria 6283
133 Ga0207708_10138458 3300026075 Bacteria 1907
134 Ga0207641_10006868 3300026088 Bacteria 9526
135 Ga0207641_10164808 3300026088 Bacteria 2017
136 Ga0207648_10001676 3300026089 Bacteria 24261
137 Ga0207648_10102654 3300026089 Bacteria 2507
138 Ga0207676_10098694 3300026095 Bacteria 2415
139 Ga0207676_10183371 3300026095 Bacteria 1835
140 Ga0207675_100001477 3300026118 Bacteria 23607
141 Ga0207675_100014735 3300026118 Bacteria 7292
142 Ga0207675_100024382 3300026118 Bacteria 5625
143 Ga0207675_100653746 3300026118 Bacteria 1057
144 Ga0207683_10004100 3300026121 Bacteria 12587
145 Ga0209179_1000141 3300027512 Bacteria 7511
146 Ga0209983_1002343 3300027665 Bacteria 4155
147 Ga0209971_1000520 3300027682 Bacteria 10152
148 Ga0209998_10000392 3300027717 Bacteria 12663
149 Ga0209974_10009217 3300027876 Bacteria 3350
150 Ga0207428_10072802 3300027907 Bacteria 2697
151 Ga0207428_10184024 3300027907 Bacteria 1577
152 Ga0265354_1001198 3300028016 Bacteria 3930
153 Ga0268266_10003298 3300028379 Bacteria 16225
154 Ga0268266_10012000 3300028379 Bacteria 7500
155 Ga0268266_10137179 3300028379 Bacteria 2192
156 Ga0268265_10163848 3300028380 Bacteria 1892
157 Ga0265334_10000136 3300028573 Bacteria 46227
158 Ga0265318_10000421 3300028577 Bacteria 32586
159 Ga0265338_10007730 3300028800 Bacteria 13231
160 Ga0265338_10039257 3300028800 Bacteria 4470
161 Ga0265770_1000816 3300030878 Bacteria 4312
162 Ga0265760_10000560 3300031090 Bacteria 10554
163 Ga0265332_10088796 3300031238 Bacteria 1308
164 Ga0265328_10000985 3300031239 Bacteria 13077
165 Ga0265328_10005460 3300031239 Bacteria 5444
166 Ga0265320_10020388 3300031240 Bacteria 3596
167 Ga0265325_10018562 3300031241 Bacteria 3857
168 Ga0265339_10022303 3300031249 Bacteria 3669
169 Ga0265316_10010914 3300031344 Bacteria 8247
170 Ga0265316_10027384 3300031344 Bacteria 4721
171 Ga0307513_10004634 3300031456 Bacteria 18306
172 Ga0307513_10012255 3300031456 Bacteria 10598
173 Ga0307513_10072274 3300031456 Bacteria 3596
174 Ga0307513_10155016 3300031456 Bacteria 2192
175 Ga0307509_10000023 3300031507 Bacteria 242310
176 Ga0307509_10000051 3300031507 Bacteria 165037
177 Ga0307408_100042027 3300031548 Bacteria 3244
178 Ga0265313_10002962 3300031595 Bacteria 14171
179 Ga0316575_10030108 3300031665 Bacteria 2121
180 Ga0265342_10004067 3300031712 Bacteria 11666
181 Ga0316576_10002130 3300031727 Bacteria 11149
182 Ga0307413_10001294 3300031824 Bacteria 9334
183 Ga0307410_10021885 3300031852 Bacteria 3941
184 Ga0307409_100008647 3300031995 Bacteria 6193
185 Ga0307416_100030491 3300032002 Bacteria 4047
186 Ga0307411_10011533 3300032005 Bacteria 4776
187 Ga0307415_100036509 3300032126 Bacteria 3221
188 Ga0373936_0001633 3300035113 Bacteria 8219
189 Ga0373955_0017276 3300035172 Bacteria 3567
190 Ga0316574_0000160 3300035398 Bacteria 22013
191 Ga0316574_0061959 3300035398 Bacteria 2350
192 Ga0373935_0063062 3300035692 Bacteria 2375
193 Ga0373937_0155911 3300036401 Bacteria 2140
194 Ga0316584_0019527 3300036712 Bacteria 4900
195 Ga0395900_0121458 3300037418 Bacteria 2680
196 Ga0395898_0083379 3300037466 Bacteria 3081
197 Ga0436365_1175251 3300039437 Bacteria 2135
198 Ga0436363_0552953 3300039450 Bacteria 3212
199 Ga0436362_1055620 3300039453 Bacteria 2828
200 Ga0451798_0126725 3300041458 Unclassified 1281
201 Ga0451802_0788370 3300041460 Bacteria 2048
202 Ga0451807_1321294 3300041486 Bacteria 2825
203 Ga0451833_0954513 3300041491 Bacteria 3158
204 Ga0451853_0929775 3300041512 Bacteria 1357
205 Ga0450896_004187 3300042133 Bacteria 1950
206 Ga0451577_0081946 3300042876 Bacteria 2878
207 Ga0453683_0038094 3300044673 Bacteria 3023
208 Ga0466966_0054678 3300044684 Bacteria 2529
209 Ga0453684_0032019 3300044712 Bacteria 7373
210 Ga0451576_0063432 3300045051 Bacteria 3851
211 Ga0451576_0338290 3300045051 Bacteria 1575
212 Ga0451576_0498327 3300045051 Bacteria 1279
