F398128

General Info

Members Datasets Scaffolds Average Seq Length
305 178 276 158

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10759185|Ga0157380_107591852
Length 162
Sequence MSRSNAYWALPVSLLAALILGLLPLPVALQPLRPYWLALVLAYWLIEDPDRVGLGVAFSVGLLADLTFGTLFGEQALRLVVMAFILQRFRARLRFFPMSQQALAIGGLLLNDRIVAAVIHFVLGQPSPPREFWLAPLLGMLLWPLVFVAMDAMRLGQWRRRS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2818991457 Xanthomonas translucens 569 Isolate Unclassified
15 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
16 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
17 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
18 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
19 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
20 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
21 2919513703 Luteimonas sp. 3794 Isolate Unclassified
22 2919675420 Luteimonas terrae 4099 Isolate Unclassified
23 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
24 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
25 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
56 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
110 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
111 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
130 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
169 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
174 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
175 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
176 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
177 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
178 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 0
Isolates 9.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.67
Nodule 0
Rhizoplane 8.85
Rhizosphere 59.67
Stem 0
Stem Tuber 0
Unclassified 11.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_794112 2162886007 Bacteria 2462
2 JGI25151J46595_10000160 3300003187 Bacteria 86811
3 JGI25151J46595_10008797 3300003187 Bacteria 4825
4 rootL2_10016420 3300003322 Bacteria 4824
5 Ga0055526_1000014 3300003771 Bacteria 233327
6 Ga0055526_1071461 3300003771 Bacteria 702
7 Ga0055537_1000059 3300003773 Bacteria 79628
8 Ga0055524_1000019 3300003775 Bacteria 233561
9 Ga0055536_1004024 3300003781 Bacteria 7665
10 Ga0055536_1012076 3300003781 Bacteria 3242
11 Ga0055536_1018806 3300003781 Bacteria 2197
12 Ga0055536_1022967 3300003781 Bacteria 1845
13 Ga0055536_1059884 3300003781 Bacteria 793
14 Ga0055534_1000012 3300003784 Bacteria 153530
15 Ga0055528_1000007 3300003790 Bacteria 233327
16 Ga0055530_10002905 3300003791 Bacteria 10385
17 Ga0055531_10004248 3300003794 Bacteria 8812
18 Ga0055531_10010263 3300003794 Bacteria 4679
19 Ga0055531_10010914 3300003794 Bacteria 4454
20 Ga0055531_10029158 3300003794 Bacteria 1886
21 Ga0055531_10039510 3300003794 Bacteria 1400
22 Ga0065704_10093971 3300005289 Bacteria 2567
23 Ga0065704_10101394 3300005289 Bacteria 2239
24 Ga0070683_101176700 3300005329 Bacteria 737
25 Ga0070670_100008914 3300005331 Bacteria 8564
26 Ga0070670_100049396 3300005331 Bacteria 3617
27 Ga0070670_100278412 3300005331 Bacteria 1461
28 Ga0070677_10100965 3300005333 Bacteria 1272
29 Ga0070680_100319036 3300005336 Bacteria 1319
30 Ga0070692_10779372 3300005345 Bacteria 651
31 Ga0070668_100004200 3300005347 Bacteria 10679
32 Ga0070668_100061447 3300005347 Bacteria 2910
33 Ga0070675_100060094 3300005354 Bacteria 3137
34 Ga0070675_100113027 3300005354 Bacteria 2299
35 Ga0070671_100055494 3300005355 Bacteria 3295
36 Ga0070671_100060330 3300005355 Bacteria 3158
37 Ga0070673_100653350 3300005364 Bacteria 963
38 Ga0070667_100285453 3300005367 Bacteria 1483
39 Ga0070679_100623184 3300005530 Bacteria 1022
40 Ga0068864_100372816 3300005618 Bacteria 1351
41 Ga0068861_100097331 3300005719 Bacteria 2334
42 Ga0068863_100071799 3300005841 Bacteria 3275
43 Ga0075364_10030063 3300006051 Bacteria 3485
44 Ga0075364_10082069 3300006051 Bacteria 2132
45 Ga0105251_10000155 3300009011 Bacteria 69872
46 Ga0105243_10004154 3300009148 Bacteria 11495
47 Ga0105248_10321904 3300009177 Bacteria 1742
48 Ga0157316_1004231 3300012510 Bacteria 1079
49 Ga0157327_1000122 3300012512 Bacteria 3534
50 Ga0157373_10125516 3300013100 Bacteria 1805
51 Ga0157371_10557590 3300013102 Bacteria 850
