F397869

General Info

Members Datasets Scaffolds Average Seq Length
304 196 263 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8008485437|8008485509
Length 262
Sequence ENADRPRRPRAGRGSRPRRAAPAPLAEAPAPSTPLTPSTPPAPPADADPRPDLAAMRVRYRAAGLGEEDLAAAPIEQFRRWFDEAVASGLNEPNAMVVATADATGAPSQRTVLLKGFDERGFVFFSNYASRKGREIEANPRASLLFPWHPIARQVIVTGPVTRTGRDETVAYFRTRPHGSQLGAWASEQSAPVASRAALDGMYAELAARYPEGEDVPAPPNWGGYRVAPETVEFWQGRANRLHDRLRYVRADGGWSVERLCP

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
11 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
12 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
13 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
14 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
15 2808606448 Streptomyces sp. 193411 Isolate Unclassified
16 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
17 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
18 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
19 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
20 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
21 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
22 2867369537 Streptomyces sp. Z26 Isolate Unclassified
23 2867428634 Streptomyces sp. RP5T Isolate Unclassified
24 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
25 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
26 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
27 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
28 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
29 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
30 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
31 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
32 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
33 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
34 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
35 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
36 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
98 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
99 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
193 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
194 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
195 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
196 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.86
Metatranscriptomes 0.66
Isolates 13.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 0
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 17.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10017593 3300001990 Bacteria 2301
2 JGI24735J21928_10024076 3300002067 Bacteria 1844
3 rootH2_10010188 3300003320 Bacteria 8537
4 rootH2_10054733 3300003320 Bacteria 4008
5 rootH1_10034196 3300003323 Bacteria 7762
6 Ga0006562J51391_1116078 3300003578 Bacteria 12055
7 Ga0006562J51391_1116086 3300003578 Bacteria 2750
8 Ga0055530_10032843 3300003791 Bacteria 1345
9 Ga0065712_10322030 3300005290 Unclassified 827
10 Ga0070714_100957347 3300005435 Bacteria 832
11 Ga0070705_100595796 3300005440 Bacteria 854
12 Ga0070708_100073834 3300005445 Bacteria 3075
13 Ga0070708_100295821 3300005445 Unclassified 1524
14 Ga0070708_100531564 3300005445 Bacteria 1109
15 Ga0070706_100316584 3300005467 Bacteria 1455
16 Ga0070707_100000838 3300005468 Bacteria 30417
17 Ga0070707_100008433 3300005468 Bacteria 9574
18 Ga0070707_100010267 3300005468 Bacteria 8722
19 Ga0070707_100058722 3300005468 Bacteria 3689
20 Ga0070707_100294088 3300005468 Bacteria 1578
21 Ga0070707_100361609 3300005468 Bacteria 1410
22 Ga0070707_100965700 3300005468 Bacteria 817
23 Ga0070698_100003838 3300005471 Bacteria 16524
24 Ga0070698_100318522 3300005471 Bacteria 1486
25 Ga0070698_100502436 3300005471 Bacteria 1150
26 Ga0070699_100033793 3300005518 Bacteria 4419
27 Ga0070699_100137284 3300005518 Bacteria 2157
28 Ga0070697_100009572 3300005536 Bacteria 7567
29 Ga0070697_100013585 3300005536 Bacteria 6388
30 Ga0070665_101255520 3300005548 Bacteria 751
31 Ga0068855_100276888 3300005563 Bacteria 1865
32 Ga0081539_10160141 3300005985 Bacteria 1073
33 Ga0070717_10031951 3300006028 Bacteria 4239
34 Ga0070716_100032892 3300006173 Unclassified 2833
35 Ga0075428_100104923 3300006844 Bacteria 3082
36 Ga0075431_100071501 3300006847 Bacteria 3580
37 Ga0075433_10310884 3300006852 Bacteria 1395
38 Ga0075429_100002743 3300006880 Bacteria 14875
39 Ga0075429_100052093 3300006880 Unclassified 3561
