F398451

General Info

Members Datasets Scaffolds Average Seq Length
306 206 277 543

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1001427|Ga0055526_10014273
Length 586
Sequence MNTTASLSSPFLIPSSPRRRGSRVAKVLALLPWIPACAGMTMGLAAIPATAQPVATFSSFTYSGKDASDLLTAGPNDYRNPVLKGFYPDPSVTRVGDDFYLVNSTFSYFPGIPVFHSRDLVHWAQIGNAIDRPGQLDFKQLGLSRGVFAPSIQARDGIFYLLNTCVDCGDNFLLTAKNPAGPWSDPVWLPDLKGGIDPSMFFDDDGRTWVVNNGPPEGKPLYEGHRAIWIQEFDRKTLRTFGPRKVLVNGGIDLSKKPIWIEGPHIFRKDGWYYLSCAEGGTAEGHSQVILRSKSVTGPYEAWSGNPILTQRDLAADRPMPITSAGHAQLVTTPDGKWWATFLAVRPYAGDFYTTGRETFLLPVEWKDGWPVILPPATAIPWTHARPALPQGKAPIPTSGAFTLRDDFRGKLPAYWMMLRNPRDDWYRTGAAGLMLKARPVGLGDNANPSFLARRQQHTNAVAETMVQFAPEKEGDRAGLVVLQNDDYWFFVGRKRVNGKDVITVDQREGPDSPRLGKTLFTAAAPAGTVRLRIAVQGRSYAFSYAAPGARPAWKPLGKIDTDSLTTKVAGGFVGSVFGLFAGAGE

