F398074

General Info

Members Datasets Scaffolds Average Seq Length
305 178 610 307

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100001095|Ga0075436_1000010957
Length 315
Sequence MPSGSKQAQDADQQKTPRRRLAPRGGKFKRGPTELVIITGMSGSGKGSVLKAFEDLGYYCVDNLPLELIPRFADLARQSPEIERTALVVDIREGQTLTRLPQILKQVKRTINTQVVFLEASDESLVRRFSETRRPHPLGKSSSVASAISSEREKLDFVRNLADVIIDTSKFNVHELRSHILEKFQDGKAGTHSILVSCVSFGFKNGVPSDSDLVFDVRFLPNPHFVPEFRPLTGKHPKVAAYIRQFPQTKEFIDRISELLIYLMPHYIREGKSYLTIAFGCTGGQHRSVMIAEDVAKRLKKAGYNVKAQHRDSPK

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 1.31
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 6.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100001095 3300006914 Bacteria 18285
2 Ga0070658_10000039 3300005327 Bacteria 136150
3 Ga0070658_10032829 3300005327 Bacteria 4174
4 Ga0070658_10158105 3300005327 Bacteria 1900
5 Ga0070676_10007821 3300005328 Bacteria 5747
6 Ga0070683_100000002 3300005329 Bacteria 427530
7 Ga0068869_100000936 3300005334 Bacteria 16853
8 Ga0068869_100098209 3300005334 Bacteria 2212
9 Ga0070666_10126066 3300005335 Bacteria 1777
10 Ga0070660_100086871 3300005339 Bacteria 2461
11 Ga0070661_100139495 3300005344 Bacteria 1826
12 Ga0070668_100053632 3300005347 Bacteria 3110
13 Ga0070673_100197445 3300005364 Bacteria 1731
14 Ga0070659_100001862 3300005366 Bacteria 15160
15 Ga0070667_100024006 3300005367 Bacteria 5064
16 Ga0070709_10011710 3300005434 Bacteria 4898
17 Ga0070709_10015574 3300005434 Bacteria 4329
18 Ga0070714_100055865 3300005435 Bacteria 3375
19 Ga0070714_100066473 3300005435 Bacteria 3107
20 Ga0070714_100121248 3300005435 Bacteria 2326
21 Ga0070713_100033467 3300005436 Bacteria 4118
22 Ga0070713_100039386 3300005436 Bacteria 3835
23 Ga0070713_100068391 3300005436 Bacteria 2992
24 Ga0070713_100073402 3300005436 Bacteria 2896
25 Ga0070710_10021269 3300005437 Bacteria 3378
26 Ga0070663_100010653 3300005455 Bacteria 5737
27 Ga0070663_100154302 3300005455 Bacteria 1763
28 Ga0070663_100349969 3300005455 Bacteria 1196
29 Ga0070681_10261556 3300005458 Unclassified 1642
30 Ga0068867_100056895 3300005459 Bacteria 2895
31 Ga0068867_100108387 3300005459 Bacteria 2130
32 Ga0070685_10190667 3300005466 Bacteria 1326
33 Ga0070707_100470448 3300005468 Unclassified 1218
34 Ga0070679_100094812 3300005530 Bacteria 2972
35 Ga0070679_100187907 3300005530 Bacteria 2036
36 Ga0070684_100000007 3300005535 Bacteria 217174
37 Ga0068853_100001728 3300005539 Bacteria 16004
38 Ga0068853_100004326 3300005539 Bacteria 10984
39 Ga0068853_100050767 3300005539 Unclassified 3568
40 Ga0070693_100068131 3300005547 Bacteria 2088
41 Ga0070665_100071425 3300005548 Bacteria 3477
42 Ga0070665_100079866 3300005548 Unclassified 3276
43 Ga0070665_100525024 3300005548 Bacteria 1195
44 Ga0068855_100042363 3300005563 Bacteria 5393
45 Ga0068855_100052136 3300005563 Bacteria 4817
46 Ga0068855_100064806 3300005563 Bacteria 4261
47 Ga0068855_100067041 3300005563 Bacteria 4184
48 Ga0068855_100224586 3300005563 Bacteria 2105