213 Ga0495590_0001530 3300046457 Bacteria 9947
214 Ga0495638_0019520 3300046460 Bacteria 4485
215 Ga0495650_0022133 3300046471 Bacteria 3054
216 Ga0495616_0001135 3300046513 Bacteria 18863
217 Ga0495620_0025443 3300046515 Bacteria 2800
218 Ga0495632_0031546 3300046519 Bacteria 2738
219 Ga0495632_0052298 3300046519 Bacteria 2009
220 Ga0495640_0169077 3300046533 Bacteria 1397
221 Ga0495622_0094974 3300046557 Bacteria 1369
222 Ga0495668_0113243 3300046616 Bacteria 1484
223 Ga0495625_0026823 3300046660 Bacteria 4345
224 Ga0495625_0039985 3300046660 Bacteria 3423
225 Ga0495658_0248428 3300046683 Bacteria 1118
226 Ga0495680_0032831 3300047322 Bacteria 4209
227 Ga0495686_0119663 3300047472 Bacteria 1571
228 Ga0496100_0003190 3300048903 Bacteria 8517
229 Ga0496104_0001751 3300048907 Bacteria 18751
230 Ga0496105_0094524 3300048908 Bacteria 2468
231 Ga0496114_0007658 3300048917 Bacteria 8539
232 Ga0496115_0001316 3300048918 Bacteria 17701
233 Ga0496117_0070101 3300048920 Bacteria 2357
234 Ga0496118_0121329 3300048921 Bacteria 1703
235 Ga0495682_0083956 3300049460 Bacteria 1145
236 Ga0501033_0122066 3300049570 Bacteria 1890
237 Ga0501036_0014576 3300049572 Bacteria 6546
238 Ga0501038_0108132 3300049574 Bacteria 2306
239 Ga0501039_0005353 3300049575 Bacteria 9708
240 Ga0501039_0091913 3300049575 Bacteria 2365
241 Ga0501040_0002598 3300049576 Bacteria 11640
242 Ga0501040_0056150 3300049576 Bacteria 2701
243 Ga0501041_0000332 3300049577 Bacteria 23057
244 Ga0501041_0051872 3300049577 Bacteria 2500
245 Ga0501042_0061397 3300049578 Bacteria 2685
246 Ga0501042_0132801 3300049578 Bacteria 1794
247 Ga0501042_0154380 3300049578 Bacteria 1656
248 Ga0501046_0002509 3300049580 Bacteria 17179
249 Ga0501046_0017149 3300049580 Bacteria 6051
250 Ga0501048_0009948 3300049582 Bacteria 7122
251 Ga0501048_0175344 3300049582 Bacteria 1519
252 Ga0501067_0020497 3300049583 Bacteria 3659
253 Ga0501068_0002980 3300049584 Bacteria 9023
254 Ga0501068_0130776 3300049584 Bacteria 1569
255 Ga0501069_0064973 3300049585 Bacteria 2040
256 Ga0501070_0048932 3300049586 Bacteria 3510
257 Ga0501071_0076446 3300049587 Bacteria 2445
258 Ga0501071_0087084 3300049587 Bacteria 2291
259 Ga0501072_0002452 3300049588 Bacteria 13897
260 Ga0501072_0015872 3300049588 Bacteria 5773
261 Ga0501072_0181215 3300049588 Bacteria 1680
262 Ga0501073_0072703 3300049589 Bacteria 2395
263 Ga0501075_0002169 3300049591 Bacteria 13003
264 Ga0501075_0282277 3300049591 Bacteria 1265
265 Ga0501076_0001585 3300049592 Bacteria 15292
266 Ga0501076_0008658 3300049592 Bacteria 7469
267 Ga0501076_0010007 3300049592 Bacteria 7016
268 Ga0501077_0001114 3300049593 Bacteria 16189
269 Ga0501077_0022439 3300049593 Bacteria 3998
270 Ga0501077_0077220 3300049593 Bacteria 2109
271 Ga0501079_0000692 3300049741 Bacteria 22699
272 Ga0501079_0001314 3300049741 Bacteria 17469
273 Ga0501079_0027688 3300049741 Bacteria 4347
274 Ga0501080_0006124 3300049742 Bacteria 10787
275 Ga0501080_0010592 3300049742 Bacteria 8439
276 Ga0501080_0013825 3300049742 Bacteria 7431
277 Ga0501080_0253924 3300049742 Bacteria 1603
278 Ga0501081_0001068 3300049743 Bacteria 16465
279 Ga0501083_0004157 3300049744 Bacteria 10197
280 Ga0501083_0044721 3300049744 Bacteria 2997
281 Ga0501083_0148409 3300049744 Bacteria 1535
282 Ga0501045_0001672 3300049824 Bacteria 14914
283 Ga0501045_0007090 3300049824 Bacteria 7770
284 Ga0501045_0132304 3300049824 Bacteria 1854
285 nmdc:mga05p37_25748_c1 3300050507 Bacteria 7155
286 nmdc:mga09592_16296_c1 3300050508 Bacteria 6077
287 nmdc:mga0qj67_48096_c1 3300050509 Bacteria 3369
288 nmdc:mga06r32_2365_c1 3300050510 Bacteria 16895
289 nmdc:mga06r32_37288_c1 3300050510 Bacteria 4599
290 nmdc:mga08y16_89641_c1 3300050511 Bacteria 3205
291 Ga0495601_0104625 3300053077 Bacteria 1830
292 Ga0495612_0096336 3300053078 Bacteria 1257
293 Ga0500644_0017211 3300053088 Bacteria 2094