40 Ga0075436_100027792 3300006914 Bacteria 3894
41 Ga0111539_10284864 3300009094 Bacteria 1923
42 Ga0105237_10124362 3300009545 Bacteria 2574
43 Ga0105237_10262632 3300009545 Bacteria 1729
44 Ga0157378_10066227 3300013297 Unclassified 3235
45 Ga0157372_10135355 3300013307 Bacteria 2837
46 Ga0209050_1000300 3300025298 Bacteria 103399
47 Ga0207671_10165414 3300025914 Bacteria 1715
48 Ga0207671_10252845 3300025914 Bacteria 1385
49 Ga0207646_10000820 3300025922 Bacteria 40381
50 Ga0207646_10005500 3300025922 Bacteria 13317
51 Ga0207646_10027061 3300025922 Bacteria 5229
52 Ga0207646_10124633 3300025922 Bacteria 2316
53 Ga0307517_10061130 3300028786 Bacteria 3570
54 Ga0307515_10068115 3300028794 Bacteria 4896
55 Ga0307515_10210198 3300028794 Bacteria 1792
56 Ga0307511_10002973 3300030521 Bacteria 17554
57 Ga0307511_10071502 3300030521 Bacteria 2530
58 Ga0307512_10002861 3300030522 Bacteria 20972
59 Ga0307512_10027968 3300030522 Bacteria 4950
60 Ga0265327_10004015 3300031251 Bacteria 13397
61 Ga0307513_10004004 3300031456 Bacteria 19775
62 Ga0307513_10508917 3300031456 Bacteria 920
63 Ga0307509_10033071 3300031507 Bacteria 5694
64 Ga0307509_10039731 3300031507 Bacteria 5123
65 Ga0307509_10045800 3300031507 Bacteria 4713
66 Ga0307508_10203038 3300031616 Bacteria 1582
67 Ga0307514_10155580 3300031649 Bacteria 1525
68 Ga0307514_10216784 3300031649 Bacteria 1179
69 Ga0307514_10245521 3300031649 Bacteria 1067
70 Ga0316576_10013773 3300031727 Bacteria 5387
71 Ga0307516_10262432 3300031730 Bacteria 1417
72 Ga0307413_10158961 3300031824 Bacteria 1585
73 Ga0307518_10019364 3300031838 Bacteria 4889
74 Ga0307518_10064433 3300031838 Bacteria 2659
75 Ga0307518_10078977 3300031838 Bacteria 2377
76 Ga0307414_10031772 3300032004 Bacteria 3468
77 Ga0307510_10029953 3300033180 Bacteria 6179
78 Ga0307510_10190772 3300033180 Bacteria 1597
79 Ga0316574_0180584 3300035398 Bacteria 1358
80 Ga0316584_0346092 3300036712 Bacteria 1068
81 Ga0400483_265207 3300039062 Unclassified 2385
82 Ga0436363_1313413 3300039450 Unclassified 2090
83 Ga0439439_0018050 3300041406 Bacteria 1740
84 Ga0451837_0007263 3300041494 Bacteria 1807
85 Ga0439433_0000517 3300041999 Bacteria 7246
86 Ga0439442_005358 3300042002 Bacteria 2566
87 Ga0439448_0002492 3300042005 Bacteria 5016
88 Ga0439449_0009669 3300042007 Bacteria 3649
89 Ga0439455_0003708 3300042012 Bacteria 2951
90 Ga0439457_000124 3300042014 Bacteria 19049
91 Ga0439457_000499 3300042014 Bacteria 11375
92 Ga0439462_0004741 3300042015 Bacteria 3332
93 Ga0450894_016819 3300042131 Bacteria 971
94 Ga0450903_000074 3300042138 Bacteria 20108
95 Ga0439458_0000916 3300042157 Bacteria 7601
96 Ga0451577_0272133 3300042876 Unclassified 1534
97 Ga0466969_0013672 3300044656 Bacteria 4271
98 Ga0466969_0081627 3300044656 Bacteria 1542
99 Ga0466966_0002662 3300044684 Bacteria 11703
100 Ga0466966_0002669 3300044684 Bacteria 11689
101 Ga0466966_0004319 3300044684 Bacteria 9368
102 Ga0466966_0178264 3300044684 Bacteria 1290
103 Ga0466966_0255641 3300044684 Bacteria 1055
104 Ga0466961_0004540 3300044693 Bacteria 8706
105 Ga0466961_0006579 3300044693 Bacteria 7386
106 Ga0466961_0018600 3300044693 Bacteria 4471
107 Ga0466961_0030743 3300044693 Bacteria 3450
108 Ga0466961_0040140 3300044693 Bacteria 3000
109 Ga0466963_0079587 3300044694 Bacteria 2217
110 Ga0466963_0374875 3300044694 Bacteria 1003
111 Ga0453684_0000019 3300044712 Bacteria 908702
112 Ga0466971_0001329 3300044719 Bacteria 10337
113 Ga0466971_0003584 3300044719 Bacteria 6634
114 Ga0466971_0008735 3300044719 Bacteria 4421
115 Ga0466970_0030355 3300044765 Bacteria 2850
116 Ga0466970_0079017 3300044765 Bacteria 1776
117 Ga0466957_0030712 3300044842 Bacteria 3209
118 Ga0466959_0005992 3300045049 Bacteria 8388
119 Ga0466959_0010248 3300045049 Bacteria 6691
120 Ga0466959_0041430 3300045049 Bacteria 3399
121 Ga0466958_0014372 3300045836 Bacteria 4521
122 Ga0466958_0016297 3300045836 Bacteria 4277
123 Ga0466958_0117137 3300045836 Bacteria 1666
124 Ga0495592_0000781 3300046454 Bacteria 22116
125 Ga0495592_0018452 3300046454 Bacteria 5306
126 Ga0495629_0000980 3300046459 Bacteria 22904
127 Ga0495629_0006704 3300046459 Bacteria 8514
128 Ga0495629_0087143 3300046459 Bacteria 2178
129 Ga0495651_0003910 3300046462 Bacteria 11392
130 Ga0495651_0007104 3300046462 Bacteria 8559
131 Ga0495651_0105330 3300046462 Bacteria 2092
