F397826
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 219 | 295 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300053145|Ga0500586_002014|Ga0500586_002014_834_1595 |
| Length | 253 |
| Sequence | LAHDIIGSRRIVVTGGYRLAWIIQDIAYPEDSMAAQPDFELYGFWRTSATYRVRVALNLKGLGAQEHVIDLDKGEQLGADFLKINPLGAIPALIEKGHAPLTQSTAILEFLDEIHPAPPLLPSDPHGRARVRALAAMLAGDTHPLITPRVRKYLSTVGGFDDAAVRAWLIHWFDTGIAAVEKRLASESATGTFCHGDQVGIADICLASITATMKVLNIPVKNAPTIDRIIATCEAMEAFAKADPMKQVGAPKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 6 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 7 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 8 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 9 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 96 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 105 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 106 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 112 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 113 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 114 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 115 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 116 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 117 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 185 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 190 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 197 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 198 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 199 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 200 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 201 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 202 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 203 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 204 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 205 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 206 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 208 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 209 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 211 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 213 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 214 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 215 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 216 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 217 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 218 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 219 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.05 |
| Metatranscriptomes | 0.99 |
| Isolates | 2.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.46 |
| Nodule | 0 |
| Rhizoplane | 2.96 |
| Rhizosphere | 59.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001533 | 3300001979 | Bacteria | 10622 |
| 2 | JGI24737J22298_10002120 | 3300001990 | Bacteria | 7075 |
| 3 | JGI24735J21928_10001392 | 3300002067 | Bacteria | 8554 |
| 4 | JGI24749J21850_1000187 | 3300002076 | Bacteria | 9856 |
| 5 | JGI24751J29686_10000112 | 3300002459 | Bacteria | 42533 |
| 6 | rootH2_10011232 | 3300003320 | Bacteria | 1554 |
| 7 | rootH2_10036142 | 3300003320 | Bacteria | 15654 |
| 8 | rootL2_10121225 | 3300003322 | Bacteria | 2850 |
| 9 | rootL2_10212375 | 3300003322 | Bacteria | 1353 |