49 Ga0068855_100434549 3300005563 Bacteria 1434
50 Ga0068854_100462779 3300005578 Bacteria 1061
51 Ga0068856_100331917 3300005614 Bacteria 1538
52 Ga0068856_100403065 3300005614 Bacteria 1387
53 Ga0068852_100032810 3300005616 Bacteria 4304
54 Ga0068852_100568647 3300005616 Bacteria 1135
55 Ga0068859_100364107 3300005617 Bacteria 1541
56 Ga0068851_10010273 3300005834 Bacteria 4365
57 Ga0068863_100014343 3300005841 Bacteria 7632
58 Ga0068863_100042069 3300005841 Bacteria 4343
59 Ga0068858_100004071 3300005842 Bacteria 14401
60 Ga0068860_100036366 3300005843 Bacteria 4719
61 Ga0068860_100109057 3300005843 Unclassified 2646
62 Ga0081540_1002998 3300005983 Bacteria 13532
63 Ga0070717_10003800 3300006028 Bacteria 10860
64 Ga0070717_10319734 3300006028 Bacteria 1383
65 Ga0070716_100001116 3300006173 Bacteria 11824
66 Ga0070716_100052172 3300006173 Bacteria 2328
67 Ga0070716_100241366 3300006173 Bacteria 1225
68 Ga0070712_100002921 3300006175 Bacteria 10592
69 Ga0070712_100033923 3300006175 Unclassified 3457
70 Ga0070712_100318432 3300006175 Bacteria 1264
71 Ga0097621_100006950 3300006237 Bacteria 8057
72 Ga0068871_100063433 3300006358 Bacteria 3022
73 Ga0068871_100115085 3300006358 Unclassified 2267
74 Ga0068871_100290134 3300006358 Bacteria 1433
75 Ga0075430_100032476 3300006846 Bacteria 4432
76 Ga0075434_100013513 3300006871 Bacteria 7775
77 Ga0075434_100206935 3300006871 Bacteria 1983
78 Ga0068865_100020906 3300006881 Bacteria 4250
79 Ga0075436_100000421 3300006914 Bacteria 27135
80 Ga0075436_100000619 3300006914 Bacteria 23292
81 Ga0075436_100220024 3300006914 Bacteria 1347
82 Ga0097620_100364073 3300006931 Bacteria 1541
83 Ga0075435_100000835 3300007076 Bacteria 19219
84 Ga0075435_100093709 3300007076 Bacteria 2482
85 Ga0075435_100204584 3300007076 Unclassified 1673
86 Ga0105240_10051057 3300009093 Bacteria 5207
87 Ga0105240_10284442 3300009093 Bacteria 1898
88 Ga0105240_10703971 3300009093 Bacteria 1102
89 Ga0105245_10007085 3300009098 Bacteria 9837
90 Ga0105245_10014746 3300009098 Bacteria 6806
91 Ga0105245_10051170 3300009098 Bacteria 3703
92 Ga0105243_10026075 3300009148 Bacteria 4472
93 Ga0105241_10002506 3300009174 Bacteria 13802
94 Ga0105242_10051801 3300009176 Bacteria 3347
95 Ga0105248_10051163 3300009177 Bacteria 4636
96 Ga0105248_10074388 3300009177 Bacteria 3818
97 Ga0105248_10189776 3300009177 Bacteria 2316
98 Ga0105238_10043404 3300009551 Bacteria 4550
99 Ga0105238_10358136 3300009551 Bacteria 1448
100 Ga0105249_10024588 3300009553 Bacteria 5415
101 Ga0105239_10075825 3300010375 Bacteria 3698
102 Ga0105239_10372757 3300010375 Unclassified 1613
103 Ga0105246_10024213 3300011119 Bacteria 3941
104 Ga0105246_10359925 3300011119 Unclassified 1195
105 Ga0157373_10001258 3300013100 Bacteria 19350
106 Ga0157370_10019751 3300013104 Bacteria 6745
107 Ga0157370_10058224 3300013104 Bacteria 3673
108 Ga0157370_10123544 3300013104 Bacteria 2417
109 Ga0157370_10175237 3300013104 Bacteria 1993
110 Ga0157370_10539110 3300013104 Bacteria 1070