132 Ga0495662_0000880 3300046476 Bacteria 14678
133 Ga0495662_0023279 3300046476 Bacteria 2990
134 Ga0495662_0037263 3300046476 Bacteria 2348
135 Ga0495664_0001126 3300046477 Bacteria 13862
136 Ga0495585_0005641 3300046492 Bacteria 7861
137 Ga0495594_0000134 3300046499 Bacteria 34789
138 Ga0495594_0314216 3300046499 Bacteria 892
139 Ga0495618_0077303 3300046514 Bacteria 2121
140 Ga0495628_0035179 3300046516 Bacteria 4026
141 Ga0495628_0086465 3300046516 Bacteria 2431
142 Ga0495630_0044836 3300046517 Bacteria 3305
143 Ga0495630_0212661 3300046517 Bacteria 1476
144 Ga0495666_0199419 3300046526 Bacteria 920
145 Ga0495652_0007197 3300046529 Bacteria 10272
146 Ga0495652_0041124 3300046529 Bacteria 3992
147 Ga0495652_0226349 3300046529 Bacteria 1402
148 Ga0495640_0001429 3300046533 Bacteria 18812
149 Ga0495640_0093285 3300046533 Bacteria 1984
150 Ga0495640_0178114 3300046533 Bacteria 1356
151 Ga0495587_0047044 3300046536 Bacteria 2558
152 Ga0495645_0054668 3300046543 Bacteria 2900
153 Ga0495645_0110937 3300046543 Bacteria 1941
154 Ga0495622_0029282 3300046557 Bacteria 2573
155 Ga0495667_0098790 3300046559 Bacteria 1890
156 Ga0495634_0010410 3300046642 Bacteria 6814
157 Ga0495611_0023205 3300046648 Bacteria 2691
158 Ga0495625_0109126 3300046660 Bacteria 1893
159 Ga0495635_0000946 3300046663 Bacteria 19160
160 Ga0495635_0064112 3300046663 Bacteria 2523
161 Ga0495635_0176467 3300046663 Bacteria 1452
162 Ga0495588_0108180 3300046674 Bacteria 1464
163 Ga0495657_0003014 3300046675 Bacteria 13926
164 Ga0495657_0017155 3300046675 Bacteria 5261
165 Ga0495599_0035868 3300046678 Bacteria 3113
166 Ga0495646_0000479 3300046680 Bacteria 21264
167 Ga0495646_0052193 3300046680 Bacteria 2471
168 Ga0495613_0005626 3300046689 Bacteria 9405
169 Ga0495613_0006157 3300046689 Bacteria 8981
170 Ga0495613_0050212 3300046689 Bacteria 3076
171 Ga0495613_0059817 3300046689 Bacteria 2791
172 Ga0495671_0047354 3300046692 Bacteria 2149
173 Ga0495600_0091904 3300046809 Bacteria 1979
174 Ga0495600_0092234 3300046809 Bacteria 1975
175 Ga0495581_0006435 3300047315 Bacteria 6816
176 Ga0495604_0001421 3300047317 Bacteria 19651
177 Ga0495604_0025672 3300047317 Bacteria 4693
178 Ga0495676_0001645 3300047321 Bacteria 19489
179 Ga0495676_0003313 3300047321 Bacteria 14559
180 Ga0495687_000974 3300047443 Bacteria 29055
181 Ga0495675_0006351 3300047444 Bacteria 7233
182 Ga0495675_0029359 3300047444 Bacteria 3507
183 Ga0495685_011771 3300047447 Bacteria 2957
184 Ga0495593_0000286 3300047673 Bacteria 27471
185 Ga0495602_0128621 3300048088 Bacteria 2024
186 Ga0495602_0162587 3300048088 Bacteria 1741
187 Ga0495614_0002962 3300048089 Bacteria 7567
188 Ga0496117_0209024 3300048920 Bacteria 1096
189 Ga0496120_0113188 3300048923 Bacteria 1414
190 Ga0496126_0410490 3300048929 Bacteria 1097
191 Ga0501031_0009155 3300049568 Bacteria 6440
192 Ga0501032_0004937 3300049569 Bacteria 9975
193 Ga0501032_0034112 3300049569 Bacteria 3484
194 Ga0501032_0034983 3300049569 Bacteria 3435
195 Ga0501033_0015761 3300049570 Bacteria 5729
196 Ga0501033_0044495 3300049570 Bacteria 3304
197 Ga0501033_0101296 3300049570 Bacteria 2101
198 Ga0501034_0007976 3300049571 Bacteria 11241
199 Ga0501034_0031458 3300049571 Bacteria 5389
200 Ga0501034_0082833 3300049571 Bacteria 3210
201 Ga0501036_0068399 3300049572 Bacteria 3005
202 Ga0501036_0078276 3300049572 Bacteria 2796
203 Ga0501037_0004666 3300049573 Bacteria 9954
204 Ga0501037_0085836 3300049573 Bacteria 2279
205 Ga0501037_0319386 3300049573 Bacteria 1075
206 Ga0501038_0008315 3300049574 Bacteria 9549
207 Ga0501038_0239971 3300049574 Bacteria 1439
208 Ga0501038_0300659 3300049574 Bacteria 1259
209 Ga0501039_0002484 3300049575 Bacteria 13720
210 Ga0501039_0076037 3300049575 Bacteria 2610
211 Ga0501040_0136886 3300049576 Bacteria 1724
212 Ga0501041_0000878 3300049577 Bacteria 16234
213 Ga0501042_0008137 3300049578 Bacteria 6906
214 Ga0501043_0021898 3300049579 Bacteria 5012
215 Ga0501043_0056704 3300049579 Bacteria 3077
216 Ga0501046_0006399 3300049580 Bacteria 10442
217 Ga0501047_0007179 3300049581 Bacteria 10470
218 Ga0501047_0015665 3300049581 Bacteria 7225
219 Ga0501047_0245498 3300049581 Bacteria 1640
220 Ga0501047_0367744 3300049581 Bacteria 1273
221 Ga0501048_0014794 3300049582 Bacteria 5771
222 Ga0501067_0003356 3300049583 Bacteria 8800
223 Ga0501068_0035855 3300049584 Bacteria 2962
224 Ga0501069_0050195 3300049585 Bacteria 2319