| 10 | rootH1_10104958 | 3300003323 | Bacteria | 8292 |
| 11 | Ga0006562J51391_1001475 | 3300003578 | Bacteria | 3600 |
| 12 | Ga0006562J51391_1001477 | 3300003578 | Bacteria | 4840 |
| 13 | Ga0055533_1000762 | 3300003756 | Bacteria | 10264 |
| 14 | Ga0055536_1019857 | 3300003781 | Bacteria | 2096 |
| 15 | Ga0065165_1002346 | 3300005262 | Bacteria | 16454 |
| 16 | Ga0065707_10084576 | 3300005295 | Bacteria | 7042 |
| 17 | Ga0070670_100000069 | 3300005331 | Bacteria | 104077 |
| 18 | Ga0070669_100000105 | 3300005353 | Bacteria | 80655 |
| 19 | Ga0070667_100005699 | 3300005367 | Bacteria | 10403 |
| 20 | Ga0070713_100062781 | 3300005436 | Bacteria | 3112 |
| 21 | Ga0070710_10054929 | 3300005437 | Bacteria | 2248 |
| 22 | Ga0070663_100056242 | 3300005455 | Bacteria | 2818 |
| 23 | Ga0070662_100062886 | 3300005457 | Bacteria | 2713 |
| 24 | Ga0068853_100189871 | 3300005539 | Bacteria | 1866 |
| 25 | Ga0068855_100016003 | 3300005563 | Bacteria | 9022 |
| 26 | Ga0068857_100004712 | 3300005577 | Bacteria | 11557 |
| 27 | Ga0068857_100184821 | 3300005577 | Bacteria | 1897 |
| 28 | Ga0068854_100000218 | 3300005578 | Bacteria | 38701 |
| 29 | Ga0068854_100094861 | 3300005578 | Bacteria | 2226 |
| 30 | Ga0068852_101018079 | 3300005616 | Bacteria | 847 |
| 31 | Ga0068859_100004053 | 3300005617 | Bacteria | 14939 |
| 32 | Ga0068864_100000079 | 3300005618 | Bacteria | 102835 |
| 33 | Ga0068851_10003047 | 3300005834 | Bacteria | 7410 |
| 34 | Ga0068858_100517819 | 3300005842 | Bacteria | 1153 |
| 35 | Ga0068860_100641686 | 3300005843 | Bacteria | 1069 |
| 36 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 37 | Ga0070717_10026358 | 3300006028 | Bacteria | 4635 |
| 38 | Ga0075365_10027770 | 3300006038 | Bacteria | 3604 |
| 39 | Ga0070715_10230463 | 3300006163 | Bacteria | 957 |
| 40 | Ga0070716_100009352 | 3300006173 | Bacteria | 4882 |
| 41 | Ga0070712_100055195 | 3300006175 | Bacteria | 2781 |
| 42 | Ga0075369_10109127 | 3300006186 | Bacteria | 1246 |
| 43 | Ga0075366_10125100 | 3300006195 | Bacteria | 1550 |
| 44 | Ga0075428_100052004 | 3300006844 | Bacteria | 4492 |
| 45 | Ga0075431_100364447 | 3300006847 | Unclassified | 1451 |
| 46 | Ga0097620_100004053 | 3300006931 | Bacteria | 14939 |
| 47 | Ga0105240_10019848 | 3300009093 | Bacteria | 8977 |
| 48 | Ga0105240_10183270 | 3300009093 | Bacteria | 2469 |
| 49 | Ga0105240_10195995 | 3300009093 | Bacteria | 2372 |
| 50 | Ga0105240_10254037 | 3300009093 | Bacteria | 2031 |
| 51 | Ga0105240_10699162 | 3300009093 | Bacteria | 1107 |
| 52 | Ga0105248_10000620 | 3300009177 | Bacteria | 40460 |
| 53 | Ga0105248_10039014 | 3300009177 | Bacteria | 5317 |
| 54 | Ga0105248_10060657 | 3300009177 | Bacteria | 4247 |
| 55 | Ga0105248_10142690 | 3300009177 | Bacteria | 2702 |
| 56 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 57 | Ga0105239_10135014 | 3300010375 | Bacteria | 2747 |
| 58 | Ga0157326_1000037 | 3300012513 | Bacteria | 11556 |
| 59 | Ga0157373_10333805 | 3300013100 | Bacteria | 1080 |
| 60 | Ga0157371_10165226 | 3300013102 | Bacteria | 1581 |
| 61 | Ga0157369_10367677 | 3300013105 | Bacteria | 1493 |
| 62 | Ga0157372_10346407 | 3300013307 | Bacteria | 1731 |
| 63 | Ga0163163_10020871 | 3300014325 | Bacteria | 6176 |
| 64 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 65 | Ga0163161_10134788 | 3300017792 | Bacteria | 1866 |
