F398006

General Info

Members Datasets Scaffolds Average Seq Length
305 176 296 402

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100022279|Ga0070699_1000222793
Length 441
Sequence MKRTMAVILAGGEGERLSILSGVRAKPAVPFGGKYRIIDFTLSNCVNSDIDNVVVLTQYNPRSLNDHIGLGRPWDLDRNRGGVKLLQPYIARGRVAEWYRGTADAVLQNINVIEHESGDTILVLAGDHIYKMDYQPFIAAHRRHRADVTIAVRHVPLSDATRMGVLALDDADRVIEWQEKPKQPKSDLASMGVYVFSKKALRRWLGEDRIDFGRNVIPAMLDAGARVFGYRFEGYWQDVGTIQSYWEANLALLQDNAELDLYDKDWVIHTRSEERAPAKIGPTAQVHRSLISHGCMINGTVVNSILSPGVRVDVGAVIRDSIDGPDFDTPNRQEPSRLNTGITVVGKRAIIPRGARIGRNVKVAGGVRTSDFATRVVKNGASVEPGGARPKRSRRKAAGEDEAGELRAQASGNGRSEPTAVAVGSAGPGLRAGSASRVRGH

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
3 2738543010 Bacillus sp. YR335 Isolate Unclassified
4 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
5 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
6 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
7 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
99 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
100 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0.33
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 7.54
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10109980 3300005289 Bacteria 1991
2 Ga0070680_100000002 3300005336 Bacteria 211003
3 Ga0070682_100030627 3300005337 Bacteria 3250
4 Ga0068868_100086360 3300005338 Bacteria 2522
5 Ga0070687_100008968 3300005343 Bacteria 4261
6 Ga0070675_100011583 3300005354 Bacteria 6907
7 Ga0070674_100009230 3300005356 Bacteria 5903
8 Ga0070673_100050253 3300005364 Bacteria 3260
9 Ga0070705_100042909 3300005440 Bacteria 2589
10 Ga0070700_100047412 3300005441 Bacteria 2658
11 Ga0070700_100055051 3300005441 Bacteria 2489
12 Ga0070694_100014010 3300005444 Bacteria 5014
13 Ga0070708_100005137 3300005445 Bacteria 10363
14 Ga0070708_100014156 3300005445 Bacteria 6555
15 Ga0070708_100014695 3300005445 Bacteria 6451
16 Ga0070708_100024980 3300005445 Bacteria 5106
17 Ga0070708_100037003 3300005445 Bacteria 4256
18 Ga0070678_100025072 3300005456 Bacteria 4005
19 Ga0070678_100036119 3300005456 Bacteria 3456
20 Ga0070662_100009543 3300005457 Bacteria 6351
21 Ga0070681_10124138 3300005458 Bacteria 2515
22 Ga0070706_100000121 3300005467 Bacteria 95356
23 Ga0070706_100010472 3300005467 Bacteria 8608
24 Ga0070706_100027597 3300005467 Bacteria 5224
25 Ga0070706_100075295 3300005467 Bacteria 3123
26 Ga0070707_100005259 3300005468 Bacteria 12115
27 Ga0070707_100008051 3300005468 Bacteria 9786
28 Ga0070707_100008631 3300005468 Bacteria 9458
29 Ga0070707_100181202 3300005468 Bacteria 2054
30 Ga0070707_100216265 3300005468 Bacteria 1867
31 Ga0070698_100010395 3300005471 Bacteria 9939
32 Ga0070698_100171045 3300005471 Bacteria 2114
33 Ga0070698_100192031 3300005471 Bacteria 1979
34 Ga0070699_100004927 3300005518 Bacteria 11776
35 Ga0070699_100022279 3300005518 Bacteria 5459
36 Ga0070699_100038003 3300005518 Bacteria 4168
37 Ga0070684_100096046 3300005535 Bacteria 2641
38 Ga0070697_100001262 3300005536 Bacteria 19122
39 Ga0070697_100018299 3300005536 Bacteria 5523
40 Ga0070697_100053659 3300005536 Bacteria 3277
41 Ga0070686_100021087 3300005544 Bacteria 3866
42 Ga0070695_100134309 3300005545 Bacteria 1708
43 Ga0070696_100194014 3300005546 Bacteria 1513
44 Ga0070704_100014597 3300005549 Bacteria 4909
45 Ga0070704_100073720 3300005549 Bacteria 2487
46 Ga0068862_100019395 3300005844 Bacteria 5675
47 Ga0081539_10043409 3300005985 Bacteria 2607
48 Ga0075428_100013192 3300006844 Bacteria 9193
49 Ga0075433_10005328 3300006852 Bacteria 10091
50 Ga0075433_10017405 3300006852 Bacteria 5952
51 Ga0075433_10094025 3300006852 Bacteria 2652
52 Ga0111539_10028834 3300009094 Bacteria 6769
53 Ga0111539_10117394 3300009094 Bacteria 3119
54 Ga0111539_10292092 3300009094 Bacteria 1897
55 Ga0105245_10006795 3300009098 Bacteria 10033
56 Ga0114129_10048553 3300009147 Bacteria 5964
57 Ga0114129_10123133 3300009147 Bacteria 3567
58 Ga0114129_10196646 3300009147 Bacteria 2734
59 Ga0105243_10003085 3300009148 Bacteria 13720
60 Ga0105242_10284816 3300009176 Bacteria 1502
61 Ga0105248_10139424 3300009177 Bacteria 2735
62 Ga0157374_10209357 3300013296 Bacteria 1912
63 Ga0157375_10200491 3300013308 Bacteria 2151
64 Ga0163163_10071353 3300014325 Bacteria 3461
65 Ga0163161_10015840 3300017792 Bacteria 5258
66 Ga0224712_10042857 3300022467 Unclassified 1717
67 Ga0209566_100284 3300025225 Bacteria 46586
68 Ga0207645_10062576 3300025907 Bacteria 2377
69 Ga0207643_10024249 3300025908 Bacteria 3347
70 Ga0207684_10001255 3300025910 Bacteria 28058
71 Ga0207684_10017808 3300025910 Bacteria 6092
72 Ga0207684_10025373 3300025910 Bacteria 5050
73 Ga0207684_10046752 3300025910 Bacteria 3672
74 Ga0207660_10000002 3300025917 Bacteria 883566
75 Ga0207662_10002599 3300025918 Bacteria 9103
76 Ga0207662_10008416 3300025918 Bacteria 5647
77 Ga0207646_10001339 3300025922 Bacteria 30598
