F398000

General Info

Members Datasets Scaffolds Average Seq Length
305 150 610 60

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100097543|Ga0070707_1000975433
Length 70
Sequence VTLKLSRSAHSHPGEACRSSGAVSERGLHRIEDDLAETWLEDWAGAGVAEIEDFLAKHAAFLSFLETDEG

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
58 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
114 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.87
Metatranscriptomes 12.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100097543 3300005468 Bacteria 2847
2 Ga0058863_11884581 3300004799 Unclassified 972
3 Ga0058863_11975757 3300004799 Bacteria 641
4 Ga0058861_12049918 3300004800 Bacteria 1217
5 Ga0058861_12070759 3300004800 Bacteria 689
6 Ga0058862_10012405 3300004803 Unclassified 567
7 Ga0058862_12802843 3300004803 Unclassified 1004
8 Ga0070658_10027300 3300005327 Bacteria 4582
9 Ga0070658_10037301 3300005327 Bacteria 3917
10 Ga0070658_10062508 3300005327 Bacteria 3035
11 Ga0070683_100247374 3300005329 Bacteria 1696
12 Ga0070683_100293719 3300005329 Bacteria 1546
13 Ga0070680_100042293 3300005336 Bacteria 3697
14 Ga0070680_100546447 3300005336 Bacteria 993
15 Ga0070680_100826251 3300005336 Bacteria 799
16 Ga0070680_100858518 3300005336 Bacteria 783
17 Ga0070680_100864681 3300005336 Bacteria 780
18 Ga0070680_101916389 3300005336 Unclassified 514
19 Ga0070682_101014336 3300005337 Unclassified 690
20 Ga0070660_100034229 3300005339 Bacteria 3836
21 Ga0070660_100085393 3300005339 Bacteria 2482
22 Ga0070660_100409644 3300005339 Bacteria 1122
23 Ga0070660_100717276 3300005339 Bacteria 839
24 Ga0070659_100254942 3300005366 Bacteria 1455
25 Ga0070709_10110656 3300005434 Bacteria 1846
26 Ga0070714_100022366 3300005435 Bacteria 5184
27 Ga0070714_100080214 3300005435 Bacteria 2840
28 Ga0070714_100708394 3300005435 Bacteria 972
29 Ga0070713_101867756 3300005436 Bacteria 583
30 Ga0070713_101904728 3300005436 Unclassified 577
31 Ga0070710_10217396 3300005437 Bacteria 1214
32 Ga0070710_11095279 3300005437 Bacteria 584
33 Ga0070694_100895543 3300005444 Unclassified 732
34 Ga0070694_101659374 3300005444 Bacteria 543
35 Ga0070708_101442277 3300005445 Bacteria 642
36 Ga0070663_100637480 3300005455 Bacteria 900
37 Ga0070681_10051502 3300005458 Bacteria 4107
38 Ga0070681_10090918 3300005458 Bacteria 3003
39 Ga0070681_10137869 3300005458 Bacteria 2370
40 Ga0070681_10274272 3300005458 Bacteria 1598
41 Ga0070681_10284372 3300005458 Bacteria 1565
42 Ga0070681_10897554 3300005458 Unclassified 805
43 Ga0070706_100588068 3300005467 Bacteria 1035
44 Ga0070706_101470329 3300005467 Bacteria 623
45 Ga0070707_100152911 3300005468 Bacteria 2247
46 Ga0070707_100961884 3300005468 Unclassified 819
47 Ga0070698_100067236 3300005471 Bacteria 3604
48 Ga0070698_100217084 3300005471 Bacteria 1847
49 Ga0070698_100254937 3300005471 Bacteria 1687
50 Ga0070698_100479525 3300005471 Bacteria 1181
51 Ga0070698_100584003 3300005471 Bacteria 1057
52 Ga0070699_102049497 3300005518 Unclassified 523
53 Ga0070679_100085118 3300005530 Bacteria 3149
54 Ga0070679_100102002 3300005530 Bacteria 2856
55 Ga0070679_100142468 3300005530 Bacteria 2376