| 66 | Ga0209258_101981 | 3300025242 | Bacteria | 5945 |
| 67 | Ga0209675_1017258 | 3300025291 | Bacteria | 2067 |
| 68 | Ga0209676_1006583 | 3300025292 | Bacteria | 5693 |
| 69 | Ga0209564_1004510 | 3300025295 | Bacteria | 8475 |
| 70 | Ga0209758_1001512 | 3300025297 | Bacteria | 26996 |
| 71 | Ga0209758_1002311 | 3300025297 | Bacteria | 19712 |
| 72 | Ga0207656_10044863 | 3300025321 | Bacteria | 1889 |
| 73 | Ga0207692_10001677 | 3300025898 | Bacteria | 8373 |
| 74 | Ga0207647_10044398 | 3300025904 | Bacteria | 2777 |
| 75 | Ga0207654_10116353 | 3300025911 | Bacteria | 1671 |
| 76 | Ga0207695_10000322 | 3300025913 | Bacteria | 114700 |
| 77 | Ga0207695_10005321 | 3300025913 | Bacteria | 17138 |
| 78 | Ga0207695_10021909 | 3300025913 | Bacteria | 7273 |
| 79 | Ga0207695_10027120 | 3300025913 | Bacteria | 6380 |
| 80 | Ga0207693_10000982 | 3300025915 | Bacteria | 25565 |
| 81 | Ga0207663_10000310 | 3300025916 | Bacteria | 21232 |
| 82 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 83 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 84 | Ga0207700_10064164 | 3300025928 | Bacteria | 2796 |
| 85 | Ga0207664_10014356 | 3300025929 | Bacteria | 5717 |
| 86 | Ga0207665_10007935 | 3300025939 | Bacteria | 7011 |
| 87 | Ga0207711_10000297 | 3300025941 | Bacteria | 53217 |
| 88 | Ga0207711_10022192 | 3300025941 | Bacteria | 5308 |
| 89 | Ga0207711_10093273 | 3300025941 | Bacteria | 2652 |
| 90 | Ga0207667_10000344 | 3300025949 | Bacteria | 63681 |
| 91 | Ga0207640_10002077 | 3300025981 | Bacteria | 10785 |
| 92 | Ga0207640_10009561 | 3300025981 | Bacteria | 5433 |
| 93 | Ga0207658_10003316 | 3300025986 | Bacteria | 11429 |
| 94 | Ga0207703_10130858 | 3300026035 | Bacteria | 2167 |
| 95 | Ga0207639_10118249 | 3300026041 | Bacteria | 2173 |
| 96 | Ga0207678_10044754 | 3300026067 | Bacteria | 3828 |
| 97 | Ga0207676_10000071 | 3300026095 | Bacteria | 104095 |
| 98 | Ga0207674_10083258 | 3300026116 | Bacteria | 3199 |
| 99 | Ga0207674_10185143 | 3300026116 | Bacteria | 2033 |
| 100 | Ga0207675_100001970 | 3300026118 | Bacteria | 20462 |
| 101 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 102 | Ga0265318_10052001 | 3300028577 | Bacteria | 1538 |
| 103 | Ga0307515_10213269 | 3300028794 | Bacteria | 1769 |
| 104 | Ga0265760_10038589 | 3300031090 | Bacteria | 1420 |
| 105 | Ga0265330_10012787 | 3300031235 | Bacteria | 3917 |
| 106 | Ga0265328_10062328 | 3300031239 | Bacteria | 1369 |
| 107 | Ga0265320_10006218 | 3300031240 | Bacteria | 7546 |
| 108 | Ga0265340_10004964 | 3300031247 | Bacteria | 7395 |
| 109 | Ga0265316_10192044 | 3300031344 | Bacteria | 1516 |
| 110 | Ga0307513_10251217 | 3300031456 | Bacteria | 1565 |
| 111 | Ga0265313_10045327 | 3300031595 | Bacteria | 2141 |
| 112 | Ga0265313_10071902 | 3300031595 | Bacteria | 1591 |
| 113 | Ga0316575_10041537 | 3300031665 | Bacteria | 1819 |
| 114 | Ga0265314_10219713 | 3300031711 | Bacteria | 1110 |
| 115 | Ga0307412_10257774 | 3300031911 | Bacteria | 1358 |
| 116 | Ga0373934_0052630 | 3300035086 | Bacteria | 1615 |
| 117 | Ga0373953_0029031 | 3300035117 | Bacteria | 2137 |
| 118 | Ga0373954_0021698 | 3300035118 | Bacteria | 2908 |
| 119 | Ga0373956_0124426 | 3300035119 | Bacteria | 1205 |
| 120 | Ga0373955_0180461 | 3300035172 | Bacteria | 1252 |