78 Ga0207646_10007178 3300025922 Bacteria 11381
79 Ga0207646_10007495 3300025922 Bacteria 11076
80 Ga0207690_10020973 3300025932 Bacteria 4046
81 Ga0207706_10094494 3300025933 Bacteria 2630
82 Ga0207704_10063314 3300025938 Bacteria 2305
83 Ga0207711_10071109 3300025941 Bacteria 3018
84 Ga0207651_10051162 3300025960 Bacteria 2809
85 Ga0207640_10171464 3300025981 Bacteria 1617
86 Ga0207678_10003978 3300026067 Bacteria 13300
87 Ga0207708_10002016 3300026075 Bacteria 14966
88 Ga0207708_10087667 3300026075 Bacteria 2397
89 Ga0207641_10110515 3300026088 Bacteria 2436
90 Ga0207648_10002191 3300026089 Bacteria 21204
91 Ga0207683_10003421 3300026121 Bacteria 13825
92 Ga0209998_10010872 3300027717 Bacteria 1884
93 Ga0209998_10017435 3300027717 Bacteria 1517
94 Ga0209974_10007653 3300027876 Bacteria 3716
95 Ga0268265_10106482 3300028380 Bacteria 2278
96 Ga0265326_10007805 3300028558 Bacteria 3261
97 Ga0265326_10009498 3300028558 Bacteria 2908
98 Ga0265326_10027751 3300028558 Bacteria 1614
99 Ga0265319_1000327 3300028563 Bacteria 35008
100 Ga0265319_1014839 3300028563 Bacteria 3040
101 Ga0265334_10001801 3300028573 Bacteria 10212
102 Ga0265334_10011617 3300028573 Bacteria 3704
103 Ga0265334_10035933 3300028573 Bacteria 1958
104 Ga0265323_10007271 3300028653 Bacteria 4613
105 Ga0265322_10002545 3300028654 Bacteria 5611
106 Ga0265336_10010730 3300028666 Bacteria 3132
107 Ga0265338_10004010 3300028800 Bacteria 20210
108 Ga0265324_10001793 3300029957 Bacteria 11720
109 Ga0265330_10046170 3300031235 Bacteria 1920
110 Ga0265328_10017032 3300031239 Bacteria 2820
111 Ga0265320_10000236 3300031240 Bacteria 45341
112 Ga0265320_10017022 3300031240 Bacteria 4050
113 Ga0265320_10060119 3300031240 Bacteria 1815
114 Ga0265325_10017170 3300031241 Bacteria 4026
115 Ga0265329_10001697 3300031242 Bacteria 10553
116 Ga0265329_10009429 3300031242 Bacteria 3645
117 Ga0265340_10000588 3300031247 Bacteria 20197
118 Ga0265339_10004447 3300031249 Bacteria 9565
119 Ga0265331_10011072 3300031250 Bacteria 4948
120 Ga0265331_10068000 3300031250 Bacteria 1670
121 Ga0265316_10003848 3300031344 Bacteria 15056
122 Ga0265316_10149928 3300031344 Bacteria 1747
123 Ga0265316_10171203 3300031344 Bacteria 1620
124 Ga0265313_10023306 3300031595 Bacteria 3337
125 Ga0265314_10001391 3300031711 Bacteria 27126
126 Ga0265314_10042439 3300031711 Bacteria 3244
127 Ga0265342_10025881 3300031712 Bacteria 3683
128 Ga0265342_10035537 3300031712 Bacteria 3050
129 Ga0265342_10041367 3300031712 Bacteria 2791
130 Ga0265342_10067105 3300031712 Bacteria 2100
131 Ga0316576_10003599 3300031727 Bacteria 9131
132 Ga0316576_10013688 3300031727 Bacteria 5401
133 Ga0316576_10018899 3300031727 Bacteria 4714
134 Ga0316576_10020937 3300031727 Bacteria 4513
135 Ga0316576_10219303 3300031727 Bacteria 1431
136 Ga0316577_10008262 3300031733 Bacteria 5576
137 Ga0316577_10109472 3300031733 Bacteria 1550
138 Ga0307413_10098678 3300031824 Bacteria 1924
139 Ga0307416_100010337 3300032002 Bacteria 6159
140 Ga0373943_0040459 3300035170 Bacteria 2251
141 Ga0373962_0013542 3300035242 Bacteria 2068
142 Ga0316574_0037414 3300035398 Bacteria 2976
143 Ga0316574_0065584 3300035398 Bacteria 2286
144 Ga0316582_0027890 3300036647 Bacteria 3416
145 Ga0395901_0049459 3300038443 Bacteria 4368
146 Ga0400490_60595 3300038726 Bacteria 3659
147 Ga0400488_37728 3300038741 Bacteria 3270
148 Ga0400489_09939 3300039093 Bacteria 12256
149 Ga0436365_0151131 3300039437 Bacteria 4623
150 Ga0450920_002294 3300042122 Bacteria 3247
151 Ga0450910_001954 3300042147 Bacteria 2670
152 Ga0451577_0000033 3300042876 Bacteria 378714
153 Ga0451577_0008002 3300042876 Bacteria 10320
154 Ga0453683_0145677 3300044673 Bacteria 1495
155 Ga0453683_0209216 3300044673 Bacteria 1239
156 Ga0453684_0000109 3300044712 Bacteria 361015
157 Ga0453684_0004344 3300044712 Bacteria 30121
158 Ga0453684_0010244 3300044712 Bacteria 16058
159 Ga0453684_0017620 3300044712 Bacteria 11045
160 Ga0453684_0338729 3300044712 Bacteria 1699
161 Ga0453684_0354740 3300044712 Bacteria 1653
162 Ga0451576_0114985 3300045051 Bacteria 2801
163 Ga0451576_0234412 3300045051 Bacteria 1917
164 Ga0466967_0083244 3300045976 Bacteria 2893
165 Ga0466967_0165542 3300045976 Bacteria 2078
166 Ga0495592_0078166 3300046454 Bacteria 2397
167 Ga0495651_0096387 3300046462 Bacteria 2210
168 Ga0495653_0091658 3300046463 Bacteria 2221
169 Ga0495664_0017943 3300046477 Bacteria 4047
170 Ga0495628_0140693 3300046516 Bacteria 1842
171 Ga0495652_0057947 3300046529 Bacteria 3283
172 Ga0495667_0060257 3300046559 Bacteria 2490
173 Ga0495634_0046464 3300046642 Bacteria 2930
174 Ga0495660_0025660 3300046810 Bacteria 3345
175 Ga0495674_0063442 3300047319 Bacteria 3214
176 Ga0495674_0073026 3300047319 Bacteria 2958
177 Ga0495674_0155666 3300047319 Bacteria 1915
178 Ga0496101_0054339 3300048904 Bacteria 2891
179 Ga0496103_0105381 3300048906 Bacteria 1788