52 Ga0157375_10991242 3300013308 Bacteria 980
53 Ga0157375_13137210 3300013308 Bacteria 551
54 Ga0157380_10759185 3300014326 Bacteria 982
55 Ga0182005_1008758 3300015265 Bacteria 2970
56 Ga0183360_10002 3300015689 Bacteria 953821
57 Ga0207425_1013497 3300025245 Bacteria 1886
58 Ga0209565_1000001 3300025263 Bacteria 2950419
59 Ga0209673_1000001 3300025273 Bacteria 3176258
60 Ga0209673_1022337 3300025273 Bacteria 2185
61 Ga0209130_1002194 3300025284 Bacteria 10269
62 Ga0209675_1000001 3300025291 Bacteria 2950293
63 Ga0209675_1012909 3300025291 Bacteria 2653
64 Ga0209676_1000052 3300025292 Bacteria 371539
65 Ga0209676_1000501 3300025292 Bacteria 62489
66 Ga0209676_1002219 3300025292 Bacteria 14426
67 Ga0209676_1002832 3300025292 Bacteria 11471
68 Ga0209676_1014104 3300025292 Bacteria 3026
69 Ga0209676_1016805 3300025292 Bacteria 2622
70 Ga0209025_1000006 3300025294 Bacteria 1153444
71 Ga0209025_1003295 3300025294 Bacteria 15540
72 Ga0209025_1005504 3300025294 Bacteria 10298
73 Ga0209025_1039653 3300025294 Bacteria 2051
74 Ga0209025_1050230 3300025294 Bacteria 1669
75 Ga0209564_1000001 3300025295 Bacteria 3176258
76 Ga0209564_1028516 3300025295 Bacteria 1782
77 Ga0209758_1088284 3300025297 Bacteria 916
78 Ga0209050_1004903 3300025298 Bacteria 8748
79 Ga0209256_1000006 3300025299 Bacteria 1250310
80 Ga0209256_1009139 3300025299 Bacteria 4410
81 Ga0209256_1009484 3300025299 Bacteria 4260
82 Ga0209256_1013937 3300025299 Bacteria 2938
83 Ga0207426_1022125 3300025302 Bacteria 2188
84 Ga0209051_1018076 3300025303 Bacteria 3132
85 Ga0209257_1000046 3300025304 Bacteria 477765
86 Ga0209257_1000067 3300025304 Bacteria 342468
87 Ga0209257_1000414 3300025304 Bacteria 82489
88 Ga0209257_1003369 3300025304 Bacteria 13803
89 Ga0209257_1008502 3300025304 Bacteria 5810
90 Ga0209257_1012560 3300025304 Bacteria 3896
91 Ga0209257_1018200 3300025304 Bacteria 2718
92 Ga0207713_1000196 3300025735 Bacteria 84000
93 Ga0207682_10142118 3300025893 Bacteria 1077
94 Ga0207643_10482769 3300025908 Bacteria 791
95 Ga0207707_10512780 3300025912 Bacteria 1022
96 Ga0207650_10001854 3300025925 Bacteria 14905
97 Ga0207650_10175765 3300025925 Bacteria 1704
98 Ga0207650_10277985 3300025925 Bacteria 1362
99 Ga0207644_10025574 3300025931 Bacteria 4059
100 Ga0207679_10395120 3300025945 Bacteria 1215
101 Ga0207667_10290180 3300025949 Bacteria 1671
102 Ga0207651_10456836 3300025960 Bacteria 1097
103 Ga0207641_10073353 3300026088 Bacteria 2950
104 Ga0209371_1000025 3300027312 Bacteria 450640
105 Ga0268265_10657873 3300028380 Bacteria 1008
106 Ga0268256_1000027 3300030500 Bacteria 450640
107 Ga0316180_1013283 3300030736 Bacteria 1435
108 Ga0316182_1441073 3300030745 Bacteria 1649
109 Ga0307513_10002018 3300031456 Bacteria 28576
110 Ga0307408_100121982 3300031548 Bacteria 2020
111 Ga0307408_100171070 3300031548 Bacteria 1735
112 Ga0307408_100957426 3300031548 Bacteria 787
113 Ga0307405_10040600 3300031731 Bacteria 2819
114 Ga0307405_10157019 3300031731 Bacteria 1607
115 Ga0307405_10412688 3300031731 Bacteria 1060
116 Ga0307413_10000577 3300031824 Bacteria 12300
117 Ga0307413_10047736 3300031824 Bacteria 2555
118 Ga0307413_10213713 3300031824 Bacteria 1403
119 Ga0307413_10282989 3300031824 Bacteria 1248
120 Ga0307413_10795265 3300031824 Bacteria 794
121 Ga0307413_11843465 3300031824 Bacteria 542
122 Ga0307410_10143514 3300031852 Bacteria 1769
123 Ga0307410_10309734 3300031852 Bacteria 1249
124 Ga0307410_10697731 3300031852 Bacteria 855
125 Ga0307406_10007200 3300031901 Bacteria 6162
126 Ga0307406_11013027 3300031901 Bacteria 713
127 Ga0307407_10010021 3300031903 Bacteria 4447
128 Ga0307407_10735834 3300031903 Bacteria 746
129 Ga0307412_10024406 3300031911 Bacteria 3732
130 Ga0307412_10045496 3300031911 Bacteria 2869
131 Ga0307412_10162446 3300031911 Bacteria 1661
132 Ga0307412_10217238 3300031911 Bacteria 1463
133 Ga0307412_10381237 3300031911 Bacteria 1142
134 Ga0307412_11475438 3300031911 Bacteria 617
135 Ga0307409_100104029 3300031995 Bacteria 2363
136 Ga0307409_100355200 3300031995 Bacteria 1384
137 Ga0307409_100405885 3300031995 Bacteria 1303
138 Ga0307416_100087822 3300032002 Bacteria 2656
139 Ga0307416_100351652 3300032002 Bacteria 1492
140 Ga0307414_10001515 3300032004 Bacteria 12072
141 Ga0307414_10002017 3300032004 Bacteria 10551