225 Ga0501069_0324015 3300049585 Bacteria 906
226 Ga0501070_0078068 3300049586 Bacteria 2740
227 Ga0501070_0115453 3300049586 Bacteria 2217
228 Ga0501071_0001544 3300049587 Bacteria 13441
229 Ga0501072_0000587 3300049588 Bacteria 26203
230 Ga0501073_0172858 3300049589 Bacteria 1495
231 Ga0501074_0044641 3300049590 Bacteria 3207
232 Ga0501077_0125163 3300049593 Bacteria 1629
233 Ga0501079_0092822 3300049741 Bacteria 2338
234 Ga0501080_0025084 3300049742 Bacteria 5532
235 Ga0501080_0103021 3300049742 Bacteria 2647
236 Ga0501083_0055771 3300049744 Bacteria 2648
237 Ga0501035_0063083 3300049822 Bacteria 3296
238 Ga0501035_0063260 3300049822 Bacteria 3291
239 Ga0501035_0064732 3300049822 Bacteria 3248
240 Ga0501035_0350779 3300049822 Bacteria 1234
241 Ga0501044_0000276 3300049823 Bacteria 65263
242 Ga0501044_0002100 3300049823 Bacteria 22927
243 Ga0501044_0043000 3300049823 Bacteria 4695
244 Ga0501044_0057164 3300049823 Bacteria 4003
245 Ga0501044_0342750 3300049823 Bacteria 1415
246 Ga0501044_0701362 3300049823 Bacteria 897
247 Ga0501045_0073279 3300049824 Bacteria 2521
248 nmdc:mga09592_1113_c1 3300050508 Bacteria 21394
249 nmdc:mga09592_88902_c1 3300050508 Unclassified 2638
250 nmdc:mga06r32_35089_c1 3300050510 Bacteria 4732
251 nmdc:mga08y16_339162_c1 3300050511 Bacteria 1545
252 nmdc:mga08x19_10651_c1 3300050514 Bacteria 5529
253 Ga0495612_0007022 3300053078 Bacteria 4605
254 Ga0500572_005825 3300053111 Bacteria 2805
255 Ga0500568_0006232 3300053139 Bacteria 6020
256 Ga0501084_0100188 3300054114 Bacteria 2432
257 Ga0501082_0033718 3300060353 Bacteria 4416
258 Ga0466962_0000051 3300061719 Bacteria 47373
259 Ga0466962_0002926 3300061719 Bacteria 8142
260 Ga0466962_0010068 3300061719 Bacteria 4536
261 Ga0466962_0290811 3300061719 Bacteria 807
262 Ga0530510_0004792 3300061734 Bacteria 9368
263 Ga0530510_0098460 3300061734 Bacteria 2138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0037263 Ga0495662_0037263_1021_1764 206
2 3300046517 Ga0495630_0212661 Ga0495630_0212661_220_963 206
3 3300046663 Ga0495635_0064112 Ga0495635_0064112_550_1293 206
4 3300046689 Ga0495613_0050212 Ga0495613_0050212_1762_2505 206
5 3300048920 Ga0496117_0209024 Ga0496117_0209024_277_948 207
6 3300048923 Ga0496120_0113188 Ga0496120_0113188_733_1404 207
7 3300044693 Ga0466961_0040140 Ga0466961_0040140_575_1216 208
8 3300044719 Ga0466971_0008735 Ga0466971_0008735_2657_3298 208
9 3300045049 Ga0466959_0005992 Ga0466959_0005992_6241_6882 208
10 3300046492 Ga0495585_0005641 Ga0495585_0005641_6620_7255 208
11 3300049823 Ga0501044_0342750 Ga0501044_0342750_209_958 208
12 3300061719 Ga0466962_0010068 Ga0466962_0010068_1210_1851 208
13 3300041494 Ga0451837_0007263 Ga0451837_0007263_20_661 209
14 3300049569 Ga0501032_0004937 Ga0501032_0004937_9268_9906 209
15 3300049822 Ga0501035_0350779 Ga0501035_0350779_70_708 209
16 3300039062 Ga0400483_265207 Ga0400483_265207_194_826 210
17 3300005290 Ga0065712_10322030 Ga0065712_103220301 211
18 3300005435 Ga0070714_100957347 Ga0070714_1009573471 211
19 3300005445 Ga0070708_100295821 Ga0070708_1002958212 211
20 3300005445 Ga0070708_100531564 Ga0070708_1005315642 211
21 3300005467 Ga0070706_100316584 Ga0070706_1003165842 211
22 3300005468 Ga0070707_100000838 Ga0070707_1000008389 211
23 3300005468 Ga0070707_100008433 Ga0070707_1000084333 211
24 3300005468 Ga0070707_100010267 Ga0070707_1000102673 211
25 3300005468 Ga0070707_100294088 Ga0070707_1002940881 211
26 3300005468 Ga0070707_100361609 Ga0070707_1003616092 211
27 3300005468 Ga0070707_100965700 Ga0070707_1009657001 211
28 3300005471 Ga0070698_100003838 Ga0070698_10000383814 211
29 3300005471 Ga0070698_100318522 Ga0070698_1003185222 211
30 3300005471 Ga0070698_100502436 Ga0070698_1005024362 211
31 3300005518 Ga0070699_100033793 Ga0070699_1000337935 211
32 3300005518 Ga0070699_100137284 Ga0070699_1001372843 211
33 3300005536 Ga0070697_100013585 Ga0070697_1000135854 211
34 3300005985 Ga0081539_10160141 Ga0081539_101601411 211
35 3300006028 Ga0070717_10031951 Ga0070717_100319513 211
36 3300006173 Ga0070716_100032892 Ga0070716_1000328923 211
37 3300006844 Ga0075428_100104923 Ga0075428_1001049232 211
38 3300006847 Ga0075431_100071501 Ga0075431_1000715012 211
39 3300006880 Ga0075429_100002743 Ga0075429_1000027433 211
40 3300006880 Ga0075429_100052093 Ga0075429_1000520932 211
41 3300006914 Ga0075436_100027792 Ga0075436_1000277923 211