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541297 Duganella sp. GV083 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738541357 Duganella sp. GV053 Isolate Unclassified
6 2738543003 Duganella sp. GV066 Isolate Unclassified
7 2738543026 Duganella sp. GV089 Isolate Unclassified
8 2738543029 Duganella sp. GV039 Isolate Unclassified
9 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
10 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2821131069 Duganella sp. 1224 Isolate Unclassified
13 2842711865 Duganella sp. R-73148 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2857558681 Duganella sp. R-74565 Isolate Unclassified
22 2857564685 Duganella sp. R-74599 Isolate Unclassified
23 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
24 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
25 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
26 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
27 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
28 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
29 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
30 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
31 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
203 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.2
Metatranscriptomes 0
Isolates 9.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.92
Nodule 0
Rhizoplane 0.65
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c001230 3300000041 Bacteria 2617
2 JGI25150J39212_1000582 3300002774 Bacteria 14421
3 JGI25153J46596_10000260 3300003215 Bacteria 42298
4 JGI25153J46596_10012909 3300003215 Bacteria 3567
5 rootH1_10020653 3300003316 Bacteria 20480
6 rootH2_10021495 3300003320 Bacteria 59568
7 rootL2_10000935 3300003322 Bacteria 11758
8 rootL2_10003822 3300003322 Bacteria 68632
9 rootL2_10012685 3300003322 Bacteria 5262
10 rootH1_10000877 3300003316 Bacteria 19081
11 rootH1_10000877 3300003323 Bacteria 40245
12 rootH1_10009812 3300003323 Unclassified 3243
13 rootH1_10011789 3300003323 Bacteria 124621
14 rootH1_10035305 3300003323 Bacteria 13858
15 rootH1_10059214 3300003323 Bacteria 6013
16 Ga0055529_1000341 3300003763 Bacteria 52197
17 Ga0055526_1000029 3300003771 Bacteria 148855
18 Ga0055526_1001427 3300003771 Bacteria 17011
19 Ga0055537_1000161 3300003773 Bacteria 50226
20 Ga0055524_1000110 3300003775 Bacteria 99255
21 Ga0055530_10000074 3300003791 Bacteria 85116
22 Ga0055530_10008826 3300003791 Bacteria 3972
23 Ga0055540_1005064 3300003792 Bacteria 5700
24 Ga0055540_1009090 3300003792 Bacteria 3483
25 Ga0055531_10000374 3300003794 Bacteria 43198
26 Ga0055531_10001873 3300003794 Bacteria 14758
27 Ga0055531_10002640 3300003794 Bacteria 11857
28 Ga0065165_1000459 3300005262 Bacteria 63870
29 Ga0065165_1001172 3300005262 Bacteria 30464
30 Ga0065165_1001720 3300005262 Bacteria 21926
31 Ga0065165_1012896 3300005262 Bacteria 3363
32 Ga0065714_10064423 3300005288 Bacteria 257266
33 Ga0070682_100030897 3300005337 Bacteria 3237
34 Ga0070660_100006806 3300005339 Bacteria 7933
35 Ga0070661_100000006 3300005344 Bacteria 216544
36 Ga0070667_100059957 3300005367 Bacteria 3220
37 Ga0070711_100062324 3300005439 Unclassified 2599
38 Ga0070685_10012217 3300005466 Bacteria 4507
39 Ga0070679_100005952 3300005530 Bacteria 11338
40 Ga0068856_100002115 3300005614 Bacteria 20611
41 Ga0070717_10000103 3300006028 Bacteria 66530
42 Ga0097621_100082850 3300006237 Bacteria 2672
43 Ga0105237_10000059 3300009545 Bacteria 146569
44 Ga0105238_10001661 3300009551 Bacteria 22342
45 Ga0157371_10000076 3300013102 Bacteria 161805
46 Ga0157370_10001645 3300013104 Bacteria 27598
47 Ga0157370_10092596 3300013104 Bacteria 2837
48 Ga0157370_10130391 3300013104 Bacteria 2345
49 Ga0157369_10000015 3300013105 Bacteria 262917
50 Ga0157374_10026791 3300013296 Bacteria 5191
51 Ga0163163_10039308 3300014325 Bacteria 4617
52 Ga0182006_1000088 3300015261 Bacteria 114232
53 Ga0182006_1000388 3300015261 Bacteria 36326
54 Ga0182007_10000010 3300015262 Bacteria 286070
55 Ga0163161_10000878 3300017792 Bacteria 23391
56 Ga0213873_10000006 3300021358 Bacteria 408723
57 Ga0213876_10000004 3300021384 Bacteria 943822
58 Ga0207425_1000072 3300025245 Bacteria 115017
59 Ga0207425_1000211 3300025245 Bacteria 46314
60 Ga0209129_1002536 3300025258 Bacteria 8864
61 Ga0209565_1000030 3300025263 Bacteria 325058
62 Ga0209565_1000132 3300025263 Bacteria 104716
63 Ga0209455_1000037 3300025272 Bacteria 464097
64 Ga0209673_1000925 3300025273 Bacteria 37051
65 Ga0209676_1010696 3300025292 Bacteria 3784
66 Ga0209025_1000721 3300025294 Bacteria 56094
67 Ga0209564_1000009 3300025295 Bacteria 950196
68 Ga0209564_1000502 3300025295 Bacteria 64443
69 Ga0209564_1010068 3300025295 Bacteria 4407
70 Ga0209758_1000009 3300025297 Bacteria 1123483
71 Ga0209758_1000215 3300025297 Bacteria 125461
72 Ga0209758_1001186 3300025297 Bacteria 32950
73 Ga0209758_1007196 3300025297 Bacteria 7664
74 Ga0209050_1000005 3300025298 Bacteria 1557793
75 Ga0209050_1000039 3300025298 Bacteria 410069
76 Ga0209050_1000049 3300025298 Bacteria 364096
77 Ga0209050_1003793 3300025298 Bacteria 10798
78 Ga0209050_1004719 3300025298 Bacteria 9028
79 Ga0209050_1024795 3300025298 Bacteria 2061
80 Ga0209256_1000046 3300025299 Bacteria 325040
81 Ga0207426_1009796 3300025302 Bacteria 3761
82 Ga0209051_1000377 3300025303 Bacteria 63522
83 Ga0209257_1000051 3300025304 Bacteria 434166
84 Ga0209257_1001706 3300025304 Bacteria 24648
85 Ga0209257_1001841 3300025304 Bacteria 23124
86 Ga0209257_1001876 3300025304 Bacteria 22762