111 Ga0157369_10011409 3300013105 Bacteria 10091
112 Ga0157369_10052660 3300013105 Bacteria 4403
113 Ga0157369_10087485 3300013105 Bacteria 3327
114 Ga0157369_10128742 3300013105 Bacteria 2683
115 Ga0157369_10158924 3300013105 Bacteria 2386
116 Ga0157369_10187783 3300013105 Bacteria 2173
117 Ga0157369_10229761 3300013105 Bacteria 1940
118 Ga0157374_10085229 3300013296 Bacteria 3004
119 Ga0157378_10091178 3300013297 Unclassified 2770
120 Ga0163162_10001630 3300013306 Bacteria 20998
121 Ga0157372_10007560 3300013307 Bacteria 11553
122 Ga0157372_10010401 3300013307 Bacteria 9891
123 Ga0157372_10013954 3300013307 Bacteria 8584
124 Ga0157372_10015017 3300013307 Bacteria 8288
125 Ga0157372_10032539 3300013307 Bacteria 5720
126 Ga0157372_10141606 3300013307 Bacteria 2771
127 Ga0157372_10144884 3300013307 Bacteria 2739
128 Ga0157372_10677504 3300013307 Bacteria 1200
129 Ga0163163_10425343 3300014325 Bacteria 1387
130 Ga0157376_10015808 3300014969 Bacteria 5711
131 Ga0157376_10022975 3300014969 Bacteria 4872
132 Ga0213875_10112926 3300021388 Bacteria 1269
133 Ga0207697_10008083 3300025315 Bacteria 4639
134 Ga0207656_10011843 3300025321 Bacteria 3302
135 Ga0207692_10014869 3300025898 Bacteria 3411
136 Ga0207680_10036981 3300025903 Bacteria 2815
137 Ga0207647_10002172 3300025904 Bacteria 14965
138 Ga0207699_10010931 3300025906 Bacteria 4571
139 Ga0207699_10020139 3300025906 Bacteria 3570
140 Ga0207699_10054499 3300025906 Bacteria 2376
141 Ga0207699_10342578 3300025906 Bacteria 1053
142 Ga0207645_10014030 3300025907 Bacteria 5374
143 Ga0207705_10000063 3300025909 Bacteria 145090
144 Ga0207705_10013842 3300025909 Bacteria 5817
145 Ga0207705_10013955 3300025909 Bacteria 5793
146 Ga0207654_10003233 3300025911 Bacteria 8232
147 Ga0207695_10011971 3300025913 Bacteria 10441
148 Ga0207695_10190227 3300025913 Bacteria 1970
149 Ga0207671_10152126 3300025914 Bacteria 1788
150 Ga0207693_10002534 3300025915 Bacteria 15879
151 Ga0207693_10015724 3300025915 Bacteria 6064
152 Ga0207693_10027808 3300025915 Bacteria 4470
153 Ga0207693_10064757 3300025915 Unclassified 2863
154 Ga0207693_10328152 3300025915 Bacteria 1198
155 Ga0207663_10010291 3300025916 Bacteria 4973
156 Ga0207663_10129766 3300025916 Bacteria 1740
157 Ga0207657_10069428 3300025919 Bacteria 2990
158 Ga0207649_10014203 3300025920 Bacteria 4455
159 Ga0207649_10264601 3300025920 Bacteria 1244
160 Ga0207652_10134470 3300025921 Bacteria 2207
161 Ga0207652_10171736 3300025921 Bacteria 1946
162 Ga0207646_10042306 3300025922 Bacteria 4093
163 Ga0207694_10158775 3300025924 Bacteria 1825
164 Ga0207700_10101148 3300025928 Bacteria 2299
165 Ga0207700_10167134 3300025928 Bacteria 1832
166 Ga0207664_10029209 3300025929 Bacteria 4198
167 Ga0207664_10080039 3300025929 Bacteria 2654
168 Ga0207664_10101410 3300025929 Bacteria 2378
169 Ga0207706_10002815 3300025933 Bacteria 16887
170 Ga0207709_10014614 3300025935 Bacteria 4338
171 Ga0207665_10002642 3300025939 Bacteria 12045
172 Ga0207665_10086594 3300025939 Bacteria 2164