294 Ga0500646_0034244 3300053090 Bacteria 1408
295 Ga0500583_0019660 3300053092 Bacteria 2773
296 Ga0500588_0001230 3300053146 Bacteria 4753
297 Ga0500622_0009293 3300053156 Bacteria 5448
298 Ga0500656_002015 3300053732 Bacteria 1807
299 Ga0501084_0001572 3300054114 Bacteria 18081
300 Ga0501084_0005020 3300054114 Bacteria 10822
301 Ga0501084_0140120 3300054114 Bacteria 2036
302 Ga0501082_0002740 3300060353 Bacteria 15399
303 Ga0501082_0003947 3300060353 Bacteria 12948
304 Ga0530510_0000573 3300061734 Bacteria 23717
305 Ga0530510_0010863 3300061734 Bacteria 6387
306 Ga0530510_0128716 3300061734 Bacteria 1862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10036587 Ga0207707_100365876 284
2 3300031456 Ga0307513_10072274 Ga0307513_100722744 290
3 3300014969 Ga0157376_10502857 Ga0157376_105028571 296
4 3300049460 Ga0495682_0083956 Ga0495682_0083956_28_924 296
5 3300048921 Ga0496118_0121329 Ga0496118_0121329_451_1368 301
6 3300006844 Ga0075428_100007063 Ga0075428_1000070638 309
7 3300006847 Ga0075431_100000064 Ga0075431_1000000648 309
8 3300006880 Ga0075429_100008499 Ga0075429_1000084996 309
9 3300009094 Ga0111539_10002612 Ga0111539_100026127 309
10 3300028800 Ga0265338_10039257 Ga0265338_100392575 309
11 3300036401 Ga0373937_0155911 Ga0373937_0155911_446_1375 309
12 3300050507 nmdc:mga05p37_25748_c1 nmdc:mga05p37_25748_c1_1899_2828 309
13 3300050508 nmdc:mga09592_16296_c1 nmdc:mga09592_16296_c1_2542_3471 309
14 3300050510 nmdc:mga06r32_2365_c1 nmdc:mga06r32_2365_c1_9156_10085 309
15 3300006173 Ga0070716_100006687 Ga0070716_1000066872 310
16 3300007265 Ga0099794_10074358 Ga0099794_100743582 310
17 3300007788 Ga0099795_10000372 Ga0099795_100003727 310
18 3300009093 Ga0105240_10033167 Ga0105240_100331673 310
19 3300009545 Ga0105237_10517597 Ga0105237_105175971 310
20 3300013105 Ga0157369_10006257 Ga0157369_100062577 310
21 3300025939 Ga0207665_10031118 Ga0207665_100311185 310
22 3300047322 Ga0495680_0032831 Ga0495680_0032831_1909_2841 310
23 3300009094 Ga0111539_10374038 Ga0111539_103740382 311
24 3300009148 Ga0105243_10266072 Ga0105243_102660722 311
25 3300009093 Ga0105240_10003246 Ga0105240_1000324616 312
26 3300009177 Ga0105248_10127282 Ga0105248_101272822 312
27 3300009545 Ga0105237_10062987 Ga0105237_100629872 312
28 3300009551 Ga0105238_10469353 Ga0105238_104693531 312
29 3300013297 Ga0157378_10256025 Ga0157378_102560252 312
30 3300039450 Ga0436363_0552953 Ga0436363_0552953_1888_2826 312
31 3300039453 Ga0436362_1055620 Ga0436362_1055620_1851_2813 312
32 3300041458 Ga0451798_0126725 Ga0451798_0126725_206_1144 312
33 3300041460 Ga0451802_0788370 Ga0451802_0788370_524_1462 312
34 3300041512 Ga0451853_0929775 Ga0451853_0929775_170_1108 312
35 3300046515 Ga0495620_0025443 Ga0495620_0025443_590_1528 312
36 3300047472 Ga0495686_0119663 Ga0495686_0119663_585_1523 312
37 3300061734 Ga0530510_0128716 Ga0530510_0128716_187_1128 312
38 3300050510 nmdc:mga06r32_37288_c1 nmdc:mga06r32_37288_c1_752_1699 315
39 3300025913 Ga0207695_10092422 Ga0207695_100924224 316
40 3300044673 Ga0453683_0038094 Ga0453683_0038094_181_1173 317
41 3300044712 Ga0453684_0032019 Ga0453684_0032019_2224_3216 317
42 3300045051 Ga0451576_0063432 Ga0451576_0063432_2002_2994 317
43 3300046471 Ga0495650_0022133 Ga0495650_0022133_1061_2014 317
44 3300014968 Ga0157379_10000588 Ga0157379_1000058816 318
45 3300046533 Ga0495640_0169077 Ga0495640_0169077_101_1057 318
46 3300046683 Ga0495658_0248428 Ga0495658_0248428_87_1043 318
47 3300005347 Ga0070668_100037548 Ga0070668_1000375482 319
48 3300005353 Ga0070669_100094170 Ga0070669_1000941702 319
49 3300005354 Ga0070675_100159388 Ga0070675_1001593882 319
50 3300006846 Ga0075430_100246610 Ga0075430_1002466102 319
51 3300014326 Ga0157380_10224077 Ga0157380_102240771 319
52 3300025926 Ga0207659_10069164 Ga0207659_100691644 319
53 3300025960 Ga0207651_10013697 Ga0207651_100136972 319