| 121 | Ga0316574_0219306 | 3300035398 | Bacteria | 1219 |
| 122 | Ga0316574_0378321 | 3300035398 | Unclassified | 894 |
| 123 | Ga0373935_0537078 | 3300035692 | Bacteria | 851 |
| 124 | Ga0373937_0453011 | 3300036401 | Bacteria | 1218 |
| 125 | Ga0451793_0852106 | 3300041452 | Bacteria | 2074 |
| 126 | Ga0439459_0000632 | 3300042438 | Bacteria | 4759 |
| 127 | Ga0466982_0000007 | 3300044672 | Bacteria | 250854 |
| 128 | Ga0466964_0001144 | 3300044706 | Bacteria | 8954 |
| 129 | Ga0466971_0001520 | 3300044719 | Bacteria | 9782 |
| 130 | Ga0466968_0002636 | 3300044735 | Bacteria | 6602 |
| 131 | Ga0466970_0408239 | 3300044765 | Bacteria | 775 |
| 132 | Ga0466960_0003797 | 3300044901 | Bacteria | 5853 |
| 133 | Ga0466960_0049907 | 3300044901 | Bacteria | 2016 |
| 134 | Ga0451576_0816574 | 3300045051 | Bacteria | 979 |
| 135 | Ga0495592_0227519 | 3300046454 | Bacteria | 1243 |
| 136 | Ga0495629_0049462 | 3300046459 | Bacteria | 2946 |
| 137 | Ga0495638_0000090 | 3300046460 | Bacteria | 148040 |
| 138 | Ga0495638_0009094 | 3300046460 | Bacteria | 6993 |
| 139 | Ga0495638_0009641 | 3300046460 | Bacteria | 6753 |
| 140 | Ga0495653_0311001 | 3300046463 | Bacteria | 1024 |
| 141 | Ga0495584_0021730 | 3300046491 | Bacteria | 3259 |
| 142 | Ga0495607_0068010 | 3300046501 | Bacteria | 1999 |
| 143 | Ga0495606_0140725 | 3300046507 | Bacteria | 1425 |
| 144 | Ga0495606_0263120 | 3300046507 | Bacteria | 951 |
| 145 | Ga0495608_0256467 | 3300046511 | Bacteria | 1089 |
| 146 | Ga0495616_0050317 | 3300046513 | Bacteria | 2084 |
| 147 | Ga0495618_0159300 | 3300046514 | Bacteria | 1439 |
| 148 | Ga0495620_0026172 | 3300046515 | Bacteria | 2746 |
| 149 | Ga0495620_0154650 | 3300046515 | Bacteria | 893 |
| 150 | Ga0495630_0048759 | 3300046517 | Bacteria | 3170 |
| 151 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 152 | Ga0495632_0073449 | 3300046519 | Bacteria | 1640 |
| 153 | Ga0495637_0000809 | 3300046520 | Bacteria | 20718 |
| 154 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 155 | Ga0495648_0006938 | 3300046524 | Bacteria | 9133 |
| 156 | Ga0495648_0025933 | 3300046524 | Bacteria | 3957 |
| 157 | Ga0495648_0133904 | 3300046524 | Bacteria | 1314 |
| 158 | Ga0495648_0225249 | 3300046524 | Bacteria | 922 |
| 159 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 160 | Ga0495652_0222270 | 3300046529 | Bacteria | 1418 |
| 161 | Ga0495654_0025978 | 3300046530 | Bacteria | 3015 |
| 162 | Ga0495586_0108782 | 3300046535 | Bacteria | 1542 |
| 163 | Ga0495587_0201818 | 3300046536 | Bacteria | 1124 |
| 164 | Ga0495645_0062148 | 3300046543 | Bacteria | 2705 |
| 165 | Ga0495622_0026821 | 3300046557 | Bacteria | 2689 |
| 166 | Ga0495633_0000053 | 3300046558 | Bacteria | 152374 |
| 167 | Ga0495633_0000160 | 3300046558 | Bacteria | 88116 |
| 168 | Ga0495634_0076464 | 3300046642 | Bacteria | 2197 |
| 169 | Ga0495661_0005736 | 3300046665 | Bacteria | 8791 |
| 170 | Ga0495588_0082302 | 3300046674 | Bacteria | 1681 |
| 171 | Ga0495657_0254884 | 3300046675 | Bacteria | 1055 |
| 172 | Ga0495599_0037857 | 3300046678 | Bacteria | 3030 |
| 173 | Ga0495670_0009580 | 3300046691 | Bacteria | 4758 |
| 174 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 175 | Ga0495600_0095752 | 3300046809 | Bacteria | 1935 |