173 Ga0207665_10251992 3300025939 Bacteria 1305
174 Ga0207691_10009757 3300025940 Bacteria 9216
175 Ga0207711_10030880 3300025941 Bacteria 4519
176 Ga0207711_10366458 3300025941 Bacteria 1336
177 Ga0207689_10000068 3300025942 Bacteria 83861
178 Ga0207689_10039132 3300025942 Bacteria 3926
179 Ga0207661_10000003 3300025944 Bacteria 611941
180 Ga0207661_10073750 3300025944 Bacteria 2796
181 Ga0207667_10011625 3300025949 Bacteria 10220
182 Ga0207667_10023622 3300025949 Bacteria 6768
183 Ga0207667_10035388 3300025949 Bacteria 5356
184 Ga0207667_10042059 3300025949 Bacteria 4860
185 Ga0207651_10254235 3300025960 Bacteria 1439
186 Ga0207712_10014164 3300025961 Bacteria 5120
187 Ga0207712_10057132 3300025961 Bacteria 2752
188 Ga0207640_10000323 3300025981 Bacteria 31989
189 Ga0207677_10170436 3300026023 Bacteria 1701
190 Ga0207703_10015285 3300026035 Bacteria 5988
191 Ga0207639_10000266 3300026041 Bacteria 37399
192 Ga0207639_10196741 3300026041 Bacteria 1726
193 Ga0207678_10018712 3300026067 Bacteria 6083
194 Ga0207678_10116506 3300026067 Bacteria 2279
195 Ga0207641_10008840 3300026088 Bacteria 8319
196 Ga0207648_10019786 3300026089 Bacteria 6074
197 Ga0207683_10003661 3300026121 Bacteria 13361
198 Ga0207698_10212523 3300026142 Bacteria 1741
199 Ga0268266_10026568 3300028379 Bacteria 4926
200 Ga0268266_10391672 3300028379 Bacteria 1312
201 Ga0268264_10012417 3300028381 Bacteria 7011
202 Ga0268264_10041059 3300028381 Bacteria 3824
203 Ga0265770_1001370 3300030878 Bacteria 3355
204 Ga0265760_10000389 3300031090 Bacteria 12258
205 Ga0265760_10003408 3300031090 Bacteria 4622
206 Ga0265760_10034333 3300031090 Bacteria 1500
207 Ga0373936_0136694 3300035113 Bacteria 1056
208 Ga0373943_0111709 3300035170 Bacteria 1442
209 Ga0373935_0137116 3300035692 Bacteria 1649
210 Ga0373927_0102885 3300035695 Bacteria 1858
211 Ga0373947_0003115 3300035725 Bacteria 9866
212 Ga0373937_0096639 3300036401 Unclassified 2740
213 Ga0373925_0004835 3300037068 Bacteria 10141
214 Ga0373925_0028746 3300037068 Bacteria 4074
215 Ga0373925_0084361 3300037068 Bacteria 2421
216 Ga0395899_0360839 3300037312 Bacteria 970
217 Ga0395898_0026891 3300037466 Bacteria 5782
218 Ga0395898_0404185 3300037466 Bacteria 1302
219 Ga0395905_0015086 3300037471 Bacteria 7355
220 Ga0395905_0257575 3300037471 Bacteria 1629
221 Ga0395905_0332149 3300037471 Bacteria 1411
222 Ga0436364_0647884 3300037853 Bacteria 2451
223 Ga0395901_0155608 3300038443 Bacteria 2401
224 Ga0436365_1597601 3300039437 Unclassified 2314
225 Ga0436361_0004935 3300039447 Bacteria 20777
226 Ga0436363_0108277 3300039450 Bacteria 8227
227 Ga0436363_1261943 3300039450 Bacteria 4386
228 Ga0436362_0328808 3300039453 Unclassified 3709
229 Ga0453683_0116020 3300044673 Bacteria 1684
230 Ga0453684_0000951 3300044712 Bacteria 95417
231 Ga0466959_0077018 3300045049 Bacteria 2408
232 Ga0466959_0187884 3300045049 Bacteria 1443
233 Ga0451576_0037693 3300045051 Bacteria 5120
234 Ga0451576_0366795 3300045051 Bacteria 1508