87 Ga0209257_1002030 3300025304 Bacteria 21596
88 Ga0209257_1002036 3300025304 Bacteria 21541
89 Ga0209257_1015748 3300025304 Bacteria 3116
90 Ga0207707_10031698 3300025912 Bacteria 4626
91 Ga0207671_10000064 3300025914 Bacteria 169693
92 Ga0207657_10013554 3300025919 Bacteria 7996
93 Ga0207649_10000058 3300025920 Bacteria 100911
94 Ga0207694_10009544 3300025924 Bacteria 7319
95 Ga0207665_10074913 3300025939 Bacteria 2317
96 Ga0207661_10007163 3300025944 Bacteria 7923
97 Ga0207702_10000731 3300026078 Bacteria 35138
98 Ga0207674_10114407 3300026116 Bacteria 2670
99 Ga0265326_10012280 3300028558 Bacteria 2520
100 Ga0265334_10010789 3300028573 Bacteria 3856
101 Ga0265323_10000448 3300028653 Bacteria 23600
102 Ga0265323_10004166 3300028653 Bacteria 6263
103 Ga0265323_10029628 3300028653 Unclassified 2046
104 Ga0307515_10037816 3300028794 Bacteria 7743
105 Ga0265338_10001667 3300028800 Bacteria 35359
106 Ga0265338_10019425 3300028800 Bacteria 7211
107 Ga0307511_10001468 3300030521 Bacteria 24941
108 Ga0265330_10000707 3300031235 Bacteria 21114
109 Ga0265330_10007580 3300031235 Bacteria 5276
110 Ga0265330_10008054 3300031235 Bacteria 5098
111 Ga0265330_10017471 3300031235 Bacteria 3302
112 Ga0265330_10023041 3300031235 Bacteria 2830
113 Ga0265332_10025239 3300031238 Unclassified 2611
114 Ga0265329_10000088 3300031242 Bacteria 42313
115 Ga0265329_10000106 3300031242 Bacteria 39414
116 Ga0265331_10025960 3300031250 Unclassified 2952
117 Ga0265316_10000160 3300031344 Bacteria 75479
118 Ga0265316_10000175 3300031344 Bacteria 72559
119 Ga0265316_10000603 3300031344 Bacteria 40127
120 Ga0265316_10001195 3300031344 Bacteria 28082
121 Ga0265316_10010446 3300031344 Bacteria 8458
122 Ga0265316_10015342 3300031344 Bacteria 6702
123 Ga0307408_100123964 3300031548 Unclassified 2006
124 Ga0307508_10000027 3300031616 Bacteria 171013
125 Ga0265314_10014809 3300031711 Bacteria 6218
126 Ga0265314_10021892 3300031711 Unclassified 4903
127 Ga0265342_10001516 3300031712 Bacteria 21504
128 Ga0265342_10001752 3300031712 Bacteria 19811
129 Ga0265342_10032822 3300031712 Unclassified 3199
130 Ga0316578_10053443 3300031728 Bacteria 2367
131 Ga0307405_10000013 3300031731 Bacteria 227563
132 Ga0316577_10013778 3300031733 Bacteria 4430
133 Ga0307413_10002767 3300031824 Bacteria 7222
134 Ga0307407_10000024 3300031903 Bacteria 113716
135 Ga0307409_100075640 3300031995 Bacteria 2697
136 Ga0307416_100000037 3300032002 Bacteria 137513
137 Ga0307414_10001797 3300032004 Bacteria 11109
138 Ga0307414_10008467 3300032004 Bacteria 5833
139 Ga0307415_100000511 3300032126 Bacteria 16878
140 Ga0307415_100019408 3300032126 Bacteria 4127
141 Ga0373939_0006545 3300035114 Bacteria 2809
142 Ga0373954_0007247 3300035118 Bacteria 4846
143 Ga0373937_0000835 3300036401 Bacteria 26380
144 Ga0316584_0000058 3300036712 Bacteria 42692
145 Ga0373925_0160832 3300037068 Bacteria 1769
146 Ga0395900_0011733 3300037418 Bacteria 8959
147 Ga0395905_0030653 3300037471 Bacteria 5065
148 Ga0395901_0001184 3300038443 Bacteria 27748
149 Ga0436365_0862833 3300039437 Bacteria 88455
150 Ga0436362_0554113 3300039453 Bacteria 162652
151 Ga0439461_0000015 3300041410 Bacteria 22241
152 Ga0439465_0001953 3300041413 Bacteria 6759
153 Ga0439431_0000089 3300041997 Bacteria 14969
154 Ga0439442_002415 3300042002 Bacteria 3667
155 Ga0439445_0001126 3300042004 Bacteria 5721
156 Ga0439445_0003080 3300042004 Bacteria 3734
157 Ga0439432_001016 3300042006 Bacteria 10605
158 Ga0439462_0000140 3300042015 Bacteria 11659
159 Ga0439434_0000049 3300042435 Bacteria 29298
160 Ga0439434_0009946 3300042435 Bacteria 2800
161 Ga0451577_0003868 3300042876 Bacteria 16253
162 Ga0466966_0037366 3300044684 Bacteria 3132
163 Ga0453684_0000001 3300044712 Bacteria 2623166
164 Ga0453684_0022350 3300044712 Bacteria 9387
165 Ga0453684_0231704 3300044712 Bacteria 2132
166 Ga0451576_0000163 3300045051 Bacteria 170072
167 Ga0451576_0001835 3300045051 Bacteria 34480
168 Ga0466958_0002804 3300045836 Bacteria 8874
169 Ga0495617_000003 3300046452 Bacteria 541914
170 Ga0495617_003036 3300046452 Bacteria 6399
171 Ga0495590_0000014 3300046457 Bacteria 258314
172 Ga0495638_0000133 3300046460 Bacteria 119393
173 Ga0495638_0000633 3300046460 Bacteria 38772
174 Ga0495638_0030325 3300046460 Bacteria 3482
175 Ga0495638_0041552 3300046460 Bacteria 2908
176 Ga0495653_0000002 3300046463 Bacteria 507262
177 Ga0495650_0000072 3300046471 Bacteria 257886
178 Ga0495650_0000267 3300046471 Bacteria 100234
179 Ga0495650_0001047 3300046471 Bacteria 30813
180 Ga0495650_0009192 3300046471 Bacteria 5657
181 Ga0495605_0000068 3300046474 Bacteria 137743
182 Ga0495585_0002789 3300046492 Bacteria 12177
183 Ga0495607_0000360 3300046501 Bacteria 47044
184 Ga0495583_0000044 3300046506 Bacteria 226264
185 Ga0495606_0000001 3300046507 Bacteria 592123
186 Ga0495606_0000030 3300046507 Bacteria 249484
187 Ga0495606_0000476 3300046507 Bacteria 65896
188 Ga0495606_0000545 3300046507 Bacteria 60465
189 Ga0495606_0002860 3300046507 Bacteria 19101
190 Ga0495610_0000003 3300046512 Bacteria 1203910
191 Ga0495610_0000449 3300046512 Bacteria 42537
192 Ga0495610_0002355 3300046512 Bacteria 15969
193 Ga0495628_0122816 3300046516 Bacteria 1991
194 Ga0495637_0000937 3300046520 Bacteria 18653
195 Ga0495643_0000028 3300046522 Bacteria 262886
196 Ga0495648_0000006 3300046524 Bacteria 361208
197 Ga0495648_0002607 3300046524 Bacteria 16486
198 Ga0495648_0038419 3300046524 Bacteria 3061
199 Ga0495642_0001570 3300046528 Bacteria 10031
200 Ga0495654_0000037 3300046530 Bacteria 188218