| 176 | Ga0495660_0189555 | 3300046810 | Bacteria | 989 |
| 177 | Ga0495604_0772399 | 3300047317 | Bacteria | 607 |
| 178 | Ga0495674_0070907 | 3300047319 | Bacteria | 3010 |
| 179 | Ga0495672_0117226 | 3300047320 | Bacteria | 1421 |
| 180 | Ga0495680_0117356 | 3300047322 | Bacteria | 1967 |
| 181 | Ga0495673_0079008 | 3300047469 | Bacteria | 1366 |
| 182 | Ga0495681_0002650 | 3300047470 | Bacteria | 12688 |
| 183 | Ga0495681_0114624 | 3300047470 | Bacteria | 1163 |
| 184 | Ga0495684_0036355 | 3300047471 | Bacteria | 3776 |
| 185 | Ga0495684_0606694 | 3300047471 | Bacteria | 738 |
| 186 | Ga0495686_0012360 | 3300047472 | Bacteria | 5975 |
| 187 | Ga0495626_0095829 | 3300048091 | Bacteria | 1299 |
| 188 | Ga0496100_0035139 | 3300048903 | Bacteria | 3151 |
| 189 | Ga0496101_0047558 | 3300048904 | Bacteria | 3080 |
| 190 | Ga0496102_0427036 | 3300048905 | Bacteria | 1245 |
| 191 | Ga0496105_0001744 | 3300048908 | Bacteria | 15551 |
| 192 | Ga0496106_0000034 | 3300048909 | Bacteria | 130368 |
| 193 | Ga0496106_0184891 | 3300048909 | Bacteria | 1655 |
| 194 | Ga0496115_0061497 | 3300048918 | Bacteria | 3027 |
| 195 | Ga0496116_0002501 | 3300048919 | Bacteria | 19243 |
| 196 | Ga0496116_0024416 | 3300048919 | Bacteria | 4472 |
| 197 | Ga0496116_0188500 | 3300048919 | Bacteria | 1095 |
| 198 | Ga0496117_0040887 | 3300048920 | Bacteria | 3404 |
| 199 | Ga0496117_0102882 | 3300048920 | Bacteria | 1801 |
| 200 | Ga0496117_0105119 | 3300048920 | Bacteria | 1775 |
| 201 | Ga0496117_0190091 | 3300048920 | Bacteria | 1170 |
| 202 | Ga0496118_0029916 | 3300048921 | Bacteria | 4557 |
| 203 | Ga0496118_0032086 | 3300048921 | Bacteria | 4337 |
| 204 | Ga0496118_0041772 | 3300048921 | Bacteria | 3626 |
| 205 | Ga0496118_0050225 | 3300048921 | Bacteria | 3203 |
| 206 | Ga0496118_0197234 | 3300048921 | Bacteria | 1197 |
| 207 | Ga0496118_0290497 | 3300048921 | Bacteria | 904 |
| 208 | Ga0496119_0000113 | 3300048922 | Bacteria | 114626 |
| 209 | Ga0496119_0040222 | 3300048922 | Bacteria | 2993 |
| 210 | Ga0496119_0119010 | 3300048922 | Bacteria | 1455 |
| 211 | Ga0496120_0000450 | 3300048923 | Bacteria | 65290 |
| 212 | Ga0496120_0022211 | 3300048923 | Bacteria | 3994 |
| 213 | Ga0496120_0063746 | 3300048923 | Bacteria | 2049 |
| 214 | Ga0496121_0000754 | 3300048924 | Bacteria | 59457 |
| 215 | Ga0496121_0008874 | 3300048924 | Bacteria | 11691 |
| 216 | Ga0496121_0009082 | 3300048924 | Bacteria | 11508 |
| 217 | Ga0496121_0015428 | 3300048924 | Bacteria | 8008 |
| 218 | Ga0496121_0036583 | 3300048924 | Bacteria | 4373 |
| 219 | Ga0496121_0151705 | 3300048924 | Bacteria | 1704 |
| 220 | Ga0496121_0205185 | 3300048924 | Bacteria | 1401 |
| 221 | Ga0496122_0021346 | 3300048925 | Bacteria | 5800 |
| 222 | Ga0496122_0047309 | 3300048925 | Bacteria | 3322 |
| 223 | Ga0496122_0110492 | 3300048925 | Bacteria | 1806 |
| 224 | Ga0496123_0114165 | 3300048926 | Bacteria | 1536 |
| 225 | Ga0496124_0068935 | 3300048927 | Bacteria | 2938 |
| 226 | Ga0496124_0125175 | 3300048927 | Bacteria | 2048 |
| 227 | Ga0496124_0223292 | 3300048927 | Bacteria | 1415 |
| 228 | Ga0496124_0493667 | 3300048927 | Bacteria | 823 |
| 229 | Ga0496125_0000406 | 3300048928 | Bacteria | 80645 |
| 230 | Ga0496125_0000516 | 3300048928 | Bacteria | 67232 |
| 231 | Ga0496125_0009348 | 3300048928 | Bacteria | 10099 |