42 3300009094 Ga0111539_10284864 Ga0111539_102848642 211
43 3300009545 Ga0105237_10124362 Ga0105237_101243622 211
44 3300009545 Ga0105237_10262632 Ga0105237_102626323 211
45 3300013297 Ga0157378_10066227 Ga0157378_100662274 211
46 3300013307 Ga0157372_10135355 Ga0157372_101353553 211
47 3300025914 Ga0207671_10165414 Ga0207671_101654141 211
48 3300025914 Ga0207671_10252845 Ga0207671_102528452 211
49 3300025922 Ga0207646_10000820 Ga0207646_100008209 211
50 3300025922 Ga0207646_10005500 Ga0207646_1000550010 211
51 3300025922 Ga0207646_10124633 Ga0207646_101246333 211
52 3300039450 Ga0436363_1313413 Ga0436363_1313413_1114_1764 211
53 3300044656 Ga0466969_0081627 Ga0466969_0081627_284_943 211
54 3300044684 Ga0466966_0004319 Ga0466966_0004319_92_742 211
55 3300044684 Ga0466966_0178264 Ga0466966_0178264_217_876 211
56 3300044693 Ga0466961_0006579 Ga0466961_0006579_226_876 211
57 3300044694 Ga0466963_0079587 Ga0466963_0079587_1338_1988 211
58 3300044694 Ga0466963_0374875 Ga0466963_0374875_121_771 211
59 3300044719 Ga0466971_0003584 Ga0466971_0003584_258_908 211
60 3300044765 Ga0466970_0030355 Ga0466970_0030355_1718_2368 211
61 3300044842 Ga0466957_0030712 Ga0466957_0030712_1008_1658 211
62 3300045836 Ga0466958_0014372 Ga0466958_0014372_1767_2417 211
63 3300046543 Ga0495645_0054668 Ga0495645_0054668_1322_2011 211
64 3300047444 Ga0495675_0006351 Ga0495675_0006351_5395_6084 211
65 3300050508 nmdc:mga09592_1113_c1 nmdc:mga09592_1113_c1_15979_16614 211
66 3300050508 nmdc:mga09592_88902_c1 nmdc:mga09592_88902_c1_1406_2041 211
67 3300050510 nmdc:mga06r32_35089_c1 nmdc:mga06r32_35089_c1_2659_3294 211
68 3300050511 nmdc:mga08y16_339162_c1 nmdc:mga08y16_339162_c1_471_1106 211
69 3300050514 nmdc:mga08x19_10651_c1 nmdc:mga08x19_10651_c1_1005_1655 211
70 3300061719 Ga0466962_0002926 Ga0466962_0002926_7267_7917 211
71 3300061719 Ga0466962_0290811 Ga0466962_0290811_141_791 211
72 3300003320 rootH2_10010188 rootH2_100101889 212
73 3300003791 Ga0055530_10032843 Ga0055530_100328432 212
74 3300005440 Ga0070705_100595796 Ga0070705_1005957962 212
75 3300005445 Ga0070708_100073834 Ga0070708_1000738343 212
76 3300005468 Ga0070707_100058722 Ga0070707_1000587221 212
77 3300005536 Ga0070697_100009572 Ga0070697_1000095722 212
78 3300005548 Ga0070665_101255520 Ga0070665_1012555201 212
79 3300006852 Ga0075433_10310884 Ga0075433_103108841 212
80 3300025298 Ga0209050_1000300 Ga0209050_100030038 212
81 3300025922 Ga0207646_10027061 Ga0207646_100270614 212
82 3300028786 Ga0307517_10061130 Ga0307517_100611303 212
83 3300030521 Ga0307511_10071502 Ga0307511_100715022 212
84 3300031251 Ga0265327_10004015 Ga0265327_1000401510 212
85 3300031507 Ga0307509_10033071 Ga0307509_100330713 212
86 3300044656 Ga0466969_0013672 Ga0466969_0013672_3371_4045 212
87 3300044684 Ga0466966_0002669 Ga0466966_0002669_154_828 212
88 3300044693 Ga0466961_0030743 Ga0466961_0030743_1672_2346 212
89 3300044719 Ga0466971_0001329 Ga0466971_0001329_7823_8497 212
90 3300044765 Ga0466970_0079017 Ga0466970_0079017_890_1564 212
91 3300045049 Ga0466959_0010248 Ga0466959_0010248_178_852 212
92 3300045836 Ga0466958_0016297 Ga0466958_0016297_3471_4145 212
93 3300046454 Ga0495592_0018452 Ga0495592_0018452_3838_4512 212
94 3300046462 Ga0495651_0007104 Ga0495651_0007104_6465_7139 212
95 3300046514 Ga0495618_0077303 Ga0495618_0077303_644_1318 212
96 3300046516 Ga0495628_0035179 Ga0495628_0035179_916_1590 212
97 3300046529 Ga0495652_0007197 Ga0495652_0007197_473_1147 212
98 3300046529 Ga0495652_0226349 Ga0495652_0226349_136_825 212
99 3300046663 Ga0495635_0000946 Ga0495635_0000946_15234_15908 212
100 3300046678 Ga0495599_0035868 Ga0495599_0035868_999_1673 212
101 3300046680 Ga0495646_0052193 Ga0495646_0052193_1147_1821 212
102 3300046809 Ga0495600_0092234 Ga0495600_0092234_161_835 212
103 3300048088 Ga0495602_0128621 Ga0495602_0128621_1184_1858 212
104 3300048929 Ga0496126_0410490 Ga0496126_0410490_328_1002 212
105 3300049742 Ga0501080_0103021 Ga0501080_0103021_1081_1755 212
106 3300053078 Ga0495612_0007022 Ga0495612_0007022_659_1333 212
107 3300061719 Ga0466962_0000051 Ga0466962_0000051_31851_32525 212
108 iso_pu_bacteria 2515154088 2515494073 212
109 iso_pu_bacteria 2515154129 2515721372 212
110 iso_pu_bacteria 2515154137 2515755880 212
111 iso_pu_bacteria 2515154202 2516085496 212
112 iso_pu_bacteria 2515154203 2516089787 212
113 iso_pu_bacteria 3006486233 3006488605 212