56 Ga0070679_100200685 3300005530 Bacteria 1961
57 Ga0070679_100250017 3300005530 Bacteria 1729
58 Ga0070679_100441180 3300005530 Bacteria 1247
59 Ga0070684_100048252 3300005535 Bacteria 3694
60 Ga0070684_100611364 3300005535 Unclassified 1014
61 Ga0068853_100674439 3300005539 Bacteria 985
62 Ga0070695_100320372 3300005545 Bacteria 1152
63 Ga0070696_100070311 3300005546 Bacteria 2462
64 Ga0070696_101204151 3300005546 Bacteria 640
65 Ga0070693_100554783 3300005547 Bacteria 823
66 Ga0070704_102190749 3300005549 Bacteria 514
67 Ga0068855_100033191 3300005563 Bacteria 6162
68 Ga0068855_100070976 3300005563 Bacteria 4051
69 Ga0068855_100225420 3300005563 Bacteria 2100
70 Ga0068856_100350464 3300005614 Bacteria 1495
71 Ga0068856_100740963 3300005614 Bacteria 1003
72 Ga0068856_102662571 3300005614 Bacteria 506
73 Ga0068852_102521770 3300005616 Bacteria 534
74 Ga0070717_10506067 3300006028 Bacteria 1092
75 Ga0070717_10910101 3300006028 Bacteria 801
76 Ga0070717_10918704 3300006028 Unclassified 797
77 Ga0070716_101398238 3300006173 Bacteria 569
78 Ga0070712_100261522 3300006175 Bacteria 1387
79 Ga0075433_11196757 3300006852 Bacteria 659
80 Ga0075434_100489553 3300006871 Bacteria 1251
81 Ga0075436_100105858 3300006914 Bacteria 1961
82 Ga0075436_100530700 3300006914 Bacteria 863
83 Ga0105240_10013640 3300009093 Bacteria 11145
84 Ga0105240_10593340 3300009093 Bacteria 1220
85 Ga0105245_12761457 3300009098 Bacteria 544
86 Ga0114129_11263376 3300009147 Bacteria 917
87 Ga0105241_11488857 3300009174 Unclassified 651
88 Ga0105237_12728802 3300009545 Bacteria 505
89 Ga0105238_10440310 3300009551 Bacteria 1299
90 Ga0105238_11870692 3300009551 Bacteria 633
91 Ga0099796_10403465 3300010159 Bacteria 600
92 Ga0105239_12339896 3300010375 Bacteria 622
93 Ga0157373_11441293 3300013100 Bacteria 524
94 Ga0157371_10118615 3300013102 Bacteria 1881
95 Ga0157371_10235728 3300013102 Bacteria 1316
96 Ga0157370_10008554 3300013104 Bacteria 11030
97 Ga0157370_10011551 3300013104 Bacteria 9220
98 Ga0157370_10722003 3300013104 Bacteria 909
99 Ga0157370_11916351 3300013104 Bacteria 532
100 Ga0157369_10003021 3300013105 Bacteria 20101
101 Ga0157369_10003191 3300013105 Bacteria 19559
102 Ga0157369_10569865 3300013105 Bacteria 1170
103 Ga0157369_10652700 3300013105 Bacteria 1085
104 Ga0157374_12764432 3300013296 Bacteria 518
105 Ga0157372_13087863 3300013307 Unclassified 532
106 Ga0182008_10034210 3300014497 Bacteria 2548
107 Ga0182008_10192216 3300014497 Bacteria 1036
108 Ga0182006_1075791 3300015261 Bacteria 1237
109 Ga0197907_11014537 3300020069 Bacteria 1368
110 Ga0197907_11032837 3300020069 Bacteria 809
111 Ga0206356_10654230 3300020070 Bacteria 2945
112 Ga0206356_11462311 3300020070 Bacteria 632
113 Ga0206356_11523791 3300020070 Bacteria 617
114 Ga0206356_11551499 3300020070 Bacteria 870
115 Ga0206349_1102637 3300020075 Bacteria 905
116 Ga0206355_1488794 3300020076 Unclassified 528
117 Ga0206351_10054583 3300020077 Bacteria 815
118 Ga0206352_10021398 3300020078 Bacteria 675
119 Ga0206352_10052649 3300020078 Bacteria 915
120 Ga0206352_10619755 3300020078 Bacteria 931
121 Ga0206350_10284785 3300020080 Bacteria 885
122 Ga0206350_11398972 3300020080 Unclassified 690