180 Ga0496104_0031707 3300048907 Bacteria 4916
181 Ga0496104_0038532 3300048907 Bacteria 4473
182 Ga0496104_0254069 3300048907 Bacteria 1670
183 Ga0496105_0037269 3300048908 Bacteria 4004
184 Ga0496108_0000093 3300048911 Bacteria 93493
185 Ga0496108_0005265 3300048911 Bacteria 10439
186 Ga0496108_0012621 3300048911 Bacteria 6884
187 Ga0496108_0044031 3300048911 Bacteria 3727
188 Ga0496109_0038129 3300048912 Bacteria 4343
189 Ga0496109_0056488 3300048912 Bacteria 3582
190 Ga0496109_0065598 3300048912 Bacteria 3323
191 Ga0496110_0042494 3300048913 Bacteria 3967
192 Ga0496110_0153859 3300048913 Bacteria 2083
193 Ga0496111_0023447 3300048914 Bacteria 4333
194 Ga0496111_0119149 3300048914 Bacteria 1949
195 Ga0496112_0000001 3300048915 Bacteria 1346031
196 Ga0496112_0017305 3300048915 Bacteria 6770
197 Ga0496113_0013399 3300048916 Bacteria 5553
198 Ga0496113_0156318 3300048916 Bacteria 1801
199 Ga0496114_0004880 3300048917 Bacteria 10445
200 Ga0496114_0101458 3300048917 Bacteria 2457
201 Ga0496116_0008474 3300048919 Bacteria 8913
202 Ga0496117_0000087 3300048920 Bacteria 211708
203 Ga0496117_0000409 3300048920 Bacteria 72196
204 Ga0496118_0086459 3300048921 Bacteria 2178
205 Ga0496119_0000054 3300048922 Bacteria 181312
206 Ga0496119_0018628 3300048922 Bacteria 5156
207 Ga0496120_0000037 3300048923 Bacteria 204517
208 Ga0496120_0000767 3300048923 Bacteria 46379
209 Ga0496120_0002088 3300048923 Bacteria 21421
210 Ga0496120_0011985 3300048923 Bacteria 5927
211 Ga0496122_0000128 3300048925 Bacteria 177688
212 Ga0496122_0000139 3300048925 Bacteria 169425
213 Ga0496123_0031892 3300048926 Bacteria 3825
214 Ga0496123_0059307 3300048926 Bacteria 2475
215 Ga0496124_0012592 3300048927 Bacteria 8326
216 Ga0496125_0000084 3300048928 Bacteria 223170
217 Ga0496125_0092449 3300048928 Bacteria 2262
218 Ga0496126_0000266 3300048929 Bacteria 111148
219 Ga0496126_0000516 3300048929 Bacteria 75076
220 Ga0496126_0001974 3300048929 Bacteria 29052
221 Ga0496126_0005186 3300048929 Bacteria 15060
222 Ga0496126_0188201 3300048929 Bacteria 1750
223 Ga0501031_0061246 3300049568 Bacteria 2452
224 Ga0501032_0075476 3300049569 Bacteria 2245
225 Ga0501036_0023568 3300049572 Bacteria 5186
226 Ga0501036_0218485 3300049572 Bacteria 1600
227 Ga0501038_0038313 3300049574 Bacteria 4199
228 Ga0501038_0069077 3300049574 Bacteria 3002
229 Ga0501038_0103843 3300049574 Bacteria 2363
230 Ga0501038_0169034 3300049574 Bacteria 1771
231 Ga0501039_0073026 3300049575 Bacteria 2666
232 Ga0501040_0036197 3300049576 Bacteria 3348
233 Ga0501040_0072396 3300049576 Bacteria 2380
234 Ga0501041_0045744 3300049577 Bacteria 2661
235 Ga0501042_0021038 3300049578 Bacteria 4543
236 Ga0501042_0080761 3300049578 Bacteria 2330
237 Ga0501042_0082086 3300049578 Bacteria 2311
238 Ga0501042_0117852 3300049578 Bacteria 1911
239 Ga0501043_0023022 3300049579 Bacteria 4886
240 Ga0501043_0045293 3300049579 Bacteria 3460
241 Ga0501046_0016744 3300049580 Bacteria 6130
242 Ga0501046_0068545 3300049580 Bacteria 2761
243 Ga0501046_0144465 3300049580 Bacteria 1798
244 Ga0501046_0161673 3300049580 Bacteria 1684
245 Ga0501048_0038275 3300049582 Bacteria 3442
246 Ga0501048_0057414 3300049582 Bacteria 2761
247 Ga0501048_0109805 3300049582 Bacteria 1947
248 Ga0501067_0024896 3300049583 Bacteria 3319
249 Ga0501068_0052436 3300049584 Bacteria 2468
250 Ga0501070_0187062 3300049586 Bacteria 1703
251 Ga0501072_0014728 3300049588 Bacteria 5997
252 Ga0501072_0024124 3300049588 Bacteria 4729
253 Ga0501072_0081926 3300049588 Bacteria 2558
254 Ga0501074_0032122 3300049590 Bacteria 3804
255 Ga0501074_0033139 3300049590 Bacteria 3744
256 Ga0501075_0010440 3300049591 Bacteria 6526
257 Ga0501075_0032989 3300049591 Bacteria 3851
258 Ga0501075_0037563 3300049591 Bacteria 3618
259 Ga0501075_0081430 3300049591 Bacteria 2451
260 Ga0501076_0153199 3300049592 Bacteria 1875
261 Ga0501076_0237215 3300049592 Bacteria 1491
262 Ga0501077_0016560 3300049593 Bacteria 4644
263 Ga0501077_0061037 3300049593 Bacteria 2392
264 Ga0501079_0022447 3300049741 Bacteria 4839
265 Ga0501079_0097655 3300049741 Bacteria 2277
266 Ga0501080_0126568 3300049742 Bacteria 2366
267 Ga0501081_0009555 3300049743 Bacteria 6324
268 Ga0501083_0040342 3300049744 Bacteria 3169
269 Ga0501035_0126651 3300049822 Bacteria 2229
270 Ga0501045_0068434 3300049824 Bacteria 2608
271 Ga0501045_0098165 3300049824 Bacteria 2167
272 nmdc:mga05p37_101183_c1 3300050507 Bacteria 3549
273 nmdc:mga05p37_237_c1 3300050507 Bacteria 56213
274 nmdc:mga05p37_243716_c1 3300050507 Bacteria 2159
275 nmdc:mga08y16_251377_c1 3300050511 Bacteria 1827
276 nmdc:mga0rr50_55089_c1 3300050513 Bacteria 2965
277 nmdc:mga0a205_15329_c2 3300050515 Bacteria 5165
278 nmdc:mga0a205_199369_c1 3300050515 Bacteria 1892
279 Ga0495601_0008872 3300053077 Bacteria 5934
280 Ga0495601_0038791 3300053077 Bacteria 2979
281 Ga0495601_0042904 3300053077 Bacteria 2840
282 Ga0495612_0000250 3300053078 Bacteria 22270