142 Ga0307414_10013601 3300032004 Bacteria 4850
143 Ga0307414_10019771 3300032004 Bacteria 4181
144 Ga0307414_10055281 3300032004 Bacteria 2779
145 Ga0307414_10092851 3300032004 Bacteria 2248
146 Ga0307414_10110411 3300032004 Bacteria 2092
147 Ga0307414_10184357 3300032004 Bacteria 1682
148 Ga0307414_10326840 3300032004 Bacteria 1307
149 Ga0307414_10770850 3300032004 Bacteria 875
150 Ga0307414_10854734 3300032004 Bacteria 832
151 Ga0307411_10003756 3300032005 Bacteria 7122
152 Ga0307411_10073927 3300032005 Bacteria 2320
153 Ga0307411_10213888 3300032005 Bacteria 1490
154 Ga0307415_100063739 3300032126 Bacteria 2562
155 Ga0395900_0035900 3300037418 Bacteria 5108
156 Ga0395900_0921511 3300037418 Bacteria 796
157 Ga0395905_0037574 3300037471 Bacteria 4545
158 Ga0395901_0382375 3300038443 Bacteria 1449
159 Ga0439436_0001472 3300041404 Bacteria 6841
160 Ga0439436_0008449 3300041404 Bacteria 3166
161 Ga0439436_0012052 3300041404 Bacteria 2625
162 Ga0439436_0023100 3300041404 Bacteria 1840
163 Ga0439436_0029997 3300041404 Bacteria 1582
164 Ga0439436_0053437 3300041404 Bacteria 1138
165 Ga0439436_0219079 3300041404 Bacteria 547
166 Ga0439439_0003435 3300041406 Bacteria 3493
167 Ga0439439_0138101 3300041406 Bacteria 687
168 Ga0439447_002882 3300041407 Bacteria 6162
169 Ga0439453_0118329 3300041408 Bacteria 605
170 Ga0439465_0007763 3300041413 Bacteria 3402
171 Ga0451787_444939 3300041441 Bacteria 778
172 Ga0451787_509403 3300041441 Bacteria 678
173 Ga0451791_1412553 3300041451 Bacteria 918
174 Ga0451791_1559947 3300041451 Bacteria 1622
175 Ga0451800_0574995 3300041459 Bacteria 8405
176 Ga0451802_1772622 3300041460 Bacteria 2789
177 Ga0451806_258175 3300041462 Bacteria 8490
178 Ga0451804_0604079 3300041463 Bacteria 1341
179 Ga0451807_0776096 3300041486 Bacteria 2644
180 Ga0451807_0802952 3300041486 Bacteria 779
181 Ga0451807_2204680 3300041486 Bacteria 3535
182 Ga0451837_0856215 3300041494 Bacteria 1097
183 Ga0451837_1451510 3300041494 Bacteria 3204
184 Ga0451837_1503881 3300041494 Bacteria 4033
185 Ga0451843_1398491 3300041509 Bacteria 903
186 Ga0439431_0051747 3300041997 Bacteria 1066
187 Ga0439433_0013187 3300041999 Bacteria 1814
188 Ga0439433_0068644 3300041999 Bacteria 852
189 Ga0439445_0049793 3300042004 Bacteria 1129
190 Ga0439445_0190919 3300042004 Bacteria 603
191 Ga0439445_0222503 3300042004 Bacteria 560
192 Ga0439432_016661 3300042006 Bacteria 2471
193 Ga0439432_042032 3300042006 Bacteria 1446
194 Ga0439449_0000031 3300042007 Bacteria 41749
195 Ga0439449_0016826 3300042007 Bacteria 2746
196 Ga0439449_0020263 3300042007 Bacteria 2491
197 Ga0439449_0060211 3300042007 Bacteria 1401
198 Ga0439449_0100451 3300042007 Bacteria 1069
199 Ga0439449_0134562 3300042007 Bacteria 919
200 Ga0439449_0250256 3300042007 Bacteria 666
201 Ga0439457_073321 3300042014 Bacteria 782
202 Ga0439457_087196 3300042014 Bacteria 720
203 Ga0439462_0041000 3300042015 Bacteria 1236
204 Ga0439462_0081064 3300042015 Bacteria 886
205 Ga0450892_022418 3300042130 Bacteria 628
206 Ga0450905_060976 3300042142 Bacteria 630
207 Ga0451577_0004321 3300042876 Bacteria 15082
208 Ga0453684_0967066 3300044712 Bacteria 908
209 Ga0495638_0029385 3300046460 Bacteria 3544
210 Ga0495638_0062628 3300046460 Bacteria 2296
211 Ga0495606_0022657 3300046507 Bacteria 4567
212 Ga0495616_0112833 3300046513 Bacteria 1261
213 Ga0495663_0002657 3300046525 Bacteria 5328
214 Ga0495663_0019761 3300046525 Bacteria 1931
215 Ga0495663_0034199 3300046525 Bacteria 1520
216 Ga0495663_0139716 3300046525 Bacteria 821
217 Ga0495663_0166005 3300046525 Bacteria 759
218 Ga0495621_0000337 3300046539 Bacteria 11433
219 Ga0495621_0031062 3300046539 Bacteria 1830
220 Ga0495656_0000692 3300046615 Bacteria 10851
221 Ga0495656_0020763 3300046615 Bacteria 2550
222 Ga0495656_0073862 3300046615 Bacteria 1522
223 Ga0495656_0098656 3300046615 Bacteria 1347
224 Ga0495668_0005968 3300046616 Bacteria 8093
225 Ga0495659_0019913 3300046664 Bacteria 2249
226 Ga0495659_0039856 3300046664 Bacteria 1671
227 Ga0495636_0000510 3300047318 Bacteria 14286
228 Ga0495636_0035009 3300047318 Bacteria 2068
229 Ga0495636_0061136 3300047318 Bacteria 1592
230 Ga0495677_0015306 3300047445 Bacteria 2787
231 Ga0495685_011714 3300047447 Bacteria 2964
232 Ga0495615_0003382 3300048090 Bacteria 2669
233 Ga0495615_0220462 3300048090 Bacteria 592