54 3300031507 Ga0307509_10000051 Ga0307509_10000051127 319
55 3300031665 Ga0316575_10030108 Ga0316575_100301081 319
56 3300031727 Ga0316576_10002130 Ga0316576_100021305 319
57 3300035398 Ga0316574_0000160 Ga0316574_0000160_7549_8511 319
58 3300035398 Ga0316574_0061959 Ga0316574_0061959_179_1138 319
59 3300036712 Ga0316584_0019527 Ga0316584_0019527_2702_3664 319
60 3300041491 Ga0451833_0954513 Ga0451833_0954513_155_1117 319
61 3300046616 Ga0495668_0113243 Ga0495668_0113243_396_1355 319
62 3300050509 nmdc:mga0qj67_48096_c1 nmdc:mga0qj67_48096_c1_2277_3236 319
63 3300005439 Ga0070711_100003459 Ga0070711_1000034592 320
64 3300005546 Ga0070696_100030651 Ga0070696_1000306511 320
65 3300005937 Ga0081455_10001360 Ga0081455_1000136018 320
66 3300005937 Ga0081455_10020730 Ga0081455_100207304 320
67 3300025913 Ga0207695_10033369 Ga0207695_100333693 320
68 3300025916 Ga0207663_10004735 Ga0207663_100047355 320
69 3300025917 Ga0207660_10066722 Ga0207660_100667223 320
70 3300025928 Ga0207700_10072835 Ga0207700_100728352 320
71 3300025949 Ga0207667_10190297 Ga0207667_101902971 320
72 3300028016 Ga0265354_1001198 Ga0265354_10011984 320
73 3300030878 Ga0265770_1000816 Ga0265770_10008165 320
74 3300031090 Ga0265760_10000560 Ga0265760_100005607 320
75 3300035692 Ga0373935_0063062 Ga0373935_0063062_169_1137 320
76 3300037418 Ga0395900_0121458 Ga0395900_0121458_405_1367 320
77 3300037466 Ga0395898_0083379 Ga0395898_0083379_1374_2336 320
78 3300041486 Ga0451807_1321294 Ga0451807_1321294_1263_2237 320
79 3300044684 Ga0466966_0054678 Ga0466966_0054678_1270_2232 320
80 3300048903 Ga0496100_0003190 Ga0496100_0003190_5415_6383 320
81 3300048907 Ga0496104_0001751 Ga0496104_0001751_13068_14036 320
82 3300048908 Ga0496105_0094524 Ga0496105_0094524_365_1333 320
83 3300048917 Ga0496114_0007658 Ga0496114_0007658_2128_3096 320
84 3300048918 Ga0496115_0001316 Ga0496115_0001316_13248_14216 320
85 3300053077 Ga0495601_0104625 Ga0495601_0104625_606_1574 320
86 3300053088 Ga0500644_0017211 Ga0500644_0017211_189_1151 320
87 3300053090 Ga0500646_0034244 Ga0500646_0034244_95_1057 320
88 3300053092 Ga0500583_0019660 Ga0500583_0019660_595_1557 320
89 3300053146 Ga0500588_0001230 Ga0500588_0001230_2083_3045 320
90 3300053156 Ga0500622_0009293 Ga0500622_0009293_2427_3389 320
91 3300053732 Ga0500656_002015 Ga0500656_002015_143_1105 320
92 3300005345 Ga0070692_10084932 Ga0070692_100849322 321
93 3300005347 Ga0070668_100008997 Ga0070668_1000089976 321
94 3300005354 Ga0070675_100202372 Ga0070675_1002023722 321
95 3300005356 Ga0070674_100003114 Ga0070674_1000031146 321
96 3300005457 Ga0070662_100027828 Ga0070662_1000278282 321
97 3300005459 Ga0068867_100007569 Ga0068867_1000075695 321
98 3300005543 Ga0070672_100017646 Ga0070672_1000176462 321
99 3300005564 Ga0070664_100187531 Ga0070664_1001875312 321
100 3300005577 Ga0068857_100132473 Ga0068857_1001324732 321
101 3300005615 Ga0070702_100022564 Ga0070702_1000225644 321
102 3300005719 Ga0068861_100002198 Ga0068861_1000021985 321
103 3300005719 Ga0068861_100174852 Ga0068861_1001748522 321
104 3300006358 Ga0068871_100007480 Ga0068871_1000074809 321
105 3300006847 Ga0075431_100070460 Ga0075431_1000704605 321
106 3300006881 Ga0068865_100253259 Ga0068865_1002532592 321
107 3300009094 Ga0111539_10130193 Ga0111539_101301932 321
108 3300009553 Ga0105249_10057034 Ga0105249_100570344 321
109 3300013308 Ga0157375_10123569 Ga0157375_101235692 321
110 3300014325 Ga0163163_10024438 Ga0163163_100244382 321
111 3300025907 Ga0207645_10000594 Ga0207645_100005946 321
112 3300025917 Ga0207660_10039440 Ga0207660_100394402 321
113 3300025918 Ga0207662_10087360 Ga0207662_100873602 321
114 3300025923 Ga0207681_10023649 Ga0207681_100236495 321
115 3300025933 Ga0207706_10015520 Ga0207706_100155206 321
116 3300025938 Ga0207704_10028471 Ga0207704_100284714 321
117 3300025940 Ga0207691_10005609 Ga0207691_100056096 321