283 Ga0495619_0028038 3300053085 Bacteria 3630
284 Ga0501084_0041781 3300054114 Bacteria 3836
285 Ga0501084_0046556 3300054114 Bacteria 3633
286 Ga0501084_0144364 3300054114 Bacteria 2005
287 Ga0501084_0170048 3300054114 Bacteria 1840
288 Ga0590075_005779 3300059424 Bacteria 2926
289 Ga0501082_0020532 3300060353 Bacteria 5693
290 Ga0501082_0034708 3300060353 Bacteria 4348
291 Ga0501082_0072961 3300060353 Bacteria 2956
292 Ga0501082_0205822 3300060353 Bacteria 1712
293 Ga0530510_0000420 3300061734 Bacteria 27420
294 Ga0530510_0005943 3300061734 Bacteria 8463
295 Ga0530510_0025900 3300061734 Bacteria 4195
296 Ga0530510_0120135 3300061734 Bacteria 1929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0096387 Ga0495651_0096387_98_1318 306
2 3300026088 Ga0207641_10110515 Ga0207641_101105152 326
3 3300025225 Ga0209566_100284 Ga0209566_1002847 328
4 3300031344 Ga0265316_10149928 Ga0265316_101499282 329
5 3300031712 Ga0265342_10041367 Ga0265342_100413672 329
6 3300044712 Ga0453684_0354740 Ga0453684_0354740_159_1289 332
7 3300048920 Ga0496117_0000087 Ga0496117_0000087_153793_154935 335
8 3300038443 Ga0395901_0049459 Ga0395901_0049459_2377_3702 337
9 3300044673 Ga0453683_0209216 Ga0453683_0209216_68_1198 337
10 3300049574 Ga0501038_0038313 Ga0501038_0038313_547_1857 338
11 3300049576 Ga0501040_0036197 Ga0501040_0036197_1586_2896 338
12 3300049582 Ga0501048_0038275 Ga0501048_0038275_1490_2800 338
13 3300049592 Ga0501076_0237215 Ga0501076_0237215_94_1404 338
14 3300049593 Ga0501077_0016560 Ga0501077_0016560_278_1588 338
15 3300049824 Ga0501045_0098165 Ga0501045_0098165_365_1675 338
16 3300028573 Ga0265334_10035933 Ga0265334_100359331 339
17 3300028653 Ga0265323_10007271 Ga0265323_100072712 339
18 3300028654 Ga0265322_10002545 Ga0265322_100025452 339
19 3300031240 Ga0265320_10060119 Ga0265320_100601192 339
20 3300031344 Ga0265316_10003848 Ga0265316_100038486 339
21 3300031344 Ga0265316_10171203 Ga0265316_101712031 339
22 3300049578 Ga0501042_0082086 Ga0501042_0082086_214_1524 339
23 3300049580 Ga0501046_0068545 Ga0501046_0068545_1198_2508 339
24 3300005985 Ga0081539_10043409 Ga0081539_100434092 340
25 3300044673 Ga0453683_0145677 Ga0453683_0145677_130_1437 342
26 3300045051 Ga0451576_0114985 Ga0451576_0114985_225_1532 342
27 3300045976 Ga0466967_0165542 Ga0466967_0165542_311_1615 343
28 3300005445 Ga0070708_100037003 Ga0070708_1000370032 344
29 3300005546 Ga0070696_100194014 Ga0070696_1001940141 344
30 3300028558 Ga0265326_10009498 Ga0265326_100094982 344
31 3300031235 Ga0265330_10046170 Ga0265330_100461701 344
32 3300031242 Ga0265329_10009429 Ga0265329_100094291 344
33 3300031712 Ga0265342_10067105 Ga0265342_100671051 344
34 3300048929 Ga0496126_0005186 Ga0496126_0005186_8184_9401 345
35 3300031727 Ga0316576_10018899 Ga0316576_100188991 346
36 3300031733 Ga0316577_10008262 Ga0316577_100082621 346
37 3300061734 Ga0530510_0120135 Ga0530510_0120135_237_1562 347
38 3300048920 Ga0496117_0000409 Ga0496117_0000409_38173_39447 348
39 3300048921 Ga0496118_0086459 Ga0496118_0086459_136_1410 348
40 3300048922 Ga0496119_0000054 Ga0496119_0000054_129199_130473 348
41 3300048922 Ga0496119_0018628 Ga0496119_0018628_1064_2338 348
42 3300048923 Ga0496120_0000037 Ga0496120_0000037_152472_153746 348
43 3300048923 Ga0496120_0000767 Ga0496120_0000767_817_2091 348
44 3300048923 Ga0496120_0011985 Ga0496120_0011985_817_2091 348
45 3300048927 Ga0496124_0012592 Ga0496124_0012592_5393_6667 348
46 3300048928 Ga0496125_0000084 Ga0496125_0000084_58775_60049 348
47 3300048929 Ga0496126_0000266 Ga0496126_0000266_50589_51863 348
48 3300049578 Ga0501042_0080761 Ga0501042_0080761_571_1887 348
49 3300049580 Ga0501046_0144465 Ga0501046_0144465_19_1335 348
50 3300049588 Ga0501072_0081926 Ga0501072_0081926_648_1964 348
51 3300049591 Ga0501075_0081430 Ga0501075_0081430_868_2184 348
52 3300049593 Ga0501077_0061037 Ga0501077_0061037_1006_2322 348
53 3300042876 Ga0451577_0000033 Ga0451577_0000033_301149_302429 349
54 3300044712 Ga0453684_0000109 Ga0453684_0000109_59657_60937 349
55 3300048919 Ga0496116_0008474 Ga0496116_0008474_568_1842 349
56 3300049583 Ga0501067_0024896 Ga0501067_0024896_211_1521 349
57 3300005440 Ga0070705_100042909 Ga0070705_1000429093 350
58 3300005445 Ga0070708_100014156 Ga0070708_1000141562 350
59 3300005468 Ga0070707_100216265 Ga0070707_1002162652 350
60 3300025910 Ga0207684_10025373 Ga0207684_100253733 350
61 3300025922 Ga0207646_10007495 Ga0207646_1000749510 350
62 3300025981 Ga0207640_10171464 Ga0207640_101714642 350
63 3300042147 Ga0450910_001954 Ga0450910_001954_1045_2343 351
64 3300005467 Ga0070706_100075295 Ga0070706_1000752953 352
65 3300031727 Ga0316576_10020937 Ga0316576_100209374 352
66 3300005444 Ga0070694_100014010 Ga0070694_1000140104 353
67 3300005844 Ga0068862_100019395 Ga0068862_1000193952 353
68 3300009147 Ga0114129_10123133 Ga0114129_101231332 353