234 Ga0496100_0090477 3300048903 Bacteria 2087
235 Ga0496100_0462529 3300048903 Bacteria 974
236 Ga0496101_0202450 3300048904 Bacteria 1535
237 Ga0496101_0211684 3300048904 Bacteria 1502
238 Ga0496101_0286072 3300048904 Bacteria 1289
239 Ga0496102_0217468 3300048905 Bacteria 1801
240 Ga0496108_0042434 3300048911 Bacteria 3797
241 Ga0496108_0732526 3300048911 Bacteria 856
242 Ga0496109_0138203 3300048912 Bacteria 2278
243 Ga0496109_0276112 3300048912 Bacteria 1583
244 Ga0496111_0179301 3300048914 Bacteria 1574
245 Ga0496112_0087192 3300048915 Bacteria 3088
246 Ga0496113_0252063 3300048916 Bacteria 1409
247 Ga0496114_0072716 3300048917 Bacteria 2892
248 Ga0496114_0125839 3300048917 Bacteria 2209
249 Ga0496115_1427221 3300048918 Bacteria 510
250 Ga0496117_0002937 3300048920 Bacteria 20634
251 Ga0496119_0001836 3300048922 Bacteria 24586
252 Ga0496120_0000273 3300048923 Bacteria 86248
253 Ga0496121_0002378 3300048924 Bacteria 28917
254 Ga0496122_0025661 3300048925 Bacteria 5109
255 Ga0496122_0058118 3300048925 Bacteria 2866
256 Ga0496123_0000137 3300048926 Bacteria 152169
257 Ga0496123_0050227 3300048926 Bacteria 2788
258 Ga0496124_0000052 3300048927 Bacteria 252750
259 Ga0496124_0019490 3300048927 Bacteria 6310
260 Ga0496124_0201459 3300048927 Bacteria 1513
261 Ga0496124_0267542 3300048927 Bacteria 1254
262 Ga0496126_0037273 3300048929 Bacteria 4539
263 Ga0496126_0193393 3300048929 Bacteria 1722
264 Ga0501033_0004007 3300049570 Bacteria 11913
265 Ga0501034_0000879 3300049571 Bacteria 44148
266 Ga0501034_0001210 3300049571 Bacteria 35418
267 Ga0501043_0001302 3300049579 Bacteria 21839
268 Ga0501250_040708 3300049680 Bacteria 681
269 Ga0501225_0018602 3300049705 Bacteria 1925
270 Ga0501268_094016 3300049765 Bacteria 635
271 Ga0501270_009597 3300049767 Bacteria 1254
272 Ga0501035_0317793 3300049822 Bacteria 1309
273 nmdc:mga00v17_136133_c1 3300050491 Bacteria 1573
274 nmdc:mga00v17_178073_c1 3300050491 Bacteria 1372
275 Ga0500658_0194521 3300053134 Bacteria 926
276 Ga0500609_013684 3300053731 Bacteria 1098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042014 Ga0439457_073321 Ga0439457_073321_370_771 131
2 3300041404 Ga0439436_0219079 Ga0439436_0219079_127_537 135
3 3300041408 Ga0439453_0118329 Ga0439453_0118329_182_592 135
4 3300048927 Ga0496124_0000052 Ga0496124_0000052_250539_251018 144
5 3300005355 Ga0070671_100060330 Ga0070671_1000603302 146
6 3300025931 Ga0207644_10025574 Ga0207644_100255742 146
7 3300037418 Ga0395900_0921511 Ga0395900_0921511_263_742 146
8 3300046525 Ga0495663_0139716 Ga0495663_0139716_274_759 146
9 3300046539 Ga0495621_0000337 Ga0495621_0000337_10797_11282 146
10 3300046615 Ga0495656_0073862 Ga0495656_0073862_173_658 146
11 3300046664 Ga0495659_0039856 Ga0495659_0039856_262_747 146
12 3300048090 Ga0495615_0003382 Ga0495615_0003382_69_554 146
13 3300048903 Ga0496100_0090477 Ga0496100_0090477_1107_1586 146
14 3300048904 Ga0496101_0202450 Ga0496101_0202450_34_513 146
15 3300048904 Ga0496101_0211684 Ga0496101_0211684_447_926 146
16 3300048911 Ga0496108_0042434 Ga0496108_0042434_2698_3177 146
17 3300048912 Ga0496109_0138203 Ga0496109_0138203_1567_2046 146
18 3300048915 Ga0496112_0087192 Ga0496112_0087192_93_572 146
19 3300048918 Ga0496115_1427221 Ga0496115_1427221_11_490 146
20 3300003781 Ga0055536_1012076 Ga0055536_10120762 148
21 3300003781 Ga0055536_1059884 Ga0055536_10598842 148
22 3300003794 Ga0055531_10004248 Ga0055531_100042486 148
23 3300013102 Ga0157371_10557590 Ga0157371_105575901 148
24 3300025292 Ga0209676_1002832 Ga0209676_100283210 148
25 3300025292 Ga0209676_1014104 Ga0209676_10141042 148
26 3300025292 Ga0209676_1016805 Ga0209676_10168052 148
27 3300025294 Ga0209025_1050230 Ga0209025_10502302 148
28 3300025304 Ga0209257_1000414 Ga0209257_100041428 148
29 3300041404 Ga0439436_0053437 Ga0439436_0053437_367_813 148
30 3300041999 Ga0439433_0013187 Ga0439433_0013187_660_1106 148
31 3300042006 Ga0439432_042032 Ga0439432_042032_70_522 148
32 3300042130 Ga0450892_022418 Ga0450892_022418_17_463 148
33 3300046507 Ga0495606_0022657 Ga0495606_0022657_1504_1983 148
34 3300042004 Ga0439445_0190919 Ga0439445_0190919_135_587 149
35 3300003794 Ga0055531_10039510 Ga0055531_100395102 150
36 3300025304 Ga0209257_1000046 Ga0209257_1000046295 150
37 3300041441 Ga0451787_509403 Ga0451787_509403_94_546 150