123 Ga0206354_10039702 3300020081 Bacteria 1280
124 Ga0206354_10369938 3300020081 Bacteria 1343
125 Ga0206354_11348122 3300020081 Bacteria 879
126 Ga0206353_11023341 3300020082 Bacteria 1653
127 Ga0206353_11466679 3300020082 Bacteria 1631
128 Ga0206353_11891094 3300020082 Bacteria 1067
129 Ga0154015_1434558 3300020610 Bacteria 992
130 Ga0224712_10102091 3300022467 Bacteria 1218
131 Ga0224712_10147404 3300022467 Bacteria 1040
132 Ga0224712_10444716 3300022467 Unclassified 622
133 Ga0207692_10456287 3300025898 Bacteria 805
134 Ga0207699_10020288 3300025906 Bacteria 3559
135 Ga0207699_10115311 3300025906 Bacteria 1728
136 Ga0207699_10124744 3300025906 Bacteria 1670
137 Ga0207705_10014803 3300025909 Bacteria 5608
138 Ga0207705_10468587 3300025909 Bacteria 977
139 Ga0207705_10634835 3300025909 Bacteria 830
140 Ga0207654_10522542 3300025911 Bacteria 840
141 Ga0207707_10092768 3300025912 Bacteria 2638
142 Ga0207707_10196947 3300025912 Bacteria 1757
143 Ga0207707_10202038 3300025912 Bacteria 1733
144 Ga0207707_10327704 3300025912 Bacteria 1321
145 Ga0207707_10594994 3300025912 Unclassified 937
146 Ga0207695_10182529 3300025913 Bacteria 2019
147 Ga0207663_10253029 3300025916 Bacteria 1297
148 Ga0207660_10126906 3300025917 Bacteria 1938
149 Ga0207660_10394770 3300025917 Bacteria 1113
150 Ga0207660_10610497 3300025917 Bacteria 889
151 Ga0207660_10706135 3300025917 Bacteria 823
152 Ga0207660_10955933 3300025917 Bacteria 699
153 Ga0207657_10001226 3300025919 Bacteria 27377
154 Ga0207657_10007076 3300025919 Bacteria 11526
155 Ga0207657_10302807 3300025919 Bacteria 1266
156 Ga0207657_10618631 3300025919 Bacteria 844
157 Ga0207649_10071201 3300025920 Bacteria 2220
158 Ga0207649_11651899 3300025920 Unclassified 507
159 Ga0207652_10029752 3300025921 Bacteria 4570
160 Ga0207652_10148356 3300025921 Bacteria 2099
161 Ga0207652_10170159 3300025921 Bacteria 1955
162 Ga0207652_10183777 3300025921 Bacteria 1879
163 Ga0207652_10934415 3300025921 Bacteria 765
164 Ga0207652_11219586 3300025921 Bacteria 654
165 Ga0207646_10526296 3300025922 Bacteria 1064
166 Ga0207646_10971478 3300025922 Unclassified 751
167 Ga0207646_11851776 3300025922 Unclassified 515
168 Ga0207646_11932338 3300025922 Unclassified 502
169 Ga0207694_10522961 3300025924 Bacteria 994
170 Ga0207700_10237542 3300025928 Bacteria 1552
171 Ga0207700_10577688 3300025928 Bacteria 999
172 Ga0207700_11173139 3300025928 Bacteria 686
173 Ga0207664_10004379 3300025929 Bacteria 9569
174 Ga0207664_10029526 3300025929 Bacteria 4177
175 Ga0207664_10039705 3300025929 Bacteria 3655
176 Ga0207664_10183470 3300025929 Bacteria 1797
177 Ga0207664_10808065 3300025929 Bacteria 843
178 Ga0207664_10829340 3300025929 Bacteria 831
179 Ga0207664_11172921 3300025929 Bacteria 685
180 Ga0207690_10305380 3300025932 Bacteria 1246
181 Ga0207665_10104024 3300025939 Bacteria 1986
182 Ga0207665_10256240 3300025939 Bacteria 1294
183 Ga0207661_10312018 3300025944 Bacteria 1412
184 Ga0207661_10611667 3300025944 Unclassified 1000
185 Ga0207679_11225230 3300025945 Bacteria 689
186 Ga0207667_10073694 3300025949 Bacteria 3547
187 Ga0207667_10218752 3300025949 Bacteria 1952