| 232 | Ga0496125_0016585 | 3300048928 | Bacteria | 7065 |
| 233 | Ga0496125_0201544 | 3300048928 | Bacteria | 1302 |
| 234 | Ga0496126_0000160 | 3300048929 | Bacteria | 155144 |
| 235 | Ga0496126_0000389 | 3300048929 | Bacteria | 90452 |
| 236 | Ga0496126_0035911 | 3300048929 | Bacteria | 4639 |
| 237 | Ga0496126_0056073 | 3300048929 | Bacteria | 3563 |
| 238 | Ga0496126_0060819 | 3300048929 | Bacteria | 3396 |
| 239 | Ga0496126_0194109 | 3300048929 | Bacteria | 1718 |
| 240 | Ga0496126_0403931 | 3300048929 | Bacteria | 1107 |
| 241 | Ga0496126_0409689 | 3300048929 | Bacteria | 1098 |
| 242 | Ga0496126_0650579 | 3300048929 | Bacteria | 825 |
| 243 | Ga0501036_0309122 | 3300049572 | Bacteria | 1322 |
| 244 | Ga0501043_0012219 | 3300049579 | Bacteria | 6712 |
| 245 | Ga0501046_0149780 | 3300049580 | Bacteria | 1761 |
| 246 | Ga0501047_0011851 | 3300049581 | Bacteria | 8246 |
| 247 | Ga0501047_0095668 | 3300049581 | Bacteria | 2849 |
| 248 | Ga0501074_0250368 | 3300049590 | Bacteria | 1260 |
| 249 | Ga0501208_017525 | 3300049655 | Bacteria | 1130 |
| 250 | Ga0501249_000212 | 3300049679 | Bacteria | 17798 |
| 251 | Ga0501035_0090295 | 3300049822 | Bacteria | 2697 |
| 252 | Ga0501035_0092550 | 3300049822 | Bacteria | 2660 |
| 253 | Ga0501035_0327421 | 3300049822 | Bacteria | 1286 |
| 254 | Ga0501044_0316406 | 3300049823 | Bacteria | 1486 |
| 255 | Ga0501044_0410362 | 3300049823 | Bacteria | 1266 |
| 256 | nmdc:mga0yw44_191561_c1 | 3300050492 | Bacteria | 1349 |
| 257 | nmdc:mga0yw44_54513_c1 | 3300050492 | Bacteria | 2430 |
| 258 | nmdc:mga0k408_31347_c1 | 3300050493 | Bacteria | 3035 |
| 259 | nmdc:mga06r32_144485_c1 | 3300050510 | Bacteria | 2356 |
| 260 | nmdc:mga0sz30_70782_c1 | 3300050516 | Bacteria | 1501 |
| 261 | Ga0495601_0066444 | 3300053077 | Bacteria | 2295 |
| 262 | Ga0495612_0025945 | 3300053078 | Bacteria | 2354 |
| 263 | Ga0495595_0269041 | 3300053084 | Bacteria | 854 |
| 264 | Ga0500644_0062359 | 3300053088 | Bacteria | 1317 |
| 265 | Ga0500646_0006392 | 3300053090 | Bacteria | 2997 |
| 266 | Ga0500646_0168314 | 3300053090 | Bacteria | 736 |
| 267 | Ga0500651_0019614 | 3300053093 | Bacteria | 4203 |
| 268 | Ga0500651_0037570 | 3300053093 | Bacteria | 3052 |
| 269 | Ga0500651_0100217 | 3300053093 | Bacteria | 1776 |
| 270 | Ga0500566_0013145 | 3300053094 | Bacteria | 4876 |
| 271 | Ga0500641_0007449 | 3300053096 | Bacteria | 3904 |
| 272 | Ga0500650_0056633 | 3300053098 | Bacteria | 1826 |
| 273 | Ga0500650_0078375 | 3300053098 | Bacteria | 1545 |
| 274 | Ga0500556_0000016 | 3300053104 | Bacteria | 194958 |
| 275 | Ga0500569_074651 | 3300053109 | Bacteria | 1073 |
| 276 | Ga0500592_009470 | 3300053116 | Bacteria | 1549 |
| 277 | Ga0500595_044095 | 3300053119 | Bacteria | 1415 |
| 278 | Ga0500608_000117 | 3300053122 | Bacteria | 32871 |
| 279 | Ga0500618_002694 | 3300053125 | Bacteria | 6490 |
| 280 | Ga0500642_0000201 | 3300053130 | Bacteria | 24478 |
| 281 | Ga0500642_0139925 | 3300053130 | Bacteria | 1135 |
| 282 | Ga0500652_000225 | 3300053131 | Bacteria | 21717 |
| 283 | Ga0500658_0101442 | 3300053134 | Bacteria | 1256 |
| 284 | Ga0500559_0000161 | 3300053136 | Bacteria | 53055 |
| 285 | Ga0500568_0002573 | 3300053139 | Bacteria | 10565 |
| 286 | Ga0500577_0004191 | 3300053142 | Bacteria | 3793 |