118 3300025945 Ga0207679_10070944 Ga0207679_100709442 321
119 3300025945 Ga0207679_10266736 Ga0207679_102667362 321
120 3300025960 Ga0207651_10180591 Ga0207651_101805912 321
121 3300025961 Ga0207712_10163760 Ga0207712_101637603 321
122 3300025972 Ga0207668_10279140 Ga0207668_102791402 321
123 3300026075 Ga0207708_10138458 Ga0207708_101384583 321
124 3300026089 Ga0207648_10001676 Ga0207648_1000167620 321
125 3300026118 Ga0207675_100001477 Ga0207675_10000147720 321
126 3300027665 Ga0209983_1002343 Ga0209983_10023435 321
127 3300027682 Ga0209971_1000520 Ga0209971_10005202 321
128 3300027717 Ga0209998_10000392 Ga0209998_1000039211 321
129 3300027876 Ga0209974_10009217 Ga0209974_100092172 321
130 3300027907 Ga0207428_10072802 Ga0207428_100728024 321
131 3300031548 Ga0307408_100042027 Ga0307408_1000420271 321
132 3300031995 Ga0307409_100008647 Ga0307409_1000086477 321
133 3300032126 Ga0307415_100036509 Ga0307415_1000365095 321
134 3300035172 Ga0373955_0017276 Ga0373955_0017276_1423_2388 321
135 3300039437 Ga0436365_1175251 Ga0436365_1175251_224_1189 321
136 3300042133 Ga0450896_004187 Ga0450896_004187_672_1640 321
137 3300049575 Ga0501039_0091913 Ga0501039_0091913_119_1087 321
138 3300049588 Ga0501072_0181215 Ga0501072_0181215_337_1305 321
139 3300049742 Ga0501080_0253924 Ga0501080_0253924_430_1398 321
140 3300005331 Ga0070670_100153208 Ga0070670_1001532082 322
141 3300005333 Ga0070677_10002356 Ga0070677_100023566 322
142 3300005333 Ga0070677_10003653 Ga0070677_100036535 322
143 3300005334 Ga0068869_100048801 Ga0068869_1000488013 322
144 3300005337 Ga0070682_100012736 Ga0070682_1000127363 322
145 3300005337 Ga0070682_100092797 Ga0070682_1000927973 322
146 3300005337 Ga0070682_100144218 Ga0070682_1001442182 322
147 3300005337 Ga0070682_100214256 Ga0070682_1002142562 322
148 3300005356 Ga0070674_100021676 Ga0070674_1000216765 322
149 3300005434 Ga0070709_10016254 Ga0070709_100162542 322
150 3300005435 Ga0070714_100039412 Ga0070714_1000394125 322
151 3300005438 Ga0070701_10032210 Ga0070701_100322103 322
152 3300005441 Ga0070700_100007280 Ga0070700_1000072805 322
153 3300005441 Ga0070700_100090204 Ga0070700_1000902042 322
154 3300005455 Ga0070663_100078687 Ga0070663_1000786873 322
155 3300005456 Ga0070678_100031684 Ga0070678_1000316843 322
156 3300005456 Ga0070678_100032755 Ga0070678_1000327552 322
157 3300005459 Ga0068867_100025017 Ga0068867_1000250173 322
158 3300005543 Ga0070672_100068104 Ga0070672_1000681042 322
159 3300005543 Ga0070672_100091289 Ga0070672_1000912892 322
160 3300005545 Ga0070695_100008677 Ga0070695_1000086774 322
161 3300005563 Ga0068855_100001758 Ga0068855_1000017586 322
162 3300005578 Ga0068854_100154717 Ga0068854_1001547172 322
163 3300005615 Ga0070702_100194768 Ga0070702_1001947681 322
164 3300005617 Ga0068859_100024476 Ga0068859_1000244765 322
165 3300005618 Ga0068864_100051067 Ga0068864_1000510672 322
166 3300005719 Ga0068861_100009183 Ga0068861_1000091832 322
167 3300005719 Ga0068861_100013894 Ga0068861_1000138945 322
168 3300005840 Ga0068870_10016246 Ga0068870_100162465 322
169 3300005841 Ga0068863_100013079 Ga0068863_1000130794 322
170 3300005843 Ga0068860_100032735 Ga0068860_1000327355 322
171 3300006881 Ga0068865_100115472 Ga0068865_1001154721 322
172 3300006931 Ga0097620_100024476 Ga0097620_1000244765 322
173 3300009551 Ga0105238_10071290 Ga0105238_100712902 322
174 3300010159 Ga0099796_10000028 Ga0099796_1000002827 322
175 3300013308 Ga0157375_10007538 Ga0157375_100075386 322
176 3300014326 Ga0157380_10066615 Ga0157380_100666152 322
177 3300025893 Ga0207682_10004182 Ga0207682_100041822 322
178 3300025906 Ga0207699_10000973 Ga0207699_1000097310 322
179 3300025907 Ga0207645_10152108 Ga0207645_101521082 322
180 3300025908 Ga0207643_10020976 Ga0207643_100209764 322
181 3300025913 Ga0207695_10017216 Ga0207695_100172166 322
182 3300025926 Ga0207659_10082582 Ga0207659_100825823 322