38 3300041451 Ga0451791_1412553 Ga0451791_1412553_229_681 150
39 3300041460 Ga0451802_1772622 Ga0451802_1772622_1820_2272 150
40 3300041486 Ga0451807_2204680 Ga0451807_2204680_2239_2691 150
41 3300041494 Ga0451837_0856215 Ga0451837_0856215_118_570 150
42 3300046513 Ga0495616_0112833 Ga0495616_0112833_20_472 150
43 3300048925 Ga0496122_0058118 Ga0496122_0058118_920_1372 150
44 3300048926 Ga0496123_0050227 Ga0496123_0050227_1374_1826 150
45 3300048927 Ga0496124_0201459 Ga0496124_0201459_173_625 150
46 3300048929 Ga0496126_0193393 Ga0496126_0193393_1099_1551 150
47 3300041494 Ga0451837_1451510 Ga0451837_1451510_2686_3147 151
48 3300049765 Ga0501268_094016 Ga0501268_094016_32_493 151
49 iso_pu_bacteria 2571042365 2572254296 154
50 iso_pu_bacteria 2643221695 2644528186 154
51 iso_pu_bacteria 2643221559 2643818254 155
52 iso_pu_bacteria 2643221573 2643880444 155
53 iso_pu_bacteria 2643221586 2643937923 155
54 iso_pu_bacteria 2643221593 2643973415 155
55 iso_pu_bacteria 2643221612 2644078832 155
56 iso_pu_bacteria 2643221720 2644661019 155
57 iso_pu_bacteria 2643221727 2644693609 155
58 iso_pu_bacteria 2643221728 2644699101 155
59 iso_pu_bacteria 2894414249 2894414289 155
60 iso_pu_bacteria 2919513703 2919517149 155
61 iso_pu_bacteria 2919675420 2919677604 155
62 iso_pu_bacteria 2941489479 2941493620 155
63 iso_pu_bacteria 2995948881 2995949600 155
64 iso_pu_bacteria 8002869464 8002870938 155
65 iso_pu_bacteria 8003014200 8003015473 155
66 iso_pu_bacteria 2643221579 2643906692 156
67 iso_pu_bacteria 2643221581 2643913807 156
68 iso_pu_bacteria 2923516293 2923519718 156
69 iso_pu_bacteria 2818991457 2819661342 157
70 iso_pu_bacteria 2852684882 2852687212 157
71 iso_pu_bacteria 2895498888 2895499882 157
72 iso_pu_bacteria 2895511927 2895512859 157
73 iso_pu_bacteria 2895522137 2895522867 157
74 iso_pu_bacteria 2895525241 2895525361 157
75 iso_pu_bacteria 8021622325 8021625538 157
76 iso_pu_bacteria 8021626552 8021628626 157
77 iso_pu_bacteria 8021648035 8021649771 157
78 3300013100 Ga0157373_10125516 Ga0157373_101255162 158
79 3300030745 Ga0316182_1441073 Ga0316182_14410732 158
80 3300031548 Ga0307408_100121982 Ga0307408_1001219822 158
81 3300031824 Ga0307413_10047736 Ga0307413_100477362 158
82 3300031824 Ga0307413_10795265 Ga0307413_107952652 158
83 3300031852 Ga0307410_10143514 Ga0307410_101435142 158
84 3300031911 Ga0307412_10045496 Ga0307412_100454962 158
85 3300031911 Ga0307412_11475438 Ga0307412_114754381 158
86 3300031995 Ga0307409_100355200 Ga0307409_1003552001 158
87 3300032002 Ga0307416_100087822 Ga0307416_1000878223 158
88 3300032005 Ga0307411_10003756 Ga0307411_100037563 158
89 3300032005 Ga0307411_10073927 Ga0307411_100739272 158
90 3300032126 Ga0307415_100063739 Ga0307415_1000637392 158
91 3300041404 Ga0439436_0008449 Ga0439436_0008449_977_1459 158
92 3300041406 Ga0439439_0138101 Ga0439439_0138101_76_558 158
93 3300042004 Ga0439445_0049793 Ga0439445_0049793_61_543 158
94 3300042006 Ga0439432_016661 Ga0439432_016661_266_748 158
95 3300042007 Ga0439449_0016826 Ga0439449_0016826_1466_1948 158
96 3300042007 Ga0439449_0020263 Ga0439449_0020263_1588_2070 158
97 3300042007 Ga0439449_0134562 Ga0439449_0134562_213_692 158
98 3300042015 Ga0439462_0041000 Ga0439462_0041000_395_877 158
99 3300042015 Ga0439462_0081064 Ga0439462_0081064_374_853 158
100 3300046525 Ga0495663_0166005 Ga0495663_0166005_55_537 158
101 3300046539 Ga0495621_0031062 Ga0495621_0031062_480_962 158
102 3300046615 Ga0495656_0020763 Ga0495656_0020763_1394_1876 158
103 3300046664 Ga0495659_0019913 Ga0495659_0019913_1337_1819 158
104 3300047318 Ga0495636_0000510 Ga0495636_0000510_4743_5225 158
105 3300047447 Ga0495685_011714 Ga0495685_011714_1945_2427 158
106 3300048090 Ga0495615_0220462 Ga0495615_0220462_17_499 158
107 3300049680 Ga0501250_040708 Ga0501250_040708_12_494 158
108 3300049767 Ga0501270_009597 Ga0501270_009597_56_538 158
109 3300049822 Ga0501035_0317793 Ga0501035_0317793_106_588 158
110 3300003187 JGI25151J46595_10000160 JGI25151J46595_1000016028 159
111 3300003187 JGI25151J46595_10008797 JGI25151J46595_100087972 159
112 3300003322 rootL2_10016420 rootL2_100164203 159
113 3300003771 Ga0055526_1000014 Ga0055526_100001463 159
114 3300003771 Ga0055526_1071461 Ga0055526_10714611 159