188 Ga0207667_10588641 3300025949 Bacteria 1123
189 Ga0207639_10283430 3300026041 Bacteria 1458
190 Ga0207639_10602270 3300026041 Bacteria 1013
191 Ga0207678_10696041 3300026067 Bacteria 894
192 Ga0207702_11394898 3300026078 Bacteria 694
193 Ga0207702_11776558 3300026078 Bacteria 609
194 Ga0207698_10453732 3300026142 Bacteria 1238
195 Ga0207698_11618750 3300026142 Bacteria 663
196 Ga0207698_12124094 3300026142 Bacteria 575
197 Ga0265334_10069863 3300028573 Bacteria 1310
198 Ga0265318_10007208 3300028577 Bacteria 5049
199 Ga0265318_10225100 3300028577 Bacteria 685
200 Ga0265322_10061915 3300028654 Bacteria 1061
201 Ga0265338_10027092 3300028800 Bacteria 5759
202 Ga0265324_10209035 3300029957 Bacteria 663
203 Ga0265330_10154318 3300031235 Bacteria 975
204 Ga0265332_10278389 3300031238 Bacteria 691
205 Ga0265328_10122158 3300031239 Bacteria 972
206 Ga0265320_10035705 3300031240 Bacteria 2518
207 Ga0265325_10083013 3300031241 Bacteria 1590
208 Ga0265325_10258165 3300031241 Bacteria 787
209 Ga0265329_10102700 3300031242 Bacteria 910
210 Ga0265340_10056022 3300031247 Bacteria 1897
211 Ga0265339_10067658 3300031249 Bacteria 1910
212 Ga0265331_10361322 3300031250 Bacteria 650
213 Ga0265327_10192504 3300031251 Bacteria 927
214 Ga0265316_10075958 3300031344 Bacteria 2582
215 Ga0265313_10022817 3300031595 Bacteria 3386
216 Ga0265314_10061971 3300031711 Bacteria 2545
217 Ga0265314_10435711 3300031711 Bacteria 701
218 Ga0265342_10037614 3300031712 Bacteria 2950
219 Ga0395899_0009149 3300037312 Bacteria 7612
220 Ga0395900_0190964 3300037418 Bacteria 2077
221 Ga0395900_0440666 3300037418 Bacteria 1260
222 Ga0395900_1112037 3300037418 Bacteria 707
223 Ga0395900_1501337 3300037418 Bacteria 586
224 Ga0395898_0050829 3300037466 Bacteria 4055
225 Ga0395898_0189561 3300037466 Bacteria 1965
226 Ga0395898_0568527 3300037466 Bacteria 1076
227 Ga0395898_0817533 3300037466 Bacteria 872
228 Ga0395898_0962795 3300037466 Bacteria 790
229 Ga0395898_1339190 3300037466 Bacteria 645
230 Ga0395905_0052656 3300037471 Bacteria 3810
231 Ga0395905_1165402 3300037471 Bacteria 674
232 Ga0395905_1708957 3300037471 Bacteria 535
233 Ga0395901_0189265 3300038443 Bacteria 2158
234 Ga0395901_0572500 3300038443 Bacteria 1142
235 Ga0395901_1273610 3300038443 Bacteria 698
236 Ga0242420_022233 3300038996 Bacteria 1140
237 Ga0451804_0152205 3300041463 Bacteria 716
238 Ga0439448_0235127 3300042005 Bacteria 645
239 Ga0439459_0250010 3300042438 Bacteria 500
240 Ga0451577_1528511 3300042876 Bacteria 590
241 Ga0466972_0172552 3300044658 Bacteria 1015
242 Ga0466965_0834531 3300044683 Unclassified 535
243 Ga0466966_0474534 3300044684 Bacteria 752
244 Ga0466966_0632221 3300044684 Bacteria 644
245 Ga0466966_0654540 3300044684 Bacteria 633
246 Ga0466963_0070283 3300044694 Bacteria 2354
247 Ga0466963_0173046 3300044694 Bacteria 1506
248 Ga0466963_0407404 3300044694 Bacteria 959
249 Ga0466963_0418405 3300044694 Bacteria 945
250 Ga0466963_0511194 3300044694 Bacteria 848
251 Ga0466963_0858029 3300044694 Bacteria 640
252 Ga0466964_0018140 3300044706 Bacteria 2699
253 Ga0466964_0154006 3300044706 Bacteria 1068
254 Ga0466964_0415400 3300044706 Bacteria 706