183 3300025926 Ga0207659_10101824 Ga0207659_101018242 322
184 3300025926 Ga0207659_10224439 Ga0207659_102244392 322
185 3300025929 Ga0207664_10195234 Ga0207664_101952341 322
186 3300025935 Ga0207709_10043560 Ga0207709_100435604 322
187 3300025936 Ga0207670_10026409 Ga0207670_100264093 322
188 3300025938 Ga0207704_10167139 Ga0207704_101671392 322
189 3300025940 Ga0207691_10002419 Ga0207691_1000241911 322
190 3300025940 Ga0207691_10007621 Ga0207691_100076215 322
191 3300025940 Ga0207691_10034113 Ga0207691_100341135 322
192 3300025940 Ga0207691_10082707 Ga0207691_100827073 322
193 3300025941 Ga0207711_10049450 Ga0207711_100494505 322
194 3300025942 Ga0207689_10003161 Ga0207689_100031616 322
195 3300025942 Ga0207689_10107822 Ga0207689_101078222 322
196 3300025942 Ga0207689_10116390 Ga0207689_101163902 322
197 3300025945 Ga0207679_10087690 Ga0207679_100876902 322
198 3300025949 Ga0207667_10017041 Ga0207667_100170416 322
199 3300025960 Ga0207651_10011291 Ga0207651_100112915 322
200 3300025972 Ga0207668_10084310 Ga0207668_100843103 322
201 3300026067 Ga0207678_10066406 Ga0207678_100664062 322
202 3300026075 Ga0207708_10012686 Ga0207708_100126865 322
203 3300026088 Ga0207641_10006868 Ga0207641_100068686 322
204 3300026088 Ga0207641_10164808 Ga0207641_101648082 322
205 3300026089 Ga0207648_10102654 Ga0207648_101026543 322
206 3300026095 Ga0207676_10098694 Ga0207676_100986942 322
207 3300026095 Ga0207676_10183371 Ga0207676_101833712 322
208 3300026118 Ga0207675_100014735 Ga0207675_1000147355 322
209 3300026118 Ga0207675_100024382 Ga0207675_1000243825 322
210 3300026118 Ga0207675_100653746 Ga0207675_1006537462 322
211 3300026121 Ga0207683_10004100 Ga0207683_100041008 322
212 3300027512 Ga0209179_1000141 Ga0209179_10001414 322
213 3300027907 Ga0207428_10184024 Ga0207428_101840242 322
214 3300028379 Ga0268266_10003298 Ga0268266_100032986 322
215 3300028379 Ga0268266_10012000 Ga0268266_100120008 322
216 3300028379 Ga0268266_10137179 Ga0268266_101371791 322
217 3300028380 Ga0268265_10163848 Ga0268265_101638482 322
218 3300028573 Ga0265334_10000136 Ga0265334_1000013648 322
219 3300028577 Ga0265318_10000421 Ga0265318_1000042111 322
220 3300028800 Ga0265338_10007730 Ga0265338_100077307 322
221 3300031238 Ga0265332_10088796 Ga0265332_100887961 322
222 3300031239 Ga0265328_10000985 Ga0265328_100009859 322
223 3300031239 Ga0265328_10005460 Ga0265328_100054602 322
224 3300031240 Ga0265320_10020388 Ga0265320_100203885 322
225 3300031241 Ga0265325_10018562 Ga0265325_100185625 322
226 3300031249 Ga0265339_10022303 Ga0265339_100223035 322
227 3300031344 Ga0265316_10010914 Ga0265316_1001091411 322
228 3300031344 Ga0265316_10027384 Ga0265316_100273843 322
229 3300031456 Ga0307513_10004634 Ga0307513_100046347 322
230 3300031456 Ga0307513_10012255 Ga0307513_100122552 322
231 3300031456 Ga0307513_10155016 Ga0307513_101550162 322
232 3300031507 Ga0307509_10000023 Ga0307509_10000023172 322
233 3300031595 Ga0265313_10002962 Ga0265313_1000296215 322
234 3300031712 Ga0265342_10004067 Ga0265342_100040676 322
235 3300031824 Ga0307413_10001294 Ga0307413_100012946 322
236 3300031852 Ga0307410_10021885 Ga0307410_100218855 322
237 3300032002 Ga0307416_100030491 Ga0307416_1000304912 322
238 3300032005 Ga0307411_10011533 Ga0307411_100115335 322
239 3300035113 Ga0373936_0001633 Ga0373936_0001633_4893_5867 322
240 3300042876 Ga0451577_0081946 Ga0451577_0081946_129_1106 322
241 3300045051 Ga0451576_0338290 Ga0451576_0338290_37_1014 322
242 3300045051 Ga0451576_0498327 Ga0451576_0498327_121_1104 322
243 3300046457 Ga0495590_0001530 Ga0495590_0001530_7685_8659 322
244 3300046460 Ga0495638_0019520 Ga0495638_0019520_2857_3825 322
245 3300046513 Ga0495616_0001135 Ga0495616_0001135_5045_6013 322
246 3300046519 Ga0495632_0031546 Ga0495632_0031546_376_1440 322
247 3300046519 Ga0495632_0052298 Ga0495632_0052298_456_1424 322