69 3300027717 Ga0209998_10010872 Ga0209998_100108721 353
70 3300027876 Ga0209974_10007653 Ga0209974_100076533 353
71 3300028380 Ga0268265_10106482 Ga0268265_101064822 353
72 3300032002 Ga0307416_100010337 Ga0307416_1000103372 353
73 3300035170 Ga0373943_0040459 Ga0373943_0040459_579_1940 353
74 3300048911 Ga0496108_0000093 Ga0496108_0000093_34791_36029 353
75 3300050507 nmdc:mga05p37_101183_c1 nmdc:mga05p37_101183_c1_1533_2864 353
76 3300005445 Ga0070708_100014695 Ga0070708_1000146952 354
77 3300005467 Ga0070706_100010472 Ga0070706_1000104724 354
78 3300005471 Ga0070698_100192031 Ga0070698_1001920312 354
79 3300048929 Ga0496126_0188201 Ga0496126_0188201_262_1536 354
80 3300031727 Ga0316576_10013688 Ga0316576_100136883 355
81 3300035398 Ga0316574_0037414 Ga0316574_0037414_1157_2503 355
82 3300042122 Ga0450920_002294 Ga0450920_002294_432_1793 355
83 3300048912 Ga0496109_0056488 Ga0496109_0056488_1344_2654 355
84 3300050513 nmdc:mga0rr50_55089_c1 nmdc:mga0rr50_55089_c1_853_2193 355
85 3300061734 Ga0530510_0000420 Ga0530510_0000420_9720_11060 355
86 iso_pu_bacteria 2711768088 2712196747 355
87 3300009094 Ga0111539_10292092 Ga0111539_102920921 356
88 3300013308 Ga0157375_10200491 Ga0157375_102004911 356
89 3300028558 Ga0265326_10027751 Ga0265326_100277511 356
90 3300028563 Ga0265319_1000327 Ga0265319_100032711 356
91 3300028573 Ga0265334_10001801 Ga0265334_100018016 356
92 3300028666 Ga0265336_10010730 Ga0265336_100107302 356
93 3300028800 Ga0265338_10004010 Ga0265338_100040106 356
94 3300029957 Ga0265324_10001793 Ga0265324_100017935 356
95 3300031239 Ga0265328_10017032 Ga0265328_100170322 356
96 3300031240 Ga0265320_10000236 Ga0265320_1000023620 356
97 3300031242 Ga0265329_10001697 Ga0265329_100016976 356
98 3300031247 Ga0265340_10000588 Ga0265340_100005886 356
99 3300031249 Ga0265339_10004447 Ga0265339_100044473 356
100 3300031250 Ga0265331_10011072 Ga0265331_100110724 356
101 3300031595 Ga0265313_10023306 Ga0265313_100233063 356
102 3300031711 Ga0265314_10001391 Ga0265314_1000139120 356
103 3300031712 Ga0265342_10035537 Ga0265342_100355371 356
104 3300044712 Ga0453684_0010244 Ga0453684_0010244_4315_5562 356
105 3300044712 Ga0453684_0010244 Ga0453684_0010244_5559_6842 356
106 3300046463 Ga0495653_0091658 Ga0495653_0091658_127_1497 356
107 3300046477 Ga0495664_0017943 Ga0495664_0017943_2099_3469 356
108 3300047319 Ga0495674_0073026 Ga0495674_0073026_12_1382 356
109 3300048907 Ga0496104_0254069 Ga0496104_0254069_44_1405 356
110 3300048914 Ga0496111_0119149 Ga0496111_0119149_548_1909 356
111 3300048915 Ga0496112_0000001 Ga0496112_0000001_96285_97577 356
112 3300048916 Ga0496113_0156318 Ga0496113_0156318_69_1430 356
113 3300048917 Ga0496114_0101458 Ga0496114_0101458_511_1872 356
114 3300049588 Ga0501072_0014728 Ga0501072_0014728_1435_2748 356
115 3300053077 Ga0495601_0008872 Ga0495601_0008872_3751_5121 356
116 3300053085 Ga0495619_0028038 Ga0495619_0028038_1611_2981 356
117 3300054114 Ga0501084_0144364 Ga0501084_0144364_594_1907 356
118 3300054114 Ga0501084_0170048 Ga0501084_0170048_161_1543 356
119 iso_pu_bacteria 8002317523 8002319950 356
120 3300005354 Ga0070675_100011583 Ga0070675_1000115832 357
121 3300005356 Ga0070674_100009230 Ga0070674_1000092301 357
122 3300005364 Ga0070673_100050253 Ga0070673_1000502532 357
123 3300005456 Ga0070678_100025072 Ga0070678_1000250723 357
124 3300005457 Ga0070662_100009543 Ga0070662_1000095432 357
125 3300009094 Ga0111539_10117394 Ga0111539_101173942 357
126 3300009098 Ga0105245_10006795 Ga0105245_100067959 357
127 3300009148 Ga0105243_10003085 Ga0105243_1000308513 357
128 3300009176 Ga0105242_10284816 Ga0105242_102848161 357
129 3300009177 Ga0105248_10139424 Ga0105248_101394241 357
130 3300025938 Ga0207704_10063314 Ga0207704_100633141 357
131 3300035242 Ga0373962_0013542 Ga0373962_0013542_235_1557 357
132 3300036647 Ga0316582_0027890 Ga0316582_0027890_1683_3011 357
133 3300048906 Ga0496103_0105381 Ga0496103_0105381_42_1364 357
134 3300048923 Ga0496120_0002088 Ga0496120_0002088_1991_3265 357
135 3300048925 Ga0496122_0000139 Ga0496122_0000139_54499_55773 357
136 3300048926 Ga0496123_0059307 Ga0496123_0059307_1025_2299 357
137 3300048929 Ga0496126_0000516 Ga0496126_0000516_54472_55746 357
138 3300050511 nmdc:mga08y16_251377_c1 nmdc:mga08y16_251377_c1_385_1707 357
139 3300050515 nmdc:mga0a205_199369_c1 nmdc:mga0a205_199369_c1_472_1794 357
140 3300006852 Ga0075433_10005328 Ga0075433_100053282 358
141 3300031727 Ga0316576_10219303 Ga0316576_102193031 358
142 3300031733 Ga0316577_10109472 Ga0316577_101094722 358
143 3300039093 Ga0400489_09939 Ga0400489_09939_6007_7242 358
144 3300048904 Ga0496101_0054339 Ga0496101_0054339_202_1572 358
145 3300048907 Ga0496104_0038532 Ga0496104_0038532_454_1824 358
146 3300048908 Ga0496105_0037269 Ga0496105_0037269_1497_2867 358
147 3300048911 Ga0496108_0012621 Ga0496108_0012621_1341_2711 358
148 3300048913 Ga0496110_0042494 Ga0496110_0042494_1308_2678 358