235 Ga0466967_0080724 3300045976 Bacteria 2936
236 Ga0495603_0099534 3300046455 Unclassified 1697
237 Ga0495629_0012188 3300046459 Bacteria 6229
238 Ga0495650_0000029 3300046471 Bacteria 453466
239 Ga0495650_0001429 3300046471 Bacteria 23160
240 Ga0495580_0001070 3300046472 Bacteria 24068
241 Ga0495580_0001650 3300046472 Bacteria 19635
242 Ga0495580_0005830 3300046472 Bacteria 10104
243 Ga0495580_0009960 3300046472 Bacteria 7435
244 Ga0495580_0035680 3300046472 Bacteria 3575
245 Ga0495580_0107079 3300046472 Bacteria 1941
246 Ga0495580_0244409 3300046472 Bacteria 1230
247 Ga0495580_0246002 3300046472 Unclassified 1225
248 Ga0495582_0001112 3300046473 Bacteria 15109
249 Ga0495664_0014772 3300046477 Bacteria 4432
250 Ga0495594_0000339 3300046499 Bacteria 23297
251 Ga0495630_0108941 3300046517 Bacteria 2098
252 Ga0495644_0000028 3300046523 Bacteria 69977
253 Ga0495642_0007211 3300046528 Bacteria 4267
254 Ga0495652_0079147 3300046529 Bacteria 2719
255 Ga0495665_0000475 3300046531 Bacteria 20220
256 Ga0495587_0046183 3300046536 Bacteria 2586
257 Ga0495645_0055759 3300046543 Bacteria 2869
258 Ga0495633_0015590 3300046558 Bacteria 3940
259 Ga0495668_0016705 3300046616 Bacteria 4267
260 Ga0495625_0001870 3300046660 Bacteria 23919
261 Ga0495625_0042713 3300046660 Bacteria 3292
262 Ga0495625_0204634 3300046660 Bacteria 1300
263 Ga0495599_0114771 3300046678 Bacteria 1676
264 Ga0495670_0009557 3300046691 Bacteria 4764
265 Ga0495649_0122293 3300046694 Bacteria 1376
266 Ga0495604_0015843 3300047317 Bacteria 6018
267 Ga0495674_0113057 3300047319 Bacteria 2300
268 Ga0495672_0004280 3300047320 Bacteria 11780
269 Ga0495677_0021675 3300047445 Bacteria 2329
270 Ga0496105_0096103 3300048908 Bacteria 2447
271 Ga0496112_0005732 3300048915 Bacteria 10793
272 Ga0496112_0156958 3300048915 Bacteria 2242
273 Ga0496112_0302088 3300048915 Bacteria 1546
274 Ga0496126_0001289 3300048929 Bacteria 40164
275 Ga0496126_0078188 3300048929 Bacteria 2932
276 Ga0501031_0179253 3300049568 Bacteria 1384
277 Ga0501032_0018410 3300049569 Bacteria 4894
278 Ga0501033_0010593 3300049570 Bacteria 7069
279 Ga0501036_0012864 3300049572 Bacteria 6947
280 Ga0501038_0002558 3300049574 Bacteria 16961
281 Ga0501043_0001064 3300049579 Bacteria 24140
282 Ga0501046_0000520 3300049580 Bacteria 38045
283 Ga0501047_0002091 3300049581 Bacteria 19101
284 Ga0501047_0027301 3300049581 Bacteria 5499
285 Ga0501070_0022044 3300049586 Bacteria 5336
286 Ga0501073_0016370 3300049589 Bacteria 5374
287 Ga0501035_0020345 3300049822 Bacteria 6093
288 Ga0501035_0082116 3300049822 Unclassified 2844
289 Ga0501044_0011831 3300049823 Bacteria 9455
290 nmdc:mga09592_153059_c1 3300050508 Unclassified 1990
291 nmdc:mga0qj67_25030_c1 3300050509 Unclassified 4607
292 nmdc:mga06r32_97333_c1 3300050510 Unclassified 2883
293 nmdc:mga0n895_21631_c1 3300050512 Bacteria 6019
294 nmdc:mga0n895_347204_c1 3300050512 Bacteria 1503
295 nmdc:mga0rr50_193957_c1 3300050513 Bacteria 1666
296 nmdc:mga0rr50_24216_c1 3300050513 Bacteria 4201