115 3300003773 Ga0055537_1000059 Ga0055537_100005959 159
116 3300003775 Ga0055524_1000019 Ga0055524_1000019152 159
117 3300003781 Ga0055536_1018806 Ga0055536_10188062 159
118 3300003781 Ga0055536_1022967 Ga0055536_10229672 159
119 3300003784 Ga0055534_1000012 Ga0055534_100001263 159
120 3300003790 Ga0055528_1000007 Ga0055528_100000763 159
121 3300003791 Ga0055530_10002905 Ga0055530_100029055 159
122 3300003794 Ga0055531_10010263 Ga0055531_100102634 159
123 3300003794 Ga0055531_10010914 Ga0055531_100109145 159
124 3300003794 Ga0055531_10029158 Ga0055531_100291582 159
125 3300005329 Ga0070683_101176700 Ga0070683_1011767001 159
126 3300005331 Ga0070670_100049396 Ga0070670_1000493962 159
127 3300005331 Ga0070670_100278412 Ga0070670_1002784121 159
128 3300005333 Ga0070677_10100965 Ga0070677_101009652 159
129 3300005336 Ga0070680_100319036 Ga0070680_1003190362 159
130 3300005345 Ga0070692_10779372 Ga0070692_107793721 159
131 3300005347 Ga0070668_100061447 Ga0070668_1000614472 159
132 3300005354 Ga0070675_100060094 Ga0070675_1000600942 159
133 3300005354 Ga0070675_100113027 Ga0070675_1001130272 159
134 3300005355 Ga0070671_100055494 Ga0070671_1000554942 159
135 3300005364 Ga0070673_100653350 Ga0070673_1006533502 159
136 3300005367 Ga0070667_100285453 Ga0070667_1002854532 159
137 3300005530 Ga0070679_100623184 Ga0070679_1006231841 159
138 3300005618 Ga0068864_100372816 Ga0068864_1003728162 159
139 3300005719 Ga0068861_100097331 Ga0068861_1000973312 159
140 3300005841 Ga0068863_100071799 Ga0068863_1000717993 159
141 3300006051 Ga0075364_10030063 Ga0075364_100300633 159
142 3300006051 Ga0075364_10082069 Ga0075364_100820692 159
143 3300009177 Ga0105248_10321904 Ga0105248_103219042 159
144 3300012510 Ga0157316_1004231 Ga0157316_10042312 159
145 3300012512 Ga0157327_1000122 Ga0157327_10001223 159
146 3300013308 Ga0157375_10991242 Ga0157375_109912422 159
147 3300013308 Ga0157375_13137210 Ga0157375_131372101 159
148 3300015689 Ga0183360_10002 Ga0183360_10002741 159
149 3300025245 Ga0207425_1013497 Ga0207425_10134972 159
150 3300025263 Ga0209565_1000001 Ga0209565_1000001394 159
151 3300025273 Ga0209673_1000001 Ga0209673_1000001394 159
152 3300025273 Ga0209673_1022337 Ga0209673_10223371 159
153 3300025284 Ga0209130_1002194 Ga0209130_10021947 159
154 3300025291 Ga0209675_1000001 Ga0209675_10000012137 159
155 3300025291 Ga0209675_1012909 Ga0209675_10129092 159
156 3300025292 Ga0209676_1000501 Ga0209676_100050154 159
157 3300025292 Ga0209676_1002219 Ga0209676_100221914 159
158 3300025294 Ga0209025_1000006 Ga0209025_1000006685 159
159 3300025294 Ga0209025_1003295 Ga0209025_10032959 159
160 3300025294 Ga0209025_1005504 Ga0209025_10055043 159
161 3300025294 Ga0209025_1039653 Ga0209025_10396531 159
162 3300025295 Ga0209564_1000001 Ga0209564_10000012299 159
163 3300025295 Ga0209564_1028516 Ga0209564_10285162 159
164 3300025297 Ga0209758_1088284 Ga0209758_10882842 159
165 3300025298 Ga0209050_1004903 Ga0209050_10049032 159
166 3300025299 Ga0209256_1000006 Ga0209256_1000006735 159
167 3300025299 Ga0209256_1009139 Ga0209256_10091392 159
168 3300025299 Ga0209256_1009484 Ga0209256_10094842 159
169 3300025299 Ga0209256_1013937 Ga0209256_10139373 159
170 3300025302 Ga0207426_1022125 Ga0207426_10221252 159
171 3300025303 Ga0209051_1018076 Ga0209051_10180763 159
172 3300025304 Ga0209257_1000067 Ga0209257_1000067244 159
173 3300025304 Ga0209257_1003369 Ga0209257_10033693 159
174 3300025304 Ga0209257_1008502 Ga0209257_10085026 159
175 3300025304 Ga0209257_1012560 Ga0209257_10125603 159
176 3300025304 Ga0209257_1018200 Ga0209257_10182002 159
177 3300025893 Ga0207682_10142118 Ga0207682_101421181 159
178 3300025908 Ga0207643_10482769 Ga0207643_104827692 159
179 3300025912 Ga0207707_10512780 Ga0207707_105127802 159
180 3300025925 Ga0207650_10175765 Ga0207650_101757652 159
181 3300025925 Ga0207650_10277985 Ga0207650_102779852 159
182 3300025945 Ga0207679_10395120 Ga0207679_103951202 159
183 3300025949 Ga0207667_10290180 Ga0207667_102901802 159
184 3300025960 Ga0207651_10456836 Ga0207651_104568362 159
185 3300026088 Ga0207641_10073353 Ga0207641_100733532 159
186 3300031456 Ga0307513_10002018 Ga0307513_1000201831 159
187 3300031548 Ga0307408_100171070 Ga0307408_1001710702 159
188 3300031548 Ga0307408_100957426 Ga0307408_1009574261 159