149 3300048917 Ga0496114_0004880 Ga0496114_0004880_1944_3314 358
150 3300050515 nmdc:mga0a205_15329_c2 nmdc:mga0a205_15329_c2_2893_4197 358
151 3300060353 Ga0501082_0072961 Ga0501082_0072961_1404_2741 358
152 3300009147 Ga0114129_10048553 Ga0114129_100485532 359
153 3300022467 Ga0224712_10042857 Ga0224712_100428571 359
154 3300039437 Ga0436365_0151131 Ga0436365_0151131_917_2224 359
155 3300044712 Ga0453684_0004344 Ga0453684_0004344_16498_17784 359
156 3300044712 Ga0453684_0017620 Ga0453684_0017620_1228_2511 359
157 3300048916 Ga0496113_0013399 Ga0496113_0013399_2500_3855 359
158 3300048925 Ga0496122_0000128 Ga0496122_0000128_94456_95730 359
159 3300048926 Ga0496123_0031892 Ga0496123_0031892_2528_3802 359
160 3300048928 Ga0496125_0092449 Ga0496125_0092449_32_1306 359
161 3300048929 Ga0496126_0001974 Ga0496126_0001974_24406_25680 359
162 3300049568 Ga0501031_0061246 Ga0501031_0061246_566_1936 359
163 3300049572 Ga0501036_0023568 Ga0501036_0023568_16_1335 359
164 3300049574 Ga0501038_0069077 Ga0501038_0069077_1561_2880 359
165 3300049574 Ga0501038_0103843 Ga0501038_0103843_526_1872 359
166 3300049575 Ga0501039_0073026 Ga0501039_0073026_329_1648 359
167 3300049578 Ga0501042_0021038 Ga0501042_0021038_1634_2953 359
168 3300049578 Ga0501042_0117852 Ga0501042_0117852_65_1435 359
169 3300049579 Ga0501043_0023022 Ga0501043_0023022_2946_4316 359
170 3300049579 Ga0501043_0045293 Ga0501043_0045293_1426_2745 359
171 3300049582 Ga0501048_0057414 Ga0501048_0057414_952_2271 359
172 3300049582 Ga0501048_0109805 Ga0501048_0109805_103_1473 359
173 3300049584 Ga0501068_0052436 Ga0501068_0052436_813_2183 359
174 3300049586 Ga0501070_0187062 Ga0501070_0187062_82_1452 359
175 3300049590 Ga0501074_0033139 Ga0501074_0033139_1656_2975 359
176 3300049591 Ga0501075_0010440 Ga0501075_0010440_4377_5723 359
177 3300049591 Ga0501075_0037563 Ga0501075_0037563_1652_3022 359
178 3300049592 Ga0501076_0153199 Ga0501076_0153199_99_1418 359
179 3300049741 Ga0501079_0022447 Ga0501079_0022447_2740_4110 359
180 3300049741 Ga0501079_0097655 Ga0501079_0097655_578_1897 359
181 3300049742 Ga0501080_0126568 Ga0501080_0126568_736_2106 359
182 3300049744 Ga0501083_0040342 Ga0501083_0040342_328_1698 359
183 3300049824 Ga0501045_0068434 Ga0501045_0068434_441_1811 359
184 3300050507 nmdc:mga05p37_237_c1 nmdc:mga05p37_237_c1_14864_16150 359
185 3300054114 Ga0501084_0041781 Ga0501084_0041781_2036_3355 359
186 3300059424 Ga0590075_005779 Ga0590075_005779_1447_2847 359
187 3300060353 Ga0501082_0020532 Ga0501082_0020532_4218_5564 359
188 3300060353 Ga0501082_0034708 Ga0501082_0034708_1945_3264 359
189 3300061734 Ga0530510_0025900 Ga0530510_0025900_2347_3717 359
190 3300005336 Ga0070680_100000002 Ga0070680_100000002111 360
191 3300005441 Ga0070700_100047412 Ga0070700_1000474123 360
192 3300005445 Ga0070708_100005137 Ga0070708_1000051376 360
193 3300005456 Ga0070678_100036119 Ga0070678_1000361191 360
194 3300005471 Ga0070698_100171045 Ga0070698_1001710452 360
195 3300005536 Ga0070697_100001262 Ga0070697_1000012624 360
196 3300005544 Ga0070686_100021087 Ga0070686_1000210872 360
197 3300006852 Ga0075433_10094025 Ga0075433_100940253 360
198 3300025917 Ga0207660_10000002 Ga0207660_10000002539 360
199 3300025918 Ga0207662_10008416 Ga0207662_100084162 360
200 3300025933 Ga0207706_10094494 Ga0207706_100944942 360
201 3300042876 Ga0451577_0008002 Ga0451577_0008002_2273_3604 360
202 3300044712 Ga0453684_0338729 Ga0453684_0338729_153_1484 360
203 3300048907 Ga0496104_0031707 Ga0496104_0031707_2550_3998 360
204 3300048911 Ga0496108_0044031 Ga0496108_0044031_1520_2968 360
205 3300048912 Ga0496109_0065598 Ga0496109_0065598_514_1962 360
206 3300048914 Ga0496111_0023447 Ga0496111_0023447_2226_3674 360
207 3300005445 Ga0070708_100024980 Ga0070708_1000249803 361
208 3300005468 Ga0070707_100005259 Ga0070707_1000052595 361
209 3300005518 Ga0070699_100004927 Ga0070699_1000049275 361
210 3300005549 Ga0070704_100073720 Ga0070704_1000737202 361
211 3300014325 Ga0163163_10071353 Ga0163163_100713533 361
212 3300025910 Ga0207684_10017808 Ga0207684_100178083 361
213 3300025922 Ga0207646_10001339 Ga0207646_1000133914 361
214 3300045976 Ga0466967_0083244 Ga0466967_0083244_672_1964 361
215 3300046454 Ga0495592_0078166 Ga0495592_0078166_292_1644 361
216 3300046516 Ga0495628_0140693 Ga0495628_0140693_446_1798 361
217 3300046529 Ga0495652_0057947 Ga0495652_0057947_1123_2475 361
218 3300046559 Ga0495667_0060257 Ga0495667_0060257_1010_2362 361
219 3300046642 Ga0495634_0046464 Ga0495634_0046464_1449_2801 361
220 3300047319 Ga0495674_0063442 Ga0495674_0063442_1373_2725 361
221 3300053077 Ga0495601_0038791 Ga0495601_0038791_596_1948 361
222 3300053078 Ga0495612_0000250 Ga0495612_0000250_14538_15947 361
223 iso_pu_bacteria 2888578766 2888579866 361
224 iso_pu_bacteria 2889049205 2889051542 361
225 3300005467 Ga0070706_100000121 Ga0070706_10000012123 362