201 Ga0495654_0007710 3300046530 Bacteria 5990
202 Ga0495609_0014880 3300046538 Bacteria 3650
203 Ga0495597_0000072 3300046542 Bacteria 87914
204 Ga0495622_0000136 3300046557 Bacteria 62960
205 Ga0495633_0000055 3300046558 Bacteria 151013
206 Ga0495633_0000509 3300046558 Bacteria 39153
207 Ga0495633_0005401 3300046558 Bacteria 7828
208 Ga0495668_0000452 3300046616 Bacteria 52507
209 Ga0495668_0000512 3300046616 Bacteria 48355
210 Ga0495668_0000527 3300046616 Bacteria 47676
211 Ga0495668_0002400 3300046616 Bacteria 15521
212 Ga0495625_0000220 3300046660 Bacteria 90406
213 Ga0495625_0000697 3300046660 Bacteria 47751
214 Ga0495625_0024433 3300046660 Bacteria 4599
215 Ga0495599_0011957 3300046678 Bacteria 5338
216 Ga0495670_0000003 3300046691 Bacteria 326779
217 Ga0495671_0000010 3300046692 Bacteria 368641
218 Ga0495649_0000239 3300046694 Bacteria 48404
219 Ga0495649_0007544 3300046694 Bacteria 6621
220 Ga0495674_0066298 3300047319 Bacteria 3133
221 Ga0495672_0000212 3300047320 Bacteria 83026
222 Ga0495672_0002330 3300047320 Bacteria 17608
223 Ga0495672_0002511 3300047320 Bacteria 16777
224 Ga0495683_0003693 3300047323 Bacteria 8866
225 Ga0495687_000885 3300047443 Bacteria 31640
226 Ga0495687_000887 3300047443 Bacteria 31523
227 Ga0495673_0000003 3300047469 Bacteria 1491337
228 Ga0495673_0000016 3300047469 Bacteria 580643
229 Ga0495673_0000035 3300047469 Bacteria 316861
230 Ga0495686_0001147 3300047472 Bacteria 31133
231 Ga0495686_0004957 3300047472 Bacteria 10710
232 Ga0496105_0021362 3300048908 Bacteria 5238
233 Ga0496115_0000657 3300048918 Bacteria 25751
234 Ga0496121_0013459 3300048924 Bacteria 8784
235 Ga0496123_0016555 3300048926 Bacteria 5978
236 Ga0496126_0004912 3300048929 Bacteria 15608
237 Ga0496126_0020109 3300048929 Bacteria 6553
238 Ga0495678_000029 3300049459 Bacteria 219803
239 Ga0501032_0000168 3300049569 Bacteria 53390
240 Ga0501032_0000579 3300049569 Bacteria 29600
241 Ga0501033_0002097 3300049570 Bacteria 17290
242 Ga0501034_0178756 3300049571 Bacteria 2087
243 Ga0501036_0001028 3300049572 Bacteria 21076
244 Ga0501036_0057758 3300049572 Bacteria 3287
245 Ga0501038_0000149 3300049574 Bacteria 59727
246 Ga0501039_0045251 3300049575 Bacteria 3400
247 Ga0501043_0005173 3300049579 Bacteria 10557
248 Ga0501043_0113805 3300049579 Bacteria 2124
249 Ga0501046_0004696 3300049580 Bacteria 12330
250 Ga0501046_0014303 3300049580 Bacteria 6701
251 Ga0501047_0028654 3300049581 Bacteria 5371
252 Ga0501047_0127647 3300049581 Bacteria 2423
253 Ga0501068_0025114 3300049584 Bacteria 3504
254 Ga0501073_0110052 3300049589 Bacteria 1911
255 Ga0501223_000911 3300049663 Bacteria 6991
256 Ga0501225_0002733 3300049705 Bacteria 5419
257 Ga0501080_0157673 3300049742 Bacteria 2096
258 Ga0501083_0122198 3300049744 Bacteria 1708
259 Ga0501035_0000140 3300049822 Bacteria 88070
260 Ga0501035_0000857 3300049822 Bacteria 32421
261 Ga0501035_0046857 3300049822 Bacteria 3886
262 Ga0501044_0000090 3300049823 Bacteria 112221
263 Ga0501044_0018021 3300049823 Bacteria 7571
264 nmdc:mga0k408_40546_c1 3300050493 Bacteria 2679
265 Ga0500643_003174 3300053087 Bacteria 8034
266 Ga0500566_0004718 3300053094 Bacteria 8118
267 Ga0500595_007458 3300053119 Bacteria 4539
268 Ga0500618_000297 3300053125 Bacteria 37721
269 Ga0500658_0000969 3300053134 Bacteria 11709
270 Ga0500658_0006541 3300053134 Bacteria 4320
271 Ga0500568_0017303 3300053139 Bacteria 3185
272 Ga0500586_000014 3300053145 Bacteria 37183
273 Ga0500604_0000021 3300053151 Bacteria 72909
274 Ga0500616_0000101 3300053153 Bacteria 172722
275 Ga0500622_0000870 3300053156 Bacteria 25713
276 Ga0500622_0002433 3300053156 Bacteria 13451
277 Ga0466962_0016398 3300061719 Bacteria 3573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031235 Ga0265330_10000707 Ga0265330_1000070710 438
2 3300046507 Ga0495606_0000030 Ga0495606_0000030_132901_134520 458
3 3300003322 rootL2_10012685 rootL2_100126852 461
4 3300031235 Ga0265330_10023041 Ga0265330_100230412 461
5 3300031344 Ga0265316_10000603 Ga0265316_1000060320 461
6 3300048924 Ga0496121_0013459 Ga0496121_0013459_2782_4401 464
7 3300031235 Ga0265330_10008054 Ga0265330_100080544 470
8 3300031242 Ga0265329_10000106 Ga0265329_1000010619 470
9 3300031344 Ga0265316_10001195 Ga0265316_1000119522 470
10 3300031711 Ga0265314_10014809 Ga0265314_100148094 470
11 3300031712 Ga0265342_10001516 Ga0265342_100015162 470
12 3300046512 Ga0495610_0000003 Ga0495610_0000003_872628_874217 470
13 3300046524 Ga0495648_0002607 Ga0495648_0002607_8656_10245 470
14 3300046692 Ga0495671_0000010 Ga0495671_0000010_128758_130347 470
15 iso_pu_bacteria 2971403814 2971408215 470
16 3300046460 Ga0495638_0030325 Ga0495638_0030325_1826_3457 471
17 3300046660 Ga0495625_0000697 Ga0495625_0000697_34748_36379 471
18 3300047469 Ga0495673_0000016 Ga0495673_0000016_320376_322007 472
19 3300046471 Ga0495650_0000267 Ga0495650_0000267_81871_83502 473
20 3300046524 Ga0495648_0038419 Ga0495648_0038419_1410_3041 473
21 3300046616 Ga0495668_0000512 Ga0495668_0000512_2817_4448 473
22 3300048926 Ga0496123_0016555 Ga0496123_0016555_3335_4969 473
23 3300046471 Ga0495650_0001047 Ga0495650_0001047_18576_20207 475
24 3300003322 rootL2_10000935 rootL2_100009354 476
25 3300050493 nmdc:mga0k408_40546_c1 nmdc:mga0k408_40546_c1_918_2471 476
26 3300031250 Ga0265331_10025960 Ga0265331_100259603 479
27 3300031712 Ga0265342_10032822 Ga0265342_100328223 479
28 3300046507 Ga0495606_0000001 Ga0495606_0000001_219187_220812 479
29 3300046512 Ga0495610_0000449 Ga0495610_0000449_1934_3559 479