297 nmdc:mga0rr50_384394_c1 3300050513 Bacteria 1184
298 nmdc:mga0rr50_54003_c1 3300050513 Bacteria 2991
299 nmdc:mga08x19_1227_c1 3300050514 Bacteria 15925
300 nmdc:mga08x19_2017_c1 3300050514 Bacteria 12439
301 nmdc:mga08x19_21991_c1 3300050514 Bacteria 3945
302 nmdc:mga08x19_4934_c1 3300050514 Bacteria 7878
303 nmdc:mga0a205_19135_c2 3300050515 Bacteria 2627
304 Ga0495601_0107842 3300053077 Bacteria 1802
305 Ga0500595_000043 3300053119 Bacteria 93122
306 Ga0075436_100001095
307 Ga0070658_10000039
308 Ga0070658_10032829
309 Ga0070658_10158105
310 Ga0070676_10007821
311 Ga0070683_100000002
312 Ga0068869_100000936
313 Ga0068869_100098209
314 Ga0070666_10126066
315 Ga0070660_100086871
316 Ga0070661_100139495
317 Ga0070668_100053632
318 Ga0070673_100197445
319 Ga0070659_100001862
320 Ga0070667_100024006
321 Ga0070709_10011710
322 Ga0070709_10015574
323 Ga0070714_100055865
324 Ga0070714_100066473
325 Ga0070714_100121248
326 Ga0070713_100033467
327 Ga0070713_100039386
328 Ga0070713_100068391
329 Ga0070713_100073402
330 Ga0070710_10021269
331 Ga0070663_100010653
332 Ga0070663_100154302
333 Ga0070663_100349969
334 Ga0070681_10261556
335 Ga0068867_100056895
336 Ga0068867_100108387
337 Ga0070685_10190667
338 Ga0070707_100470448
339 Ga0070679_100094812
340 Ga0070679_100187907
341 Ga0070684_100000007
342 Ga0068853_100001728
343 Ga0068853_100004326
344 Ga0068853_100050767
345 Ga0070693_100068131
346 Ga0070665_100071425
347 Ga0070665_100079866
348 Ga0070665_100525024
349 Ga0068855_100042363
350 Ga0068855_100052136
351 Ga0068855_100064806
352 Ga0068855_100067041
353 Ga0068855_100224586
354 Ga0068855_100434549
355 Ga0068854_100462779
356 Ga0068856_100331917
357 Ga0068856_100403065
358 Ga0068852_100032810
359 Ga0068852_100568647
360 Ga0068859_100364107
361 Ga0068851_10010273
362 Ga0068863_100014343
363 Ga0068863_100042069
364 Ga0068858_100004071
365 Ga0068860_100036366
366 Ga0068860_100109057
367 Ga0081540_1002998
368 Ga0070717_10003800
369 Ga0070717_10319734
370 Ga0070716_100001116
371 Ga0070716_100052172
372 Ga0070716_100241366
373 Ga0070712_100002921
374 Ga0070712_100033923
375 Ga0070712_100318432
376 Ga0097621_100006950
377 Ga0068871_100063433
378 Ga0068871_100115085
379 Ga0068871_100290134
380 Ga0075430_100032476
381 Ga0075434_100013513
382 Ga0075434_100206935
383 Ga0068865_100020906
384 Ga0075436_100000421
385 Ga0075436_100000619
386 Ga0075436_100220024
387 Ga0097620_100364073
388 Ga0075435_100000835
389 Ga0075435_100093709
390 Ga0075435_100204584
391 Ga0105240_10051057
392 Ga0105240_10284442
393 Ga0105240_10703971
394 Ga0105245_10007085
395 Ga0105245_10014746
396 Ga0105245_10051170
397 Ga0105243_10026075
398 Ga0105241_10002506
399 Ga0105242_10051801
400 Ga0105248_10051163
401 Ga0105248_10074388
402 Ga0105248_10189776
403 Ga0105238_10043404
404 Ga0105238_10358136
405 Ga0105249_10024588
406 Ga0105239_10075825
407 Ga0105239_10372757
408 Ga0105246_10024213
409 Ga0105246_10359925
410 Ga0157373_10001258
411 Ga0157370_10019751
412 Ga0157370_10058224