226 3300005468 Ga0070707_100008631 Ga0070707_1000086318 362
227 3300005518 Ga0070699_100022279 Ga0070699_1000222793 362
228 3300005518 Ga0070699_100038003 Ga0070699_1000380032 362
229 3300005536 Ga0070697_100018299 Ga0070697_1000182993 362
230 3300005536 Ga0070697_100053659 Ga0070697_1000536593 362
231 3300013296 Ga0157374_10209357 Ga0157374_102093572 362
232 3300025907 Ga0207645_10062576 Ga0207645_100625763 362
233 3300025910 Ga0207684_10001255 Ga0207684_1000125521 362
234 3300025910 Ga0207684_10046752 Ga0207684_100467523 362
235 3300025922 Ga0207646_10007178 Ga0207646_100071783 362
236 3300031241 Ga0265325_10017170 Ga0265325_100171704 362
237 3300031727 Ga0316576_10003599 Ga0316576_100035995 362
238 3300035398 Ga0316574_0065584 Ga0316574_0065584_638_1924 362
239 3300049588 Ga0501072_0024124 Ga0501072_0024124_1083_2420 362
240 3300049591 Ga0501075_0032989 Ga0501075_0032989_1644_2981 362
241 3300049743 Ga0501081_0009555 Ga0501081_0009555_678_2015 362
242 3300060353 Ga0501082_0205822 Ga0501082_0205822_60_1397 362
243 3300061734 Ga0530510_0005943 Ga0530510_0005943_5363_6700 362
244 iso_pu_bacteria 2554235469 2556064713 362
245 iso_pu_bacteria 2939615513 2939617785 362
246 3300005337 Ga0070682_100030627 Ga0070682_1000306272 363
247 3300005338 Ga0068868_100086360 Ga0068868_1000863603 363
248 3300005343 Ga0070687_100008968 Ga0070687_1000089682 363
249 3300005441 Ga0070700_100055051 Ga0070700_1000550512 363
250 3300005458 Ga0070681_10124138 Ga0070681_101241382 363
251 3300005467 Ga0070706_100027597 Ga0070706_1000275974 363
252 3300005468 Ga0070707_100008051 Ga0070707_1000080514 363
253 3300005468 Ga0070707_100181202 Ga0070707_1001812022 363
254 3300005535 Ga0070684_100096046 Ga0070684_1000960462 363
255 3300005545 Ga0070695_100134309 Ga0070695_1001343091 363
256 3300005549 Ga0070704_100014597 Ga0070704_1000145972 363
257 3300006844 Ga0075428_100013192 Ga0075428_1000131925 363
258 3300006852 Ga0075433_10017405 Ga0075433_100174054 363
259 3300009094 Ga0111539_10028834 Ga0111539_100288342 363
260 3300009147 Ga0114129_10196646 Ga0114129_101966462 363
261 3300017792 Ga0163161_10015840 Ga0163161_100158402 363
262 3300025908 Ga0207643_10024249 Ga0207643_100242493 363
263 3300025918 Ga0207662_10002599 Ga0207662_100025995 363
264 3300025932 Ga0207690_10020973 Ga0207690_100209733 363
265 3300025941 Ga0207711_10071109 Ga0207711_100711092 363
266 3300025960 Ga0207651_10051162 Ga0207651_100511622 363
267 3300026067 Ga0207678_10003978 Ga0207678_100039784 363
268 3300026075 Ga0207708_10002016 Ga0207708_100020169 363
269 3300026075 Ga0207708_10087667 Ga0207708_100876672 363
270 3300026089 Ga0207648_10002191 Ga0207648_100021913 363
271 3300026121 Ga0207683_10003421 Ga0207683_1000342112 363
272 3300027717 Ga0209998_10017435 Ga0209998_100174351 363
273 3300028558 Ga0265326_10007805 Ga0265326_100078053 363
274 3300028563 Ga0265319_1014839 Ga0265319_10148392 363
275 3300028573 Ga0265334_10011617 Ga0265334_100116173 363
276 3300031240 Ga0265320_10017022 Ga0265320_100170224 363
277 3300031250 Ga0265331_10068000 Ga0265331_100680002 363
278 3300031711 Ga0265314_10042439 Ga0265314_100424392 363
279 3300031712 Ga0265342_10025881 Ga0265342_100258814 363
280 3300031824 Ga0307413_10098678 Ga0307413_100986782 363
281 3300047319 Ga0495674_0155666 Ga0495674_0155666_95_1423 363
282 3300048911 Ga0496108_0005265 Ga0496108_0005265_6671_8038 363
283 3300048912 Ga0496109_0038129 Ga0496109_0038129_681_2048 363
284 3300048913 Ga0496110_0153859 Ga0496110_0153859_641_2008 363
285 3300048915 Ga0496112_0017305 Ga0496112_0017305_2266_3633 363
286 3300049569 Ga0501032_0075476 Ga0501032_0075476_647_2029 363
287 3300049572 Ga0501036_0218485 Ga0501036_0218485_184_1566 363
288 3300049574 Ga0501038_0169034 Ga0501038_0169034_316_1698 363
289 3300049576 Ga0501040_0072396 Ga0501040_0072396_201_1583 363
290 3300049577 Ga0501041_0045744 Ga0501041_0045744_1115_2497 363
291 3300049580 Ga0501046_0016744 Ga0501046_0016744_446_1828 363
292 3300049590 Ga0501074_0032122 Ga0501074_0032122_132_1514 363
293 3300049822 Ga0501035_0126651 Ga0501035_0126651_100_1482 363
294 3300050507 nmdc:mga05p37_243716_c1 nmdc:mga05p37_243716_c1_111_1493 363
295 3300054114 Ga0501084_0046556 Ga0501084_0046556_499_1881 363
296 iso_pu_bacteria 2738543010 2739234577 363
297 iso_pu_bacteria 2956897341 2956901000 363
298 3300038726 Ga0400490_60595 Ga0400490_60595_1694_2962 364
299 3300038741 Ga0400488_37728 Ga0400488_37728_261_1529 364
300 3300053077 Ga0495601_0042904 Ga0495601_0042904_574_1902 364
301 3300005471 Ga0070698_100010395 Ga0070698_1000103952 365
302 3300049580 Ga0501046_0161673 Ga0501046_0161673_233_1576 365
303 3300045051 Ga0451576_0234412 Ga0451576_0234412_516_1646 367
304 3300046810 Ga0495660_0025660 Ga0495660_0025660_453_1697 367
305 3300005289 Ga0065704_10109980 Ga0065704_101099802 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