30 3300046616 Ga0495668_0000452 Ga0495668_0000452_18923_20548 479
31 3300047472 Ga0495686_0004957 Ga0495686_0004957_3073_4698 479
32 3300005466 Ga0070685_10012217 Ga0070685_100122174 480
33 3300014325 Ga0163163_10039308 Ga0163163_100393082 480
34 3300031235 Ga0265330_10017471 Ga0265330_100174712 482
35 3300028558 Ga0265326_10012280 Ga0265326_100122802 484
36 3300028573 Ga0265334_10010789 Ga0265334_100107892 484
37 3300028653 Ga0265323_10000448 Ga0265323_1000044812 484
38 3300028653 Ga0265323_10004166 Ga0265323_100041665 484
39 3300028800 Ga0265338_10019425 Ga0265338_100194256 484
40 3300031235 Ga0265330_10007580 Ga0265330_100075802 484
41 3300031242 Ga0265329_10000088 Ga0265329_1000008814 484
42 3300031344 Ga0265316_10000160 Ga0265316_1000016023 484
43 3300031344 Ga0265316_10000175 Ga0265316_1000017516 484
44 3300031344 Ga0265316_10010446 Ga0265316_100104462 484
45 3300031712 Ga0265342_10001752 Ga0265342_100017523 484
46 3300035118 Ga0373954_0007247 Ga0373954_0007247_1445_2995 484
47 3300036401 Ga0373937_0000835 Ga0373937_0000835_5402_6952 484
48 3300046474 Ga0495605_0000068 Ga0495605_0000068_18115_19725 484
49 3300003771 Ga0055526_1000029 Ga0055526_1000029119 485
50 3300025295 Ga0209564_1000009 Ga0209564_100000914 485
51 3300035114 Ga0373939_0006545 Ga0373939_0006545_1061_2689 485
52 3300046471 Ga0495650_0000072 Ga0495650_0000072_77448_79076 485
53 3300046616 Ga0495668_0002400 Ga0495668_0002400_9617_11245 485
54 3300025245 Ga0207425_1000211 Ga0207425_100021123 486
55 3300025297 Ga0209758_1001186 Ga0209758_100118611 486
56 3300046507 Ga0495606_0000476 Ga0495606_0000476_5959_7593 486
57 3300003763 Ga0055529_1000341 Ga0055529_100034133 487
58 3300025272 Ga0209455_1000037 Ga0209455_1000037426 487
59 3300028653 Ga0265323_10029628 Ga0265323_100296282 488
60 3300031238 Ga0265332_10025239 Ga0265332_100252391 488
61 3300031711 Ga0265314_10021892 Ga0265314_100218923 488
62 3300046452 Ga0495617_000003 Ga0495617_000003_187007_188638 488
63 3300046460 Ga0495638_0041552 Ga0495638_0041552_1201_2832 488
64 3300046512 Ga0495610_0002355 Ga0495610_0002355_9764_11380 488
65 3300046530 Ga0495654_0007710 Ga0495654_0007710_370_2001 488
66 3300046660 Ga0495625_0024433 Ga0495625_0024433_719_2335 488
67 3300046694 Ga0495649_0007544 Ga0495649_0007544_2616_4232 488
68 3300046463 Ga0495653_0000002 Ga0495653_0000002_370106_371746 489
69 3300048929 Ga0496126_0020109 Ga0496126_0020109_3958_5562 489
70 3300046460 Ga0495638_0000133 Ga0495638_0000133_111188_112810 490
71 3300046506 Ga0495583_0000044 Ga0495583_0000044_70902_72524 490
72 3300046524 Ga0495648_0000006 Ga0495648_0000006_172895_174517 490
73 3300046528 Ga0495642_0001570 Ga0495642_0001570_2708_4330 490
74 3300046557 Ga0495622_0000136 Ga0495622_0000136_55335_56957 490
75 3300046558 Ga0495633_0000509 Ga0495633_0000509_6093_7715 490
76 3300046660 Ga0495625_0000220 Ga0495625_0000220_73065_74687 490
77 3300047469 Ga0495673_0000003 Ga0495673_0000003_1031262_1032866 490
78 3300046457 Ga0495590_0000014 Ga0495590_0000014_64890_66524 491
79 3300046501 Ga0495607_0000360 Ga0495607_0000360_25211_26845 491
80 3300046616 Ga0495668_0000527 Ga0495668_0000527_29671_31305 491
81 3300047443 Ga0495687_000885 Ga0495687_000885_27326_28960 491
82 3300047443 Ga0495687_000887 Ga0495687_000887_2681_4315 491
83 3300031995 Ga0307409_100075640 Ga0307409_1000756402 494
84 3300047469 Ga0495673_0000035 Ga0495673_0000035_274649_276277 494
85 3300009551 Ga0105238_10001661 Ga0105238_100016612 495
86 3300025924 Ga0207694_10009544 Ga0207694_100095442 495
87 iso_pu_bacteria 2857564685 2857567006 495
88 3300046452 Ga0495617_003036 Ga0495617_003036_1383_2969 496
89 3300046507 Ga0495606_0000545 Ga0495606_0000545_43635_45221 496
90 3300047323 Ga0495683_0003693 Ga0495683_0003693_6049_7638 496
91 iso_pu_bacteria 2842711865 2842715438 496
92 3300046558 Ga0495633_0000055 Ga0495633_0000055_47292_48935 497
93 3300046558 Ga0495633_0005401 Ga0495633_0005401_6074_7666 497
94 3300053145 Ga0500586_000014 Ga0500586_000014_2338_3930 497
95 iso_pu_bacteria 2821131069 2821131775 497
96 3300046471 Ga0495650_0009192 Ga0495650_0009192_1538_3145 499
97 3300046492 Ga0495585_0002789 Ga0495585_0002789_279_1910 499
98 3300046507 Ga0495606_0002860 Ga0495606_0002860_10923_12524 499
99 3300046520 Ga0495637_0000937 Ga0495637_0000937_4712_6319 499
100 3300046530 Ga0495654_0000037 Ga0495654_0000037_16881_18488 499
101 3300046538 Ga0495609_0014880 Ga0495609_0014880_809_2431 499
102 iso_pu_bacteria 2738541297 2738829817 499
103 iso_pu_bacteria 2738541357 2739153613 499
104 iso_pu_bacteria 2738543003 2739195533 499
105 iso_pu_bacteria 2738543026 2739322009 499
106 iso_pu_bacteria 2738543029 2739340250 499
107 3300005337 Ga0070682_100030897 Ga0070682_1000308973 500
108 3300006237 Ga0097621_100082850 Ga0097621_1000828502 500
109 3300031344 Ga0265316_10015342 Ga0265316_100153423 500
110 3300046522 Ga0495643_0000028 Ga0495643_0000028_181742_183358 500
111 3300046542 Ga0495597_0000072 Ga0495597_0000072_79752_81383 500
112 3300047320 Ga0495672_0000212 Ga0495672_0000212_33124_34740 500
113 3300049459 Ga0495678_000029 Ga0495678_000029_53611_55227 500
114 3300053125 Ga0500618_000297 Ga0500618_000297_30039_31673 500
115 iso_pu_bacteria 2857558681 2857559203 500
116 3300009545 Ga0105237_10000059 Ga0105237_1000005964 502
117 3300025914 Ga0207671_10000064 Ga0207671_1000006451 502
118 3300013296 Ga0157374_10026791 Ga0157374_100267913 504
119 3300049663 Ga0501223_000911 Ga0501223_000911_1371_3092 508
120 iso_pu_bacteria 2842722452 2842723075 511
121 iso_pu_bacteria 2842909656 2842914029 511