| 287 | Ga0500577_0201034 | 3300053142 | Bacteria | 860 |
| 288 | Ga0500586_002014 | 3300053145 | Bacteria | 4465 |
| 289 | Ga0500616_0000169 | 3300053153 | Bacteria | 109205 |
| 290 | Ga0500636_0002058 | 3300053177 | Bacteria | 11095 |
| 291 | Ga0500636_0043148 | 3300053177 | Bacteria | 2663 |
| 292 | Ga0500567_059938 | 3300053723 | Bacteria | 1708 |
| 293 | Ga0500611_022942 | 3300053727 | Bacteria | 1210 |
| 294 | Ga0500645_021313 | 3300053730 | Bacteria | 2001 |
| 295 | Ga0466962_0001170 | 3300061719 | Bacteria | 12074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10121225 | rootL2_101212255 | 186 |
| 2 | 3300047317 | Ga0495604_0772399 | Ga0495604_0772399_13_576 | 186 |
| 3 | 3300048922 | Ga0496119_0119010 | Ga0496119_0119010_10_573 | 186 |
| 4 | 3300053125 | Ga0500618_002694 | Ga0500618_002694_3463_4026 | 186 |
| 5 | 3300053084 | Ga0495595_0269041 | Ga0495595_0269041_32_610 | 191 |
| 6 | 3300017792 | Ga0163161_10134788 | Ga0163161_101347882 | 196 |
| 7 | 3300046491 | Ga0495584_0021730 | Ga0495584_0021730_2636_3229 | 197 |
| 8 | 3300046515 | Ga0495620_0154650 | Ga0495620_0154650_21_617 | 197 |
| 9 | 3300048920 | Ga0496117_0105119 | Ga0496117_0105119_503_1105 | 200 |
| 10 | 3300048921 | Ga0496118_0050225 | Ga0496118_0050225_694_1296 | 200 |
| 11 | 3300048927 | Ga0496124_0125175 | Ga0496124_0125175_1076_1678 | 200 |
| 12 | 3300048929 | Ga0496126_0194109 | Ga0496126_0194109_764_1366 | 200 |
| 13 | 3300048920 | Ga0496117_0040887 | Ga0496117_0040887_181_813 | 205 |
| 14 | 3300013100 | Ga0157373_10333805 | Ga0157373_103338051 | 206 |
| 15 | 3300013307 | Ga0157372_10346407 | Ga0157372_103464072 | 206 |
| 16 | 3300003781 | Ga0055536_1019857 | Ga0055536_10198572 | 208 |
| 17 | 3300013102 | Ga0157371_10165226 | Ga0157371_101652262 | 208 |
| 18 | 3300025291 | Ga0209675_1017258 | Ga0209675_10172582 | 208 |
| 19 | 3300025292 | Ga0209676_1006583 | Ga0209676_10065832 | 208 |
| 20 | iso_pu_bacteria | 2643221541 | 2643726999 | 208 |
| 21 | iso_pu_bacteria | 2643221605 | 2644040469 | 208 |
| 22 | iso_pu_bacteria | 2643221606 | 2644045960 | 208 |
| 23 | iso_pu_bacteria | 2643221671 | 2644393229 | 208 |
| 24 | 3300005436 | Ga0070713_100062781 | Ga0070713_1000627812 | 209 |
| 25 | 3300005437 | Ga0070710_10054929 | Ga0070710_100549291 | 209 |
| 26 | 3300006028 | Ga0070717_10026358 | Ga0070717_100263582 | 209 |
| 27 | 3300006163 | Ga0070715_10230463 | Ga0070715_102304632 | 209 |
| 28 | 3300006173 | Ga0070716_100009352 | Ga0070716_1000093526 | 209 |
| 29 | 3300006175 | Ga0070712_100055195 | Ga0070712_1000551953 | 209 |
| 30 | 3300025898 | Ga0207692_10001677 | Ga0207692_100016777 | 209 |
| 31 | 3300025915 | Ga0207693_10000982 | Ga0207693_100009823 | 209 |
| 32 | 3300025916 | Ga0207663_10000310 | Ga0207663_1000031015 | 209 |
| 33 | 3300025928 | Ga0207700_10064164 | Ga0207700_100641641 | 209 |
| 34 | 3300025929 | Ga0207664_10014356 | Ga0207664_100143565 | 209 |
| 35 | 3300025939 | Ga0207665_10007935 | Ga0207665_100079354 | 209 |
| 36 | 3300031090 | Ga0265760_10038589 | Ga0265760_100385892 | 209 |
| 37 | 3300031235 | Ga0265330_10012787 | Ga0265330_100127871 | 209 |
| 38 | 3300031239 | Ga0265328_10062328 | Ga0265328_100623282 | 209 |
| 39 | 3300031247 | Ga0265340_10004964 | Ga0265340_100049644 | 209 |