255 Ga0453684_2464584 3300044712 Unclassified 514
256 Ga0466971_0047108 3300044719 Bacteria 1938
257 Ga0466971_0142924 3300044719 Bacteria 1114
258 Ga0466968_0027845 3300044735 Bacteria 2327
259 Ga0466957_0174656 3300044842 Bacteria 1401
260 Ga0466957_0491770 3300044842 Unclassified 849
261 Ga0466957_1153166 3300044842 Bacteria 560
262 Ga0466960_0200110 3300044901 Bacteria 1091
263 Ga0466960_0375890 3300044901 Bacteria 815
264 Ga0466958_0041440 3300045836 Bacteria 2769
265 Ga0466958_0188620 3300045836 Bacteria 1310
266 Ga0466967_0011702 3300045976 Bacteria 6667
267 Ga0466967_0108961 3300045976 Bacteria 2542
268 Ga0466967_0112561 3300045976 Bacteria 2502
269 Ga0466967_0161932 3300045976 Bacteria 2101
270 Ga0466967_0183330 3300045976 Bacteria 1975
271 Ga0466967_0188490 3300045976 Bacteria 1948
272 Ga0466967_0459470 3300045976 Bacteria 1245
273 Ga0466967_0730109 3300045976 Bacteria 982
274 Ga0466967_1014807 3300045976 Bacteria 826
275 Ga0466967_1269837 3300045976 Bacteria 733
276 Ga0466967_2126883 3300045976 Bacteria 557
277 Ga0495653_0760386 3300046463 Bacteria 585
278 Ga0495589_0190057 3300046794 Unclassified 972
279 Ga0495676_0646626 3300047321 Bacteria 686
280 Ga0496102_0066356 3300048905 Bacteria 3307
281 Ga0496105_0450652 3300048908 Bacteria 1016
282 Ga0496106_0003029 3300048909 Bacteria 12519
283 Ga0496107_0000117 3300048910 Bacteria 38826
284 Ga0496109_0951614 3300048912 Bacteria 797
285 Ga0496109_1300579 3300048912 Bacteria 663
286 Ga0496112_0135581 3300048915 Bacteria 2432
287 Ga0496112_0355979 3300048915 Bacteria 1406
288 Ga0496112_0362408 3300048915 Bacteria 1391
289 Ga0496113_0281015 3300048916 Bacteria 1331
290 Ga0496113_0699536 3300048916 Bacteria 809
291 Ga0496113_1380517 3300048916 Unclassified 546
292 Ga0501067_0078452 3300049583 Bacteria 1830
293 Ga0501067_0625164 3300049583 Unclassified 604
294 Ga0501068_0250761 3300049584 Bacteria 1128
295 nmdc:mga0rr50_1439945_c1 3300050513 Unclassified 583
296 Ga0587066_205793 3300059490 Bacteria 520
297 Ga0587089_084426 3300059509 Bacteria 557
298 Ga0587095_026040 3300059514 Bacteria 586
299 Ga0587115_071927 3300059626 Bacteria 599
300 Ga0587075_115887 3300059644 Bacteria 550
301 Ga0587078_052163 3300059646 Bacteria 602
302 Ga0587079_138132 3300059647 Bacteria 619
303 Ga0466962_0125416 3300061719 Bacteria 1240
304 Ga0466962_0200074 3300061719 Bacteria 976
305 Ga0466962_0578342 3300061719 Bacteria 572
306 Ga0070707_100097543
307 Ga0058863_11884581
308 Ga0058863_11975757
309 Ga0058861_12049918
310 Ga0058861_12070759
311 Ga0058862_10012405
312 Ga0058862_12802843
313 Ga0070658_10027300
314 Ga0070658_10037301
315 Ga0070658_10062508
316 Ga0070683_100247374
317 Ga0070683_100293719
318 Ga0070680_100042293
319 Ga0070680_100546447
320 Ga0070680_100826251
321 Ga0070680_100858518
322 Ga0070680_100864681
323 Ga0070680_101916389
324 Ga0070682_101014336
325 Ga0070660_100034229
326 Ga0070660_100085393
327 Ga0070660_100409644
328 Ga0070660_100717276
329 Ga0070659_100254942
330 Ga0070709_10110656
331 Ga0070714_100022366
332 Ga0070714_100080214
333 Ga0070714_100708394
334 Ga0070713_101867756
335 Ga0070713_101904728
336 Ga0070710_10217396
337 Ga0070710_11095279