248 3300046557 Ga0495622_0094974 Ga0495622_0094974_131_1099 322
249 3300046660 Ga0495625_0026823 Ga0495625_0026823_2372_3340 322
250 3300046660 Ga0495625_0039985 Ga0495625_0039985_715_1683 322
251 3300048920 Ga0496117_0070101 Ga0496117_0070101_1077_2057 322
252 3300049570 Ga0501033_0122066 Ga0501033_0122066_766_1737 322
253 3300049572 Ga0501036_0014576 Ga0501036_0014576_36_1007 322
254 3300049574 Ga0501038_0108132 Ga0501038_0108132_870_1841 322
255 3300049575 Ga0501039_0005353 Ga0501039_0005353_944_1915 322
256 3300049576 Ga0501040_0002598 Ga0501040_0002598_457_1428 322
257 3300049576 Ga0501040_0056150 Ga0501040_0056150_462_1433 322
258 3300049577 Ga0501041_0000332 Ga0501041_0000332_6853_7824 322
259 3300049577 Ga0501041_0051872 Ga0501041_0051872_311_1282 322
260 3300049578 Ga0501042_0061397 Ga0501042_0061397_1545_2516 322
261 3300049578 Ga0501042_0132801 Ga0501042_0132801_422_1393 322
262 3300049578 Ga0501042_0154380 Ga0501042_0154380_519_1490 322
263 3300049580 Ga0501046_0002509 Ga0501046_0002509_13166_14137 322
264 3300049580 Ga0501046_0017149 Ga0501046_0017149_4837_5808 322
265 3300049582 Ga0501048_0009948 Ga0501048_0009948_3023_3994 322
266 3300049582 Ga0501048_0175344 Ga0501048_0175344_82_1053 322
267 3300049583 Ga0501067_0020497 Ga0501067_0020497_2602_3570 322
268 3300049584 Ga0501068_0002980 Ga0501068_0002980_6086_7054 322
269 3300049584 Ga0501068_0130776 Ga0501068_0130776_440_1411 322
270 3300049585 Ga0501069_0064973 Ga0501069_0064973_738_1709 322
271 3300049586 Ga0501070_0048932 Ga0501070_0048932_1327_2295 322
272 3300049587 Ga0501071_0076446 Ga0501071_0076446_1057_2028 322
273 3300049587 Ga0501071_0087084 Ga0501071_0087084_1061_2029 322
274 3300049588 Ga0501072_0002452 Ga0501072_0002452_5346_6317 322
275 3300049588 Ga0501072_0015872 Ga0501072_0015872_4365_5336 322
276 3300049589 Ga0501073_0072703 Ga0501073_0072703_1249_2235 322
277 3300049591 Ga0501075_0002169 Ga0501075_0002169_10358_11329 322
278 3300049591 Ga0501075_0282277 Ga0501075_0282277_28_996 322
279 3300049592 Ga0501076_0001585 Ga0501076_0001585_13663_14634 322
280 3300049592 Ga0501076_0008658 Ga0501076_0008658_4119_5090 322
281 3300049592 Ga0501076_0010007 Ga0501076_0010007_3487_4455 322
282 3300049593 Ga0501077_0001114 Ga0501077_0001114_10005_10976 322
283 3300049593 Ga0501077_0022439 Ga0501077_0022439_537_1505 322
284 3300049593 Ga0501077_0077220 Ga0501077_0077220_206_1177 322
285 3300049741 Ga0501079_0000692 Ga0501079_0000692_14970_15938 322
286 3300049741 Ga0501079_0001314 Ga0501079_0001314_919_1890 322
287 3300049741 Ga0501079_0027688 Ga0501079_0027688_1110_2081 322
288 3300049742 Ga0501080_0006124 Ga0501080_0006124_2748_3719 322
289 3300049742 Ga0501080_0010592 Ga0501080_0010592_6605_7576 322
290 3300049742 Ga0501080_0013825 Ga0501080_0013825_4260_5228 322
291 3300049743 Ga0501081_0001068 Ga0501081_0001068_7316_8287 322
292 3300049744 Ga0501083_0004157 Ga0501083_0004157_422_1390 322
293 3300049744 Ga0501083_0044721 Ga0501083_0044721_1661_2632 322
294 3300049744 Ga0501083_0148409 Ga0501083_0148409_280_1251 322
295 3300049824 Ga0501045_0001672 Ga0501045_0001672_12089_13060 322
296 3300049824 Ga0501045_0007090 Ga0501045_0007090_181_1152 322
297 3300049824 Ga0501045_0132304 Ga0501045_0132304_212_1183 322
298 3300050511 nmdc:mga08y16_89641_c1 nmdc:mga08y16_89641_c1_464_1432 322
299 3300053078 Ga0495612_0096336 Ga0495612_0096336_93_1079 322
300 3300054114 Ga0501084_0001572 Ga0501084_0001572_7205_8176 322
301 3300054114 Ga0501084_0005020 Ga0501084_0005020_7597_8568 322
302 3300054114 Ga0501084_0140120 Ga0501084_0140120_132_1100 322
303 3300060353 Ga0501082_0002740 Ga0501082_0002740_8155_9126 322
304 3300060353 Ga0501082_0003947 Ga0501082_0003947_8712_9683 322
305 3300061734 Ga0530510_0000573 Ga0530510_0000573_7716_8687 322
306 3300061734 Ga0530510_0010863 Ga0530510_0010863_1269_2240 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02951