5

255

0.94

PF12804

NTP_transf_3

MobA-like NTP transferase domain

6

207

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r8u-assembly1.cif.gz_A escherichia coli agpase in complex with amp. 0.9307 5 329
5l6s-assembly1.cif.gz_B crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a positive allosteric regulator beta-fructose-1,6-diphosphate (fbp) - agpase*fbp 0.9164 5 329
6shj-assembly1.cif.gz_C escherichia coli agpase in complex with fbp. symmetry applied c2 0.9115 5 330
5l6v-assembly4.cif.gz_M crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a negative allosteric regulator adenosine monophosphate (amp) - agpase*amp 0.9109 5 329
6shj-assembly1.cif.gz_B escherichia coli agpase in complex with fbp. symmetry applied c2 0.9106 5 329
ID Description Score Start End Superfamily
af_P9WN43_3_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9256 5 269 3.90.550.10
5l6vH01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9058 5 269 3.90.550.10
af_A0A1D6HWJ4_65_382_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9029 5 281 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8988 8 246 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8965 5 260 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D4EEJ2-F1-model_v4 Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27) 0.9867 120 248 GO:0005524
GO:0005978
GO:0008878
AF-A0A357B375-F1-model_v4 Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27) 0.9811 40 229 GO:0005524
GO:0005978
GO:0008878
AF-A0A3M1Z7V2-F1-model_v4 Glucose-1-phosphate adenylyltransferase 0.9709 5 255 GO:0005524
GO:0005978
GO:0008878
AF-A0A660RLZ4-F1-model_v4 Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27) (ADP-glucose pyrophosphorylase) (ADPGlc PPase) (ADP-glucose synthase) 0.9702 3 329 GO:0005524
GO:0005978
GO:0008878
AF-A0A7X7L6K2-F1-model_v4 Glucose-1-phosphate adenylyltransferase 0.9702 99 329 GO:0005524
GO:0005978
GO:0008878

Feature Viewer

pLDDT pTM Quality
78.09 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map