338 Ga0070694_100895543
339 Ga0070694_101659374
340 Ga0070708_101442277
341 Ga0070663_100637480
342 Ga0070681_10051502
343 Ga0070681_10090918
344 Ga0070681_10137869
345 Ga0070681_10274272
346 Ga0070681_10284372
347 Ga0070681_10897554
348 Ga0070706_100588068
349 Ga0070706_101470329
350 Ga0070707_100152911
351 Ga0070707_100961884
352 Ga0070698_100067236
353 Ga0070698_100217084
354 Ga0070698_100254937
355 Ga0070698_100479525
356 Ga0070698_100584003
357 Ga0070699_102049497
358 Ga0070679_100085118
359 Ga0070679_100102002
360 Ga0070679_100142468
361 Ga0070679_100200685
362 Ga0070679_100250017
363 Ga0070679_100441180
364 Ga0070684_100048252
365 Ga0070684_100611364
366 Ga0068853_100674439
367 Ga0070695_100320372
368 Ga0070696_100070311
369 Ga0070696_101204151
370 Ga0070693_100554783
371 Ga0070704_102190749
372 Ga0068855_100033191
373 Ga0068855_100070976
374 Ga0068855_100225420
375 Ga0068856_100350464
376 Ga0068856_100740963
377 Ga0068856_102662571
378 Ga0068852_102521770
379 Ga0070717_10506067
380 Ga0070717_10910101
381 Ga0070717_10918704
382 Ga0070716_101398238
383 Ga0070712_100261522
384 Ga0075433_11196757
385 Ga0075434_100489553
386 Ga0075436_100105858
387 Ga0075436_100530700
388 Ga0105240_10013640
389 Ga0105240_10593340
390 Ga0105245_12761457
391 Ga0114129_11263376
392 Ga0105241_11488857
393 Ga0105237_12728802
394 Ga0105238_10440310
395 Ga0105238_11870692
396 Ga0099796_10403465
397 Ga0105239_12339896
398 Ga0157373_11441293
399 Ga0157371_10118615
400 Ga0157371_10235728
401 Ga0157370_10008554
402 Ga0157370_10011551
403 Ga0157370_10722003
404 Ga0157370_11916351
405 Ga0157369_10003021
406 Ga0157369_10003191
407 Ga0157369_10569865
408 Ga0157369_10652700
409 Ga0157374_12764432
410 Ga0157372_13087863
411 Ga0182008_10034210
412 Ga0182008_10192216
413 Ga0182006_1075791
414 Ga0197907_11014537
415 Ga0197907_11032837
416 Ga0206356_10654230
417 Ga0206356_11462311
418 Ga0206356_11523791
419 Ga0206356_11551499
420 Ga0206349_1102637
421 Ga0206355_1488794
422 Ga0206351_10054583
423 Ga0206352_10021398
424 Ga0206352_10052649
425 Ga0206352_10619755
426 Ga0206350_10284785
427 Ga0206350_11398972
428 Ga0206354_10039702
429 Ga0206354_10369938
430 Ga0206354_11348122
431 Ga0206353_11023341
432 Ga0206353_11466679
433 Ga0206353_11891094
434 Ga0154015_1434558
435 Ga0224712_10102091
436 Ga0224712_10147404
437 Ga0224712_10444716
438 Ga0207692_10456287
439 Ga0207699_10020288
440 Ga0207699_10115311
441 Ga0207699_10124744
442 Ga0207705_10014803
443 Ga0207705_10468587
444 Ga0207705_10634835
445 Ga0207654_10522542
446 Ga0207707_10092768
447 Ga0207707_10196947
448 Ga0207707_10202038
449 Ga0207707_10327704
450 Ga0207707_10594994
451 Ga0207695_10182529
452 Ga0207663_10253029
453 Ga0207660_10126906
454 Ga0207660_10394770
455 Ga0207660_10610497
456 Ga0207660_10706135
457 Ga0207660_10955933
458 Ga0207657_10001226
459 Ga0207657_10007076
460 Ga0207657_10302807
461 Ga0207657_10618631
462 Ga0207649_10071201
463 Ga0207649_11651899
464 Ga0207652_10029752
465 Ga0207652_10148356
466 Ga0207652_10170159
467 Ga0207652_10183777
468 Ga0207652_10934415
469 Ga0207652_11219586
470 Ga0207646_10526296
471 Ga0207646_10971478
472 Ga0207646_11851776