GSH-S_N

Prokaryotic glutathione synthetase, N-terminal domain

37

155

0.99

PF02955

GSH-S_ATP

Prokaryotic glutathione synthetase, ATP-grasp domain

159

334

0.98

PF08443

RimK

RimK-like ATP-grasp domain

171

345

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2glt-assembly1.cif.gz_A structure of escherichia coli glutathione synthetase at ph 6.0. 0.9635 4 318
1glv-assembly1.cif.gz_A three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution 0.9602 4 319
1gsa-assembly1.cif.gz_A structure of glutathione synthetase complexed with adp and glutathione 0.9581 4 317
1glv-assembly1.cif.gz_A three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution 0.954 4 319
2glt-assembly1.cif.gz_A structure of escherichia coli glutathione synthetase at ph 6.0. 0.954 4 318
ID Description Score Start End Superfamily
af_P04425_1_111_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9736 4 114 3.40.50.20
af_P04425_1_111_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9651 4 114 3.40.50.20
2gltA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9444 140 203 3.30.1490.20
af_P04425_124_309_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9322 127 312 3.30.360.10
af_P04425_124_309_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9226 127 312 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A356PNH3-F1-model_v4 deleted 0.9915 4 79
AF-A0A520U7Y0-F1-model_v4 Glutathione synthase (EC 6.3.2.3) 0.9908 5 80 GO:0004363
AF-A0A350JDX7-F1-model_v4 deleted 0.987 4 78
AF-A0A7Z9QIL4-F1-model_v4 Prokaryotic glutathione synthetase N-terminal domain-containing protein 0.9865 4 80 GO:0004363
AF-A0A2G6L7H6-F1-model_v4 Glutathione synthase 0.9832 4 110 GO:0004363

Feature Viewer

pLDDT pTM Quality
88.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map