189 3300031731 Ga0307405_10040600 Ga0307405_100406001 159
190 3300031731 Ga0307405_10157019 Ga0307405_101570192 159
191 3300031731 Ga0307405_10412688 Ga0307405_104126882 159
192 3300031824 Ga0307413_10000577 Ga0307413_100005776 159
193 3300031824 Ga0307413_10213713 Ga0307413_102137132 159
194 3300031824 Ga0307413_10282989 Ga0307413_102829892 159
195 3300031824 Ga0307413_11843465 Ga0307413_118434651 159
196 3300031852 Ga0307410_10309734 Ga0307410_103097342 159
197 3300031852 Ga0307410_10697731 Ga0307410_106977311 159
198 3300031901 Ga0307406_10007200 Ga0307406_100072002 159
199 3300031901 Ga0307406_11013027 Ga0307406_110130271 159
200 3300031903 Ga0307407_10010021 Ga0307407_100100213 159
201 3300031903 Ga0307407_10735834 Ga0307407_107358341 159
202 3300031911 Ga0307412_10024406 Ga0307412_100244063 159
203 3300031911 Ga0307412_10162446 Ga0307412_101624461 159
204 3300031911 Ga0307412_10217238 Ga0307412_102172382 159
205 3300031911 Ga0307412_10381237 Ga0307412_103812372 159
206 3300031995 Ga0307409_100104029 Ga0307409_1001040292 159
207 3300031995 Ga0307409_100405885 Ga0307409_1004058852 159
208 3300032002 Ga0307416_100351652 Ga0307416_1003516521 159
209 3300032004 Ga0307414_10001515 Ga0307414_100015152 159
210 3300032004 Ga0307414_10002017 Ga0307414_100020173 159
211 3300032004 Ga0307414_10013601 Ga0307414_100136015 159
212 3300032004 Ga0307414_10019771 Ga0307414_100197713 159
213 3300032004 Ga0307414_10092851 Ga0307414_100928512 159
214 3300032004 Ga0307414_10110411 Ga0307414_101104112 159
215 3300032004 Ga0307414_10326840 Ga0307414_103268402 159
216 3300032004 Ga0307414_10770850 Ga0307414_107708502 159
217 3300032004 Ga0307414_10854734 Ga0307414_108547342 159
218 3300032005 Ga0307411_10213888 Ga0307411_102138882 159
219 3300037418 Ga0395900_0035900 Ga0395900_0035900_113_592 159
220 3300037471 Ga0395905_0037574 Ga0395905_0037574_776_1255 159
221 3300038443 Ga0395901_0382375 Ga0395901_0382375_619_1098 159
222 3300041404 Ga0439436_0001472 Ga0439436_0001472_1733_2218 159
223 3300041404 Ga0439436_0012052 Ga0439436_0012052_15_500 159
224 3300041404 Ga0439436_0023100 Ga0439436_0023100_345_830 159
225 3300041406 Ga0439439_0003435 Ga0439439_0003435_1221_1706 159
226 3300041407 Ga0439447_002882 Ga0439447_002882_4066_4551 159
227 3300041413 Ga0439465_0007763 Ga0439465_0007763_717_1202 159
228 3300041441 Ga0451787_444939 Ga0451787_444939_206_685 159
229 3300041486 Ga0451807_0802952 Ga0451807_0802952_111_590 159
230 3300041997 Ga0439431_0051747 Ga0439431_0051747_477_956 159
231 3300042004 Ga0439445_0222503 Ga0439445_0222503_20_499 159
232 3300042007 Ga0439449_0060211 Ga0439449_0060211_79_564 159
233 3300042007 Ga0439449_0100451 Ga0439449_0100451_19_498 159
234 3300042007 Ga0439449_0250256 Ga0439449_0250256_24_509 159
235 3300042014 Ga0439457_087196 Ga0439457_087196_170_649 159
236 3300042142 Ga0450905_060976 Ga0450905_060976_129_608 159
237 3300042876 Ga0451577_0004321 Ga0451577_0004321_3727_4206 159
238 3300044712 Ga0453684_0967066 Ga0453684_0967066_308_787 159
239 3300046460 Ga0495638_0029385 Ga0495638_0029385_1767_2246 159
240 3300046460 Ga0495638_0062628 Ga0495638_0062628_376_861 159
241 3300046525 Ga0495663_0002657 Ga0495663_0002657_1642_2121 159
242 3300046525 Ga0495663_0019761 Ga0495663_0019761_1115_1600 159
243 3300046525 Ga0495663_0034199 Ga0495663_0034199_671_1156 159
244 3300046615 Ga0495656_0000692 Ga0495656_0000692_4886_5371 159
245 3300046616 Ga0495668_0005968 Ga0495668_0005968_13_498 159
246 3300047318 Ga0495636_0035009 Ga0495636_0035009_174_659 159
247 3300047445 Ga0495677_0015306 Ga0495677_0015306_2194_2679 159
248 3300048903 Ga0496100_0462529 Ga0496100_0462529_442_927 159
249 3300048904 Ga0496101_0286072 Ga0496101_0286072_197_682 159
250 3300048905 Ga0496102_0217468 Ga0496102_0217468_812_1297 159
251 3300048911 Ga0496108_0732526 Ga0496108_0732526_296_775 159
252 3300048912 Ga0496109_0276112 Ga0496109_0276112_336_821 159
253 3300048914 Ga0496111_0179301 Ga0496111_0179301_21_506 159
254 3300048916 Ga0496113_0252063 Ga0496113_0252063_754_1239 159
255 3300048917 Ga0496114_0125839 Ga0496114_0125839_1136_1621 159
256 3300048924 Ga0496121_0002378 Ga0496121_0002378_26739_27224 159
257 3300048927 Ga0496124_0267542 Ga0496124_0267542_405_890 159
258 3300049570 Ga0501033_0004007 Ga0501033_0004007_6286_6765 159