114 3300044693 Ga0466961_0018600 Ga0466961_0018600_2784_3428 213
115 3300045836 Ga0466958_0117137 Ga0466958_0117137_195_839 213
116 3300049581 Ga0501047_0367744 Ga0501047_0367744_396_1058 213
117 3300061734 Ga0530510_0004792 Ga0530510_0004792_5785_6447 213
118 3300031824 Ga0307413_10158961 Ga0307413_101589613 214
119 3300032004 Ga0307414_10031772 Ga0307414_100317723 214
120 3300046648 Ga0495611_0023205 Ga0495611_0023205_994_1668 214
121 iso_pu_bacteria 2818991472 2819741159 214
122 3300042876 Ga0451577_0272133 Ga0451577_0272133_384_1118 215
123 3300044712 Ga0453684_0000019 Ga0453684_0000019_907229_907963 215
124 iso_pu_bacteria 2784746763 2785343304 215
125 iso_pu_bacteria 8048406513 8048412752 215
126 3300031727 Ga0316576_10013773 Ga0316576_100137733 216
127 3300035398 Ga0316574_0180584 Ga0316574_0180584_543_1223 216
128 3300036712 Ga0316584_0346092 Ga0316584_0346092_322_1002 216
129 3300044684 Ga0466966_0255641 Ga0466966_0255641_212_919 216
130 3300046454 Ga0495592_0000781 Ga0495592_0000781_11544_12251 216
131 3300046462 Ga0495651_0003910 Ga0495651_0003910_3850_4557 216
132 3300046476 Ga0495662_0000880 Ga0495662_0000880_1513_2220 216
133 3300046477 Ga0495664_0001126 Ga0495664_0001126_10780_11487 216
134 3300046517 Ga0495630_0044836 Ga0495630_0044836_1308_2015 216
135 3300046529 Ga0495652_0041124 Ga0495652_0041124_1887_2594 216
136 3300046533 Ga0495640_0178114 Ga0495640_0178114_33_740 216
137 3300046543 Ga0495645_0110937 Ga0495645_0110937_1057_1764 216
138 3300046642 Ga0495634_0010410 Ga0495634_0010410_615_1322 216
139 3300046663 Ga0495635_0176467 Ga0495635_0176467_478_1185 216
140 3300046674 Ga0495588_0108180 Ga0495588_0108180_652_1359 216
141 3300046675 Ga0495657_0003014 Ga0495657_0003014_6421_7128 216
142 3300046680 Ga0495646_0000479 Ga0495646_0000479_12187_12894 216
143 3300046689 Ga0495613_0006157 Ga0495613_0006157_1273_1980 216
144 3300046809 Ga0495600_0091904 Ga0495600_0091904_1005_1712 216
145 3300047315 Ga0495581_0006435 Ga0495581_0006435_4217_4924 216
146 3300047317 Ga0495604_0001421 Ga0495604_0001421_11897_12604 216
147 3300047321 Ga0495676_0001645 Ga0495676_0001645_2964_3671 216
148 3300047444 Ga0495675_0029359 Ga0495675_0029359_819_1526 216
149 3300047447 Ga0495685_011771 Ga0495685_011771_1706_2455 216
150 3300047673 Ga0495593_0000286 Ga0495593_0000286_1133_1840 216
151 3300048088 Ga0495602_0162587 Ga0495602_0162587_459_1166 216
152 3300048089 Ga0495614_0002962 Ga0495614_0002962_1704_2411 216
153 3300053111 Ga0500572_005825 Ga0500572_005825_1635_2342 216
154 3300053139 Ga0500568_0006232 Ga0500568_0006232_3598_4293 216
155 iso_pu_bacteria 2744054611 2744953977 216
156 3300049568 Ga0501031_0009155 Ga0501031_0009155_2030_2782 217
157 3300049570 Ga0501033_0015761 Ga0501033_0015761_4252_5004 217
158 3300049571 Ga0501034_0007976 Ga0501034_0007976_869_1621 217
159 3300049572 Ga0501036_0068399 Ga0501036_0068399_1344_2096 217
160 3300049573 Ga0501037_0004666 Ga0501037_0004666_4766_5518 217
161 3300049574 Ga0501038_0008315 Ga0501038_0008315_1115_1867 217
162 3300049575 Ga0501039_0002484 Ga0501039_0002484_8862_9614 217
163 3300049576 Ga0501040_0136886 Ga0501040_0136886_374_1126 217
164 3300049577 Ga0501041_0000878 Ga0501041_0000878_2705_3457 217
165 3300049578 Ga0501042_0008137 Ga0501042_0008137_5938_6690 217
166 3300049579 Ga0501043_0021898 Ga0501043_0021898_3523_4275 217
167 3300049580 Ga0501046_0006399 Ga0501046_0006399_3744_4496 217
168 3300049581 Ga0501047_0007179 Ga0501047_0007179_5966_6718 217
169 3300049582 Ga0501048_0014794 Ga0501048_0014794_4775_5527 217
170 3300049583 Ga0501067_0003356 Ga0501067_0003356_7450_8202 217
171 3300049584 Ga0501068_0035855 Ga0501068_0035855_1471_2223 217
172 3300049585 Ga0501069_0050195 Ga0501069_0050195_658_1410 217
173 3300049586 Ga0501070_0115453 Ga0501070_0115453_726_1478 217
174 3300049587 Ga0501071_0001544 Ga0501071_0001544_6843_7595 217
175 3300049588 Ga0501072_0000587 Ga0501072_0000587_13393_14145 217
176 3300049589 Ga0501073_0172858 Ga0501073_0172858_273_1025 217
177 3300049590 Ga0501074_0044641 Ga0501074_0044641_740_1492 217
178 3300049593 Ga0501077_0125163 Ga0501077_0125163_400_1152 217
179 3300049741 Ga0501079_0092822 Ga0501079_0092822_245_997 217
180 3300049742 Ga0501080_0025084 Ga0501080_0025084_401_1153 217
181 3300049744 Ga0501083_0055771 Ga0501083_0055771_910_1662 217
182 3300049823 Ga0501044_0002100 Ga0501044_0002100_18926_19678 217