413 Ga0157370_10123544
414 Ga0157370_10175237
415 Ga0157370_10539110
416 Ga0157369_10011409
417 Ga0157369_10052660
418 Ga0157369_10087485
419 Ga0157369_10128742
420 Ga0157369_10158924
421 Ga0157369_10187783
422 Ga0157369_10229761
423 Ga0157374_10085229
424 Ga0157378_10091178
425 Ga0163162_10001630
426 Ga0157372_10007560
427 Ga0157372_10010401
428 Ga0157372_10013954
429 Ga0157372_10015017
430 Ga0157372_10032539
431 Ga0157372_10141606
432 Ga0157372_10144884
433 Ga0157372_10677504
434 Ga0163163_10425343
435 Ga0157376_10015808
436 Ga0157376_10022975
437 Ga0213875_10112926
438 Ga0207697_10008083
439 Ga0207656_10011843
440 Ga0207692_10014869
441 Ga0207680_10036981
442 Ga0207647_10002172
443 Ga0207699_10010931
444 Ga0207699_10020139
445 Ga0207699_10054499
446 Ga0207699_10342578
447 Ga0207645_10014030
448 Ga0207705_10000063
449 Ga0207705_10013842
450 Ga0207705_10013955
451 Ga0207654_10003233
452 Ga0207695_10011971
453 Ga0207695_10190227
454 Ga0207671_10152126
455 Ga0207693_10002534
456 Ga0207693_10015724
457 Ga0207693_10027808
458 Ga0207693_10064757
459 Ga0207693_10328152
460 Ga0207663_10010291
461 Ga0207663_10129766
462 Ga0207657_10069428
463 Ga0207649_10014203
464 Ga0207649_10264601
465 Ga0207652_10134470
466 Ga0207652_10171736
467 Ga0207646_10042306
468 Ga0207694_10158775
469 Ga0207700_10101148
470 Ga0207700_10167134
471 Ga0207664_10029209
472 Ga0207664_10080039
473 Ga0207664_10101410
474 Ga0207706_10002815
475 Ga0207709_10014614
476 Ga0207665_10002642
477 Ga0207665_10086594
478 Ga0207665_10251992
479 Ga0207691_10009757
480 Ga0207711_10030880
481 Ga0207711_10366458
482 Ga0207689_10000068
483 Ga0207689_10039132
484 Ga0207661_10000003
485 Ga0207661_10073750
486 Ga0207667_10011625
487 Ga0207667_10023622
488 Ga0207667_10035388
489 Ga0207667_10042059
490 Ga0207651_10254235
491 Ga0207712_10014164
492 Ga0207712_10057132
493 Ga0207640_10000323
494 Ga0207677_10170436
495 Ga0207703_10015285
496 Ga0207639_10000266
497 Ga0207639_10196741
498 Ga0207678_10018712
499 Ga0207678_10116506
500 Ga0207641_10008840
501 Ga0207648_10019786
502 Ga0207683_10003661
503 Ga0207698_10212523
504 Ga0268266_10026568
505 Ga0268266_10391672
506 Ga0268264_10012417
507 Ga0268264_10041059
508 Ga0265770_1001370
509 Ga0265760_10000389
510 Ga0265760_10003408
511 Ga0265760_10034333
512 Ga0373936_0136694
513 Ga0373943_0111709
514 Ga0373935_0137116
515 Ga0373927_0102885
516 Ga0373947_0003115
517 Ga0373937_0096639
518 Ga0373925_0004835
519 Ga0373925_0028746
520 Ga0373925_0084361
521 Ga0395899_0360839
522 Ga0395898_0026891
523 Ga0395898_0404185
524 Ga0395905_0015086
525 Ga0395905_0257575
526 Ga0395905_0332149
527 Ga0436364_0647884
528 Ga0395901_0155608
529 Ga0436365_1597601
530 Ga0436361_0004935
531 Ga0436363_0108277
532 Ga0436363_1261943
533 Ga0436362_0328808
534 Ga0453683_0116020
535 Ga0453684_0000951
536 Ga0466959_0077018
537 Ga0466959_0187884
538 Ga0451576_0037693
539 Ga0451576_0366795
540 Ga0466967_0080724
541 Ga0495603_0099534
542 Ga0495629_0012188
543 Ga0495650_0000029