122 iso_pu_bacteria 2954016120 2954016683 511
123 iso_pu_bacteria 2857627736 2857627912 512
124 3300042876 Ga0451577_0003868 Ga0451577_0003868_7004_8635 513
125 3300044712 Ga0453684_0231704 Ga0453684_0231704_106_1737 513
126 3300028794 Ga0307515_10037816 Ga0307515_100378162 514
127 iso_pu_bacteria 2738541302 2738855340 514
128 iso_pu_bacteria 2818991437 2819546777 514
129 iso_pu_bacteria 2849281842 2849286093 514
130 iso_pu_bacteria 2904445276 2904446951 514
131 iso_pu_bacteria 2945997725 2945999720 514
132 3300013104 Ga0157370_10130391 Ga0157370_101303912 515
133 3300013105 Ga0157369_10000015 Ga0157369_10000015157 515
134 3300015261 Ga0182006_1000388 Ga0182006_100038821 515
135 3300015262 Ga0182007_10000010 Ga0182007_1000001059 515
136 3300017792 Ga0163161_10000878 Ga0163161_100008789 515
137 3300031548 Ga0307408_100123964 Ga0307408_1001239641 515
138 3300031731 Ga0307405_10000013 Ga0307405_10000013179 515
139 3300031903 Ga0307407_10000024 Ga0307407_1000002478 515
140 3300032002 Ga0307416_100000037 Ga0307416_10000003799 515
141 3300032004 Ga0307414_10008467 Ga0307414_100084672 515
142 iso_pu_bacteria 2738541278 2738729438 515
143 3300013104 Ga0157370_10001645 Ga0157370_1000164515 516
144 iso_pu_bacteria 2977232053 2977233143 517
145 3300005288 Ga0065714_10064423 Ga0065714_10064423121 518
146 3300013102 Ga0157371_10000076 Ga0157371_1000007652 518
147 3300013104 Ga0157370_10092596 Ga0157370_100925961 518
148 3300015261 Ga0182006_1000088 Ga0182006_100008826 518
149 3300047472 Ga0495686_0001147 Ga0495686_0001147_29081_30739 518
150 3300049705 Ga0501225_0002733 Ga0501225_0002733_3632_5308 518
151 iso_pu_bacteria 2911138879 2911142309 519
152 3300003316 rootH1_10020653 rootH1_1002065314 520
153 3300003323 rootH1_10009812 rootH1_100098124 520
154 3300003323 rootH1_10011789 rootH1_1001178915 520
155 3300005262 Ga0065165_1001172 Ga0065165_100117213 520
156 3300025302 Ga0207426_1009796 Ga0207426_10097962 520
157 3300030521 Ga0307511_10001468 Ga0307511_100014688 520
158 3300049571 Ga0501034_0178756 Ga0501034_0178756_275_1948 521
159 3300049572 Ga0501036_0057758 Ga0501036_0057758_140_1813 521
160 3300049579 Ga0501043_0113805 Ga0501043_0113805_108_1781 521
161 3300049580 Ga0501046_0004696 Ga0501046_0004696_10625_12298 521
162 3300049581 Ga0501047_0127647 Ga0501047_0127647_300_1973 521
163 3300049742 Ga0501080_0157673 Ga0501080_0157673_168_1841 521
164 3300049744 Ga0501083_0122198 Ga0501083_0122198_19_1692 521
165 3300025263 Ga0209565_1000132 Ga0209565_100013263 522
166 3300025295 Ga0209564_1010068 Ga0209564_10100681 522
167 3300053156 Ga0500622_0002433 Ga0500622_0002433_9685_11412 522
168 3300003322 rootL2_10003822 rootL2_100038229 523
169 3300053156 Ga0500622_0000870 Ga0500622_0000870_18471_20180 523
170 3300025939 Ga0207665_10074913 Ga0207665_100749132 524
171 3300037068 Ga0373925_0160832 Ga0373925_0160832_42_1712 524
172 3300045051 Ga0451576_0001835 Ga0451576_0001835_29391_31070 524
173 3300003792 Ga0055540_1005064 Ga0055540_10050642 527
174 3300003792 Ga0055540_1009090 Ga0055540_10090902 527
175 3300025292 Ga0209676_1010696 Ga0209676_10106962 527
176 3300025298 Ga0209050_1000005 Ga0209050_1000005527 527
177 3300025303 Ga0209051_1000377 Ga0209051_100037752 527
178 3300025304 Ga0209257_1002036 Ga0209257_10020369 527
179 3300002774 JGI25150J39212_1000582 JGI25150J39212_10005822 528
180 3300003215 JGI25153J46596_10000260 JGI25153J46596_100002605 528
181 3300025245 Ga0207425_1000072 Ga0207425_10000726 528
182 3300025258 Ga0209129_1002536 Ga0209129_10025365 528
183 3300025294 Ga0209025_1000721 Ga0209025_100072133 528
184 3300025297 Ga0209758_1000009 Ga0209758_1000009642 528
185 3300025298 Ga0209050_1004719 Ga0209050_10047196 530
186 3300025298 Ga0209050_1024795 Ga0209050_10247952 530
187 3300025304 Ga0209257_1002030 Ga0209257_10020309 530
188 3300025944 Ga0207661_10007163 Ga0207661_100071635 530
189 3300044712 Ga0453684_0000001 Ga0453684_0000001_424038_425720 530
190 3300044712 Ga0453684_0022350 Ga0453684_0022350_3496_5169 530
191 3300049569 Ga0501032_0000168 Ga0501032_0000168_31412_33124 530
192 3300049570 Ga0501033_0002097 Ga0501033_0002097_1754_3466 530
193 3300049572 Ga0501036_0001028 Ga0501036_0001028_459_2171 530
194 3300049574 Ga0501038_0000149 Ga0501038_0000149_55980_57692 530
195 3300049575 Ga0501039_0045251 Ga0501039_0045251_1591_3303 530
196 3300049584 Ga0501068_0025114 Ga0501068_0025114_1764_3476 530
197 3300049822 Ga0501035_0000857 Ga0501035_0000857_27390_29102 530
198 3300049823 Ga0501044_0018021 Ga0501044_0018021_459_2171 530
199 3300005439 Ga0070711_100062324 Ga0070711_1000623242 532
200 3300028800 Ga0265338_10001667 Ga0265338_100016676 532
201 3300048908 Ga0496105_0021362 Ga0496105_0021362_991_2742 532
202 3300005344 Ga0070661_100000006 Ga0070661_10000000653 534
203 3300025920 Ga0207649_10000058 Ga0207649_1000005856 534
204 3300006028 Ga0070717_10000103 Ga0070717_1000010364 535
205 3300049569 Ga0501032_0000579 Ga0501032_0000579_20142_21890 536
206 3300049579 Ga0501043_0005173 Ga0501043_0005173_3093_4841 536
207 3300049822 Ga0501035_0000140 Ga0501035_0000140_58441_60189 536
208 3300049823 Ga0501044_0000090 Ga0501044_0000090_45484_47232 536
209 3300005262 Ga0065165_1012896 Ga0065165_10128963 537
210 3300048929 Ga0496126_0004912 Ga0496126_0004912_113_1792 538
211 3300031824 Ga0307413_10002767 Ga0307413_100027673 539
212 3300032004 Ga0307414_10001797 Ga0307414_100017973 539
213 3300032126 Ga0307415_100000511 Ga0307415_1000005116 539
214 3300046516 Ga0495628_0122816 Ga0495628_0122816_19_1752 539