183 3300049824 Ga0501045_0073279 Ga0501045_0073279_910_1662 217
184 3300054114 Ga0501084_0100188 Ga0501084_0100188_1271_2023 217
185 3300060353 Ga0501082_0033718 Ga0501082_0033718_2270_3022 217
186 3300061734 Ga0530510_0098460 Ga0530510_0098460_597_1349 217
187 iso_pu_bacteria 2867346516 2867348788 217
188 iso_pu_bacteria 2867428634 2867433303 217
189 iso_pu_bacteria 8033684223 8033690585 217
190 3300046459 Ga0495629_0087143 Ga0495629_0087143_216_950 218
191 3300046462 Ga0495651_0105330 Ga0495651_0105330_1149_1883 218
192 3300046499 Ga0495594_0314216 Ga0495594_0314216_76_780 218
193 3300046516 Ga0495628_0086465 Ga0495628_0086465_216_950 218
194 3300046526 Ga0495666_0199419 Ga0495666_0199419_77_811 218
195 3300046533 Ga0495640_0001429 Ga0495640_0001429_1968_2702 218
196 3300046533 Ga0495640_0093285 Ga0495640_0093285_600_1346 218
197 3300046559 Ga0495667_0098790 Ga0495667_0098790_210_944 218
198 3300046675 Ga0495657_0017155 Ga0495657_0017155_1120_1854 218
199 3300046689 Ga0495613_0005626 Ga0495613_0005626_3191_3925 218
200 3300047317 Ga0495604_0025672 Ga0495604_0025672_1258_2004 218
201 3300047321 Ga0495676_0003313 Ga0495676_0003313_8255_8989 218
202 iso_pu_bacteria 2643221678 2644437165 218
203 iso_pu_bacteria 2643221714 2644628903 218
204 iso_pu_bacteria 2808606359 2808842061 218
205 iso_pu_bacteria 2811994879 2812358108 218
206 iso_pu_bacteria 2852635781 2852636675 218
207 iso_pu_bacteria 2862507626 2862512231 218
208 iso_pu_bacteria 2867369537 2867371872 218
209 iso_pu_bacteria 2912715099 2912719957 218
210 iso_pu_bacteria 2919468124 2919469512 218
211 iso_pu_bacteria 2946072368 2946075917 218
212 iso_pu_bacteria 2947224130 2947229231 218
213 iso_pu_bacteria 3006493962 3006500760 218
214 3300028794 Ga0307515_10210198 Ga0307515_102101981 219
215 3300030521 Ga0307511_10002973 Ga0307511_100029736 219
216 3300030522 Ga0307512_10027968 Ga0307512_100279684 219
217 3300031456 Ga0307513_10508917 Ga0307513_105089171 219
218 3300031507 Ga0307509_10039731 Ga0307509_100397312 219
219 3300031507 Ga0307509_10045800 Ga0307509_100458002 219
220 3300031649 Ga0307514_10155580 Ga0307514_101555802 219
221 3300031730 Ga0307516_10262432 Ga0307516_102624322 219
222 3300031838 Ga0307518_10064433 Ga0307518_100644333 219
223 3300031838 Ga0307518_10078977 Ga0307518_100789772 219
224 3300033180 Ga0307510_10029953 Ga0307510_100299532 219
225 3300042014 Ga0439457_000124 Ga0439457_000124_5784_6455 219
226 3300042131 Ga0450894_016819 Ga0450894_016819_44_715 219
227 3300046536 Ga0495587_0047044 Ga0495587_0047044_615_1319 219
228 3300046557 Ga0495622_0029282 Ga0495622_0029282_259_963 219
229 3300046660 Ga0495625_0109126 Ga0495625_0109126_1106_1771 219
230 3300046692 Ga0495671_0047354 Ga0495671_0047354_276_980 219
231 3300047443 Ga0495687_000974 Ga0495687_000974_12454_13173 219
232 3300049569 Ga0501032_0034112 Ga0501032_0034112_308_1024 219
233 3300049569 Ga0501032_0034983 Ga0501032_0034983_1126_1983 219
234 3300049570 Ga0501033_0044495 Ga0501033_0044495_1408_2124 219
235 3300049570 Ga0501033_0101296 Ga0501033_0101296_1210_2040 219
236 3300049571 Ga0501034_0031458 Ga0501034_0031458_14_871 219
237 3300049571 Ga0501034_0082833 Ga0501034_0082833_1441_2157 219
238 3300049572 Ga0501036_0078276 Ga0501036_0078276_690_1547 219
239 3300049573 Ga0501037_0319386 Ga0501037_0319386_296_1012 219
240 3300049574 Ga0501038_0300659 Ga0501038_0300659_289_1005 219
241 3300049575 Ga0501039_0076037 Ga0501039_0076037_1416_2132 219
242 3300049579 Ga0501043_0056704 Ga0501043_0056704_1580_2437 219
243 3300049581 Ga0501047_0015665 Ga0501047_0015665_6088_6804 219
244 3300049586 Ga0501070_0078068 Ga0501070_0078068_280_996 219
245 3300049822 Ga0501035_0063083 Ga0501035_0063083_163_879 219
246 3300049822 Ga0501035_0063260 Ga0501035_0063260_388_1245 219
247 3300049823 Ga0501044_0057164 Ga0501044_0057164_1802_2659 219
248 3300049823 Ga0501044_0701362 Ga0501044_0701362_113_829 219
249 iso_pu_bacteria 2862705112 2862710144 219
250 iso_pu_bacteria 2990044586 2990047027 219
251 iso_pu_bacteria 3006321560 3006325036 219
252 iso_pu_bacteria 8008485437 8008485509 219
253 iso_pu_bacteria 8025524527 8025529983 219
254 3300031649 Ga0307514_10245521 Ga0307514_102455211 220
255 iso_pu_bacteria 2954002825 2954007409 220
256 3300003320 rootH2_10054733 rootH2_100547332 221
257 3300003323 rootH1_10034196 rootH1_100341967 221
258 3300042005 Ga0439448_0002492 Ga0439448_0002492_776_1480 221