544 Ga0495650_0001429
545 Ga0495580_0001070
546 Ga0495580_0001650
547 Ga0495580_0005830
548 Ga0495580_0009960
549 Ga0495580_0035680
550 Ga0495580_0107079
551 Ga0495580_0244409
552 Ga0495580_0246002
553 Ga0495582_0001112
554 Ga0495664_0014772
555 Ga0495594_0000339
556 Ga0495630_0108941
557 Ga0495644_0000028
558 Ga0495642_0007211
559 Ga0495652_0079147
560 Ga0495665_0000475
561 Ga0495587_0046183
562 Ga0495645_0055759
563 Ga0495633_0015590
564 Ga0495668_0016705
565 Ga0495625_0001870
566 Ga0495625_0042713
567 Ga0495625_0204634
568 Ga0495599_0114771
569 Ga0495670_0009557
570 Ga0495649_0122293
571 Ga0495604_0015843
572 Ga0495674_0113057
573 Ga0495672_0004280
574 Ga0495677_0021675
575 Ga0496105_0096103
576 Ga0496112_0005732
577 Ga0496112_0156958
578 Ga0496112_0302088
579 Ga0496126_0001289
580 Ga0496126_0078188
581 Ga0501031_0179253
582 Ga0501032_0018410
583 Ga0501033_0010593
584 Ga0501036_0012864
585 Ga0501038_0002558
586 Ga0501043_0001064
587 Ga0501046_0000520
588 Ga0501047_0002091
589 Ga0501047_0027301
590 Ga0501070_0022044
591 Ga0501073_0016370
592 Ga0501035_0020345
593 Ga0501035_0082116
594 Ga0501044_0011831
595 nmdc:mga09592_153059_c1
596 nmdc:mga0qj67_25030_c1
597 nmdc:mga06r32_97333_c1
598 nmdc:mga0n895_21631_c1
599 nmdc:mga0n895_347204_c1
600 nmdc:mga0rr50_193957_c1
601 nmdc:mga0rr50_24216_c1
602 nmdc:mga0rr50_384394_c1
603 nmdc:mga0rr50_54003_c1
604 nmdc:mga08x19_1227_c1
605 nmdc:mga08x19_2017_c1
606 nmdc:mga08x19_21991_c1
607 nmdc:mga08x19_4934_c1
608 nmdc:mga0a205_19135_c2
609 Ga0495601_0107842
610 Ga0500595_000043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

194

314

0.98

PF03668

RapZ-like_N

RapZ-like N-terminal domain

33

188

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9789 180 298
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9401 180 298
7e9v-assembly1.cif.gz_A the crystal structure of human ump-cmp kinase from biortus. 0.7029 20 175
3vaa-assembly2.cif.gz_B 1.7 angstrom resolution crystal structure of shikimate kinase from bacteroides thetaiotaomicron 0.6579 22 173
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.6526 20 171
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 187 298 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8964 187 298 3.40.50.720
af_P9WLN3_322_498_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6695 21 172 3.40.50.300
af_A0A1D8PFW6_2_177_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6544 23 164 3.40.50.300
af_Q10242_7_192_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6513 20 168 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V8RJM9-F1-model_v4 RapZ C-terminal domain-containing protein 0.9958 186 299 GO:0005524
AF-A0A2V8R537-F1-model_v4 RNase adaptor protein RapZ 0.9873 178 298 GO:0005524
AF-A0A645DGX9-F1-model_v4 RNase adapter protein RapZ 0.9861 180 299 GO:0005524
AF-A0A662DSW2-F1-model_v4 RNase adaptor protein RapZ 0.9856 180 301 GO:0005524
AF-A0A355FQ69-F1-model_v4 RNase adaptor protein RapZ 0.985 177 300 GO:0005524

Map