215 3300046678 Ga0495599_0011957 Ga0495599_0011957_751_2484 539
216 3300003323 rootH1_10035305 rootH1_100353058 540
217 3300021358 Ga0213873_10000006 Ga0213873_10000006121 540
218 3300021384 Ga0213876_10000004 Ga0213876_10000004627 540
219 3300039437 Ga0436365_0862833 Ga0436365_0862833_10564_12204 540
220 3300039453 Ga0436362_0554113 Ga0436362_0554113_3263_4903 540
221 3300041410 Ga0439461_0000015 Ga0439461_0000015_2117_3817 540
222 3300041997 Ga0439431_0000089 Ga0439431_0000089_1047_2747 540
223 3300042002 Ga0439442_002415 Ga0439442_002415_1727_3427 540
224 3300042004 Ga0439445_0001126 Ga0439445_0001126_919_2619 540
225 3300042006 Ga0439432_001016 Ga0439432_001016_7987_9687 540
226 3300042015 Ga0439462_0000140 Ga0439462_0000140_7885_9585 540
227 3300045051 Ga0451576_0000163 Ga0451576_0000163_73960_75639 540
228 3300049580 Ga0501046_0014303 Ga0501046_0014303_329_2041 540
229 3300049581 Ga0501047_0028654 Ga0501047_0028654_262_1974 540
230 3300049822 Ga0501035_0046857 Ga0501035_0046857_645_2357 540
231 iso_pu_bacteria 2786546940 2788434215 540
232 3300003320 rootH2_10021495 rootH2_1002149530 541
233 3300003323 rootH1_10059214 rootH1_100592143 541
234 3300005614 Ga0068856_100002115 Ga0068856_1000021151 541
235 3300026078 Ga0207702_10000731 Ga0207702_1000073121 541
236 3300026116 Ga0207674_10114407 Ga0207674_101144073 541
237 3300031616 Ga0307508_10000027 Ga0307508_1000002723 541
238 3300003794 Ga0055531_10001873 Ga0055531_100018732 542
239 3300005262 Ga0065165_1000459 Ga0065165_100045943 542
240 3300025297 Ga0209758_1000215 Ga0209758_100021594 542
241 3300025298 Ga0209050_1000049 Ga0209050_100004953 542
242 3300025304 Ga0209257_1001706 Ga0209257_10017069 542
243 3300005367 Ga0070667_100059957 Ga0070667_1000599572 543
244 3300025304 Ga0209257_1001841 Ga0209257_10018417 543
245 3300042435 Ga0439434_0000049 Ga0439434_0000049_8536_10236 543
246 3300053134 Ga0500658_0000969 Ga0500658_0000969_340_1986 543
247 3300046460 Ga0495638_0000633 Ga0495638_0000633_10962_12611 544
248 3300053153 Ga0500616_0000101 Ga0500616_0000101_146220_147884 544
249 3300003323 rootH1_10000877 rootH1_100008772 545
250 3300048918 Ga0496115_0000657 Ga0496115_0000657_13669_15351 545
251 3300031728 Ga0316578_10053443 Ga0316578_100534432 547
252 3300031733 Ga0316577_10013778 Ga0316577_100137783 547
253 3300036712 Ga0316584_0000058 Ga0316584_0000058_36839_38527 547
254 3300049589 Ga0501073_0110052 Ga0501073_0110052_140_1843 547
255 iso_pu_bacteria 2791355048 2792460514 547
256 iso_pu_bacteria 2843744320 2843744608 547
257 iso_pu_bacteria 2849560528 2849565574 547
258 iso_pu_bacteria 2849573788 2849575690 547
259 3300005339 Ga0070660_100006806 Ga0070660_1000068062 548
260 3300025919 Ga0207657_10013554 Ga0207657_100135542 548
261 3300046694 Ga0495649_0000239 Ga0495649_0000239_36843_38537 548
262 3300047319 Ga0495674_0066298 Ga0495674_0066298_529_2262 548
263 3300047320 Ga0495672_0002330 Ga0495672_0002330_7179_8870 548
264 3300053087 Ga0500643_003174 Ga0500643_003174_5396_7096 548
265 3300053139 Ga0500568_0017303 Ga0500568_0017303_597_2327 548
266 3300044684 Ga0466966_0037366 Ga0466966_0037366_423_2126 549
267 3300045836 Ga0466958_0002804 Ga0466958_0002804_4020_5726 551
268 3300061719 Ga0466962_0016398 Ga0466962_0016398_1543_3249 551
269 iso_pu_bacteria 2851153111 2851153287 551
270 iso_pu_bacteria 2898329390 2898331753 551
271 3300053151 Ga0500604_0000021 Ga0500604_0000021_25632_27338 552
272 3300003771 Ga0055526_1001427 Ga0055526_10014273 553
273 3300005530 Ga0070679_100005952 Ga0070679_10000595211 553
274 3300025295 Ga0209564_1000502 Ga0209564_100050229 553
275 3300025912 Ga0207707_10031698 Ga0207707_100316982 553
276 3300037418 Ga0395900_0011733 Ga0395900_0011733_4041_5753 553
277 3300037471 Ga0395905_0030653 Ga0395905_0030653_2302_4014 553
278 3300038443 Ga0395901_0001184 Ga0395901_0001184_18694_20406 553
279 3300047320 Ga0495672_0002511 Ga0495672_0002511_9259_10974 553
280 3300025304 Ga0209257_1015748 Ga0209257_10157482 555
281 3300046691 Ga0495670_0000003 Ga0495670_0000003_189999_191672 555
282 3300053119 Ga0500595_007458 Ga0500595_007458_342_2024 555
283 3300053134 Ga0500658_0006541 Ga0500658_0006541_625_2325 555
284 3300032126 Ga0307415_100019408 Ga0307415_1000194082 556
285 3300041413 Ga0439465_0001953 Ga0439465_0001953_1935_3638 557
286 3300042004 Ga0439445_0003080 Ga0439445_0003080_1260_2963 557
287 iso_pu_bacteria 2643221622 2644128478 562
288 3300003791 Ga0055530_10000074 Ga0055530_1000007439 566
289 3300003794 Ga0055531_10000374 Ga0055531_100003745 566
290 3300005262 Ga0065165_1001720 Ga0065165_10017206 566
291 3300025298 Ga0209050_1000039 Ga0209050_1000039162 566
292 3300025304 Ga0209257_1000051 Ga0209257_1000051162 566
293 3300042435 Ga0439434_0009946 Ga0439434_0009946_275_1978 566
294 3300053094 Ga0500566_0004718 Ga0500566_0004718_4685_6391 566
295 3300000041 ARcpr5oldR_c001230 ARcpr5oldR_0012301 567
296 3300003215 JGI25153J46596_10012909 JGI25153J46596_100129092 567
297 3300003773 Ga0055537_1000161 Ga0055537_100016122 567
298 3300003775 Ga0055524_1000110 Ga0055524_100011059 567
299 3300003791 Ga0055530_10008826 Ga0055530_100088263 567
300 3300003794 Ga0055531_10002640 Ga0055531_100026403 567
301 3300025263 Ga0209565_1000030 Ga0209565_100003082 567
302 3300025273 Ga0209673_1000925 Ga0209673_100092529 567
303 3300025297 Ga0209758_1007196 Ga0209758_10071962 567
304 3300025298 Ga0209050_1003793 Ga0209050_10037935 567
305 3300025299 Ga0209256_1000046 Ga0209256_1000046203 567
306 3300025304 Ga0209257_1001876 Ga0209257_10018765 567