473 Ga0207646_11932338
474 Ga0207694_10522961
475 Ga0207700_10237542
476 Ga0207700_10577688
477 Ga0207700_11173139
478 Ga0207664_10004379
479 Ga0207664_10029526
480 Ga0207664_10039705
481 Ga0207664_10183470
482 Ga0207664_10808065
483 Ga0207664_10829340
484 Ga0207664_11172921
485 Ga0207690_10305380
486 Ga0207665_10104024
487 Ga0207665_10256240
488 Ga0207661_10312018
489 Ga0207661_10611667
490 Ga0207679_11225230
491 Ga0207667_10073694
492 Ga0207667_10218752
493 Ga0207667_10588641
494 Ga0207639_10283430
495 Ga0207639_10602270
496 Ga0207678_10696041
497 Ga0207702_11394898
498 Ga0207702_11776558
499 Ga0207698_10453732
500 Ga0207698_11618750
501 Ga0207698_12124094
502 Ga0265334_10069863
503 Ga0265318_10007208
504 Ga0265318_10225100
505 Ga0265322_10061915
506 Ga0265338_10027092
507 Ga0265324_10209035
508 Ga0265330_10154318
509 Ga0265332_10278389
510 Ga0265328_10122158
511 Ga0265320_10035705
512 Ga0265325_10083013
513 Ga0265325_10258165
514 Ga0265329_10102700
515 Ga0265340_10056022
516 Ga0265339_10067658
517 Ga0265331_10361322
518 Ga0265327_10192504
519 Ga0265316_10075958
520 Ga0265313_10022817
521 Ga0265314_10061971
522 Ga0265314_10435711
523 Ga0265342_10037614
524 Ga0395899_0009149
525 Ga0395900_0190964
526 Ga0395900_0440666
527 Ga0395900_1112037
528 Ga0395900_1501337
529 Ga0395898_0050829
530 Ga0395898_0189561
531 Ga0395898_0568527
532 Ga0395898_0817533
533 Ga0395898_0962795
534 Ga0395898_1339190
535 Ga0395905_0052656
536 Ga0395905_1165402
537 Ga0395905_1708957
538 Ga0395901_0189265
539 Ga0395901_0572500
540 Ga0395901_1273610
541 Ga0242420_022233
542 Ga0451804_0152205
543 Ga0439448_0235127
544 Ga0439459_0250010
545 Ga0451577_1528511
546 Ga0466972_0172552
547 Ga0466965_0834531
548 Ga0466966_0474534
549 Ga0466966_0632221
550 Ga0466966_0654540
551 Ga0466963_0070283
552 Ga0466963_0173046
553 Ga0466963_0407404
554 Ga0466963_0418405
555 Ga0466963_0511194
556 Ga0466963_0858029
557 Ga0466964_0018140
558 Ga0466964_0154006
559 Ga0466964_0415400
560 Ga0453684_2464584
561 Ga0466971_0047108
562 Ga0466971_0142924
563 Ga0466968_0027845
564 Ga0466957_0174656
565 Ga0466957_0491770
566 Ga0466957_1153166
567 Ga0466960_0200110
568 Ga0466960_0375890
569 Ga0466958_0041440
570 Ga0466958_0188620
571 Ga0466967_0011702
572 Ga0466967_0108961
573 Ga0466967_0112561
574 Ga0466967_0161932
575 Ga0466967_0183330
576 Ga0466967_0188490
577 Ga0466967_0459470
578 Ga0466967_0730109
579 Ga0466967_1014807
580 Ga0466967_1269837
581 Ga0466967_2126883
582 Ga0495653_0760386
583 Ga0495589_0190057
584 Ga0495676_0646626
585 Ga0496102_0066356
586 Ga0496105_0450652
587 Ga0496106_0003029
588 Ga0496107_0000117
589 Ga0496109_0951614
590 Ga0496109_1300579
591 Ga0496112_0135581
592 Ga0496112_0355979
593 Ga0496112_0362408
594 Ga0496113_0281015
595 Ga0496113_0699536
596 Ga0496113_1380517
597 Ga0501067_0078452
598 Ga0501067_0625164
599 Ga0501068_0250761
600 nmdc:mga0rr50_1439945_c1
601 Ga0587066_205793
602 Ga0587089_084426
603 Ga0587095_026040
604 Ga0587115_071927
605 Ga0587075_115887
606 Ga0587078_052163
607 Ga0587079_138132
608 Ga0466962_0125416
609 Ga0466962_0200074
610 Ga0466962_0578342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map