259 3300042012 Ga0439455_0003708 Ga0439455_0003708_572_1276 221
260 3300042138 Ga0450903_000074 Ga0450903_000074_12916_13620 221
261 3300042157 Ga0439458_0000916 Ga0439458_0000916_409_1113 221
262 3300044684 Ga0466966_0002662 Ga0466966_0002662_1481_2263 221
263 3300044693 Ga0466961_0004540 Ga0466961_0004540_442_1224 221
264 3300045049 Ga0466959_0041430 Ga0466959_0041430_1458_2240 221
265 3300046459 Ga0495629_0000980 Ga0495629_0000980_4182_4946 221
266 3300046499 Ga0495594_0000134 Ga0495594_0000134_32186_32950 221
267 3300049573 Ga0501037_0085836 Ga0501037_0085836_1129_1908 221
268 3300049574 Ga0501038_0239971 Ga0501038_0239971_442_1221 221
269 3300049822 Ga0501035_0064732 Ga0501035_0064732_2098_2877 221
270 3300049823 Ga0501044_0043000 Ga0501044_0043000_2902_3681 221
271 iso_pu_bacteria 2547132111 2547408113 221
272 iso_pu_bacteria 2643221647 2644262275 221
273 iso_pu_bacteria 2767802112 2768644733 221
274 iso_pu_bacteria 2784132148 2784588565 221
275 iso_pu_bacteria 2808606448 2809232177 221
276 iso_pu_bacteria 2954673503 2954676925 221
277 iso_pu_bacteria 2954682443 2954687233 221
278 iso_pu_bacteria 2954691527 2954696877 221
279 iso_pu_bacteria 2954701450 2954705259 221
280 iso_pu_bacteria 8023623736 8023630789 221
281 3300001990 JGI24737J22298_10017593 JGI24737J22298_100175932 222
282 3300002067 JGI24735J21928_10024076 JGI24735J21928_100240762 222
283 3300003578 Ga0006562J51391_1116078 Ga0006562J51391_11160785 222
284 3300003578 Ga0006562J51391_1116086 Ga0006562J51391_11160864 222
285 3300005563 Ga0068855_100276888 Ga0068855_1002768882 222
286 3300028794 Ga0307515_10068115 Ga0307515_100681153 222
287 3300030522 Ga0307512_10002861 Ga0307512_100028612 222
288 3300031456 Ga0307513_10004004 Ga0307513_1000400415 222
289 3300031616 Ga0307508_10203038 Ga0307508_102030381 222
290 3300031649 Ga0307514_10216784 Ga0307514_102167842 222
291 3300031838 Ga0307518_10019364 Ga0307518_100193645 222
292 3300033180 Ga0307510_10190772 Ga0307510_101907722 222
293 3300041406 Ga0439439_0018050 Ga0439439_0018050_1050_1718 222
294 3300041999 Ga0439433_0000517 Ga0439433_0000517_1471_2139 222
295 3300042002 Ga0439442_005358 Ga0439442_005358_1322_1990 222
296 3300042007 Ga0439449_0009669 Ga0439449_0009669_86_754 222
297 3300042014 Ga0439457_000499 Ga0439457_000499_1990_2658 222
298 3300042015 Ga0439462_0004741 Ga0439462_0004741_1778_2446 222
299 3300046459 Ga0495629_0006704 Ga0495629_0006704_6253_6996 222
300 3300046476 Ga0495662_0023279 Ga0495662_0023279_468_1211 222
301 3300046689 Ga0495613_0059817 Ga0495613_0059817_1259_2002 222
302 3300049581 Ga0501047_0245498 Ga0501047_0245498_78_803 222
303 3300049585 Ga0501069_0324015 Ga0501069_0324015_218_895 222
304 3300049823 Ga0501044_0000276 Ga0501044_0000276_44358_45083 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

222

262

0.97

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

82

168

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9791 12 222
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.974 21 222
6ylz-assembly1.cif.gz_AAA-2 x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli 0.9736 21 222
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9692 21 222
6ymh-assembly1.cif.gz_BBB x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.9617 18 222
ID Description Score Start End Superfamily
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9836 18 210 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9739 21 222 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9691 21 222 2.30.110.10
af_Q9VHZ5_37_246_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9653 29 222 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9603 18 172 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1E7LZK5-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9949 14 222 GO:0004733
GO:0008615
GO:0010181
AF-A0A0Q9AGA2-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9933 14 222 GO:0004733
GO:0008615
GO:0010181
AF-A0A7W3ZM69-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9932 9 222 GO:0004733
GO:0008615
GO:0010181
AF-E4NFH3-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9906 10 222 GO:0004733
GO:0008615
GO:0010181
AF-A0A1E7LZK5-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9901 14 222 GO:0004733
GO:0008615
GO:0010181

Feature Viewer

pLDDT pTM Quality
93.09 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map