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

78

371

0.97

PF17851

GH43_C2

Beta xylosidase C-terminal Concanavalin A-like domain

405

585

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jvh-assembly5.cif.gz_E crystal structure of a gh43_12 retrieved from capybara gut metagenome 0.9349 20 565
5joz-assembly2.cif.gz_B bacteroides ovatus xyloglucan pul gh43b 0.9326 45 564
5z5d-assembly1.cif.gz_A crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 0.9318 45 564
7jvh-assembly5.cif.gz_E crystal structure of a gh43_12 retrieved from capybara gut metagenome 0.9312 20 565
7erl-assembly1.cif.gz_B gh43 domain of bifunctional endoxylanase and arabinofuranosidase of bi0569 0.9294 21 567
ID Description Score Start End Superfamily
5z5iA02 Mainly Beta;Sandwich;Jelly Rolls; 0.9326 375 564 2.60.120.200
5jozB01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9217 45 360 2.115.10.20
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9188 45 361 2.115.10.20
5jozB02 Mainly Beta;Sandwich;Jelly Rolls; 0.9182 377 564 2.60.120.200
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.913 45 361 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A3D2L378-F1-model_v4 Glycoside hydrolase 43 family protein 0.9936 39 428 GO:0004553
GO:0005975
AF-A0A3D0L6X6-F1-model_v4 Glycoside hydrolase 43 family protein 0.9933 46 157 GO:0004553
GO:0005975
AF-A0A060C751-F1-model_v4 Glyco_hydro_43 0.9855 166 314 GO:0004553
GO:0005975
AF-U2BG60-F1-model_v4 deleted 0.9849 46 155
AF-A0A4Q3X390-F1-model_v4 Glycoside hydrolase family 43 protein 0.9833 120 324 GO:0004553
GO:0005975

Feature Viewer

pLDDT pTM Quality
93.6 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map