259 3300049579 Ga0501043_0001302 Ga0501043_0001302_19531_20016 159
260 3300050491 nmdc:mga00v17_136133_c1 nmdc:mga00v17_136133_c1_1053_1532 159
261 3300050491 nmdc:mga00v17_178073_c1 nmdc:mga00v17_178073_c1_620_1099 159
262 3300053134 Ga0500658_0194521 Ga0500658_0194521_348_827 159
263 3300053731 Ga0500609_013684 Ga0500609_013684_67_546 159
264 3300003781 Ga0055536_1004024 Ga0055536_10040242 160
265 3300005289 Ga0065704_10101394 Ga0065704_101013942 160
266 3300005347 Ga0070668_100004200 Ga0070668_1000042007 160
267 3300014326 Ga0157380_10759185 Ga0157380_107591852 160
268 3300025292 Ga0209676_1000052 Ga0209676_1000052226 160
269 3300028380 Ga0268265_10657873 Ga0268265_106578732 160
270 3300030736 Ga0316180_1013283 Ga0316180_10132832 160
271 3300032004 Ga0307414_10055281 Ga0307414_100552813 160
272 3300032004 Ga0307414_10184357 Ga0307414_101843572 160
273 3300041404 Ga0439436_0029997 Ga0439436_0029997_249_734 160
274 3300041494 Ga0451837_1503881 Ga0451837_1503881_130_612 160
275 3300041509 Ga0451843_1398491 Ga0451843_1398491_16_498 160
276 3300041999 Ga0439433_0068644 Ga0439433_0068644_227_712 160
277 3300042007 Ga0439449_0000031 Ga0439449_0000031_1726_2211 160
278 3300046615 Ga0495656_0098656 Ga0495656_0098656_160_648 160
279 3300047318 Ga0495636_0061136 Ga0495636_0061136_945_1433 160
280 3300048917 Ga0496114_0072716 Ga0496114_0072716_978_1463 160
281 3300048929 Ga0496126_0037273 Ga0496126_0037273_2705_3190 160
282 3300049571 Ga0501034_0000879 Ga0501034_0000879_2037_2522 160
283 3300049571 Ga0501034_0001210 Ga0501034_0001210_3254_3736 160
284 3300049705 Ga0501225_0018602 Ga0501225_0018602_789_1274 160
285 2162886007 SwRhRL2b_contig_794112 SwRhRL2b_0531.00000700 161
286 3300005289 Ga0065704_10093971 Ga0065704_100939711 161
287 3300005331 Ga0070670_100008914 Ga0070670_1000089142 161
288 3300009011 Ga0105251_10000155 Ga0105251_1000015548 161
289 3300009148 Ga0105243_10004154 Ga0105243_100041545 161
290 3300015265 Ga0182005_1008758 Ga0182005_10087582 161
291 3300025735 Ga0207713_1000196 Ga0207713_100019611 161
292 3300025925 Ga0207650_10001854 Ga0207650_1000185411 161
293 3300027312 Ga0209371_1000025 Ga0209371_100002557 161
294 3300030500 Ga0268256_1000027 Ga0268256_100002757 161
295 3300041451 Ga0451791_1559947 Ga0451791_1559947_171_659 161
296 3300041459 Ga0451800_0574995 Ga0451800_0574995_1882_2370 161
297 3300041462 Ga0451806_258175 Ga0451806_258175_6150_6638 161
298 3300041463 Ga0451804_0604079 Ga0451804_0604079_202_690 161
299 3300041486 Ga0451807_0776096 Ga0451807_0776096_1913_2401 161
300 3300048920 Ga0496117_0002937 Ga0496117_0002937_3171_3656 161
301 3300048922 Ga0496119_0001836 Ga0496119_0001836_1470_1955 161
302 3300048923 Ga0496120_0000273 Ga0496120_0000273_83741_84226 161
303 3300048925 Ga0496122_0025661 Ga0496122_0025661_2626_3111 161
304 3300048926 Ga0496123_0000137 Ga0496123_0000137_148570_149055 161
305 3300048927 Ga0496124_0019490 Ga0496124_0019490_2814_3299 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

2

153

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.5423 11 160
4z7f-assembly3.cif.gz_F crystal structure of folt bound with folic acid 0.5272 5 154
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.5207 7 156
8aq2-assembly1.cif.gz_A in meso structure of the membrane integral lipoprotein n-acyltransferase lnt from p. aeruginosa covalently linked with titc 0.5124 2 157
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.5099 11 160
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9111 5 152 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8831 5 152 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6757 9 154 1.10.1760.20
af_Q2G061_16_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6544 5 152 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6198 9 154 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A2T1I0C7-F1-model_v4 deleted 0.9701 39 161
AF-G7UN05-F1-model_v4 Rod shape-determining protein MreD 0.9621 1 160 GO:0005886
GO:0008360
AF-G7UN05-F1-model_v4 Rod shape-determining protein MreD 0.9563 1 160 GO:0005886
GO:0008360
AF-A0A2W5KXJ4-F1-model_v4 deleted 0.9538 24 159
AF-A0A2K1Q041-F1-model_v4 Rod shape-determining protein MreD 0.9523 5 159 GO:0005886
GO:0008360

Feature Viewer

pLDDT pTM Quality
89.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map