| 40 | 3300031344 | Ga0265316_10192044 | Ga0265316_101920441 | 209 |
| 41 | 3300031711 | Ga0265314_10219713 | Ga0265314_102197131 | 209 |
| 42 | 3300035086 | Ga0373934_0052630 | Ga0373934_0052630_73_705 | 209 |
| 43 | 3300035117 | Ga0373953_0029031 | Ga0373953_0029031_426_1058 | 209 |
| 44 | 3300035118 | Ga0373954_0021698 | Ga0373954_0021698_2076_2708 | 209 |
| 45 | 3300035119 | Ga0373956_0124426 | Ga0373956_0124426_200_832 | 209 |
| 46 | 3300035172 | Ga0373955_0180461 | Ga0373955_0180461_358_990 | 209 |
| 47 | 3300035692 | Ga0373935_0537078 | Ga0373935_0537078_53_685 | 209 |
| 48 | 3300036401 | Ga0373937_0453011 | Ga0373937_0453011_537_1169 | 209 |
| 49 | 3300046454 | Ga0495592_0227519 | Ga0495592_0227519_259_891 | 209 |
| 50 | 3300046459 | Ga0495629_0049462 | Ga0495629_0049462_591_1223 | 209 |
| 51 | 3300046463 | Ga0495653_0311001 | Ga0495653_0311001_256_888 | 209 |
| 52 | 3300046511 | Ga0495608_0256467 | Ga0495608_0256467_65_697 | 209 |
| 53 | 3300046514 | Ga0495618_0159300 | Ga0495618_0159300_610_1242 | 209 |
| 54 | 3300046517 | Ga0495630_0048759 | Ga0495630_0048759_1065_1697 | 209 |
| 55 | 3300046529 | Ga0495652_0222270 | Ga0495652_0222270_432_1064 | 209 |
| 56 | 3300046535 | Ga0495586_0108782 | Ga0495586_0108782_644_1276 | 209 |
| 57 | 3300046536 | Ga0495587_0201818 | Ga0495587_0201818_358_990 | 209 |
| 58 | 3300046543 | Ga0495645_0062148 | Ga0495645_0062148_1246_1878 | 209 |
| 59 | 3300046642 | Ga0495634_0076464 | Ga0495634_0076464_359_991 | 209 |
| 60 | 3300046675 | Ga0495657_0254884 | Ga0495657_0254884_393_1025 | 209 |
| 61 | 3300046678 | Ga0495599_0037857 | Ga0495599_0037857_1689_2321 | 209 |
| 62 | 3300046809 | Ga0495600_0095752 | Ga0495600_0095752_630_1262 | 209 |
| 63 | 3300047319 | Ga0495674_0070907 | Ga0495674_0070907_50_682 | 209 |
| 64 | 3300047322 | Ga0495680_0117356 | Ga0495680_0117356_745_1377 | 209 |
| 65 | 3300047471 | Ga0495684_0036355 | Ga0495684_0036355_432_1064 | 209 |
| 66 | 3300053077 | Ga0495601_0066444 | Ga0495601_0066444_1407_2039 | 209 |
| 67 | 3300053078 | Ga0495612_0025945 | Ga0495612_0025945_537_1169 | 209 |
| 68 | iso_pu_bacteria | 2926754445 | 2926760251 | 210 |
| 69 | 3300002076 | JGI24749J21850_1000187 | JGI24749J21850_100018711 | 212 |
| 70 | 3300002459 | JGI24751J29686_10000112 | JGI24751J29686_1000011219 | 212 |
| 71 | 3300005295 | Ga0065707_10084576 | Ga0065707_100845766 | 212 |
| 72 | 3300005331 | Ga0070670_100000069 | Ga0070670_10000006980 | 212 |
| 73 | 3300005353 | Ga0070669_100000105 | Ga0070669_10000010565 | 212 |
| 74 | 3300005367 | Ga0070667_100005699 | Ga0070667_1000056993 | 212 |
| 75 | 3300005539 | Ga0068853_100189871 | Ga0068853_1001898713 | 212 |
| 76 | 3300005577 | Ga0068857_100184821 | Ga0068857_1001848212 | 212 |
| 77 | 3300005578 | Ga0068854_100094861 | Ga0068854_1000948611 | 212 |
| 78 | 3300005616 | Ga0068852_101018079 | Ga0068852_1010180791 | 212 |
| 79 | 3300005617 | Ga0068859_100004053 | Ga0068859_10000405313 | 212 |
| 80 | 3300005618 | Ga0068864_100000079 | Ga0068864_10000007981 | 212 |
| 81 | 3300005843 | Ga0068860_100641686 | Ga0068860_1006416861 | 212 |
| 82 | 3300005844 | Ga0068862_100000033 | Ga0068862_100000033157 | 212 |
| 83 | 3300006195 | Ga0075366_10125100 | Ga0075366_101251002 | 212 |
| 84 | 3300006931 | Ga0097620_100004053 | Ga0097620_1000040535 | 212 |
| 85 | 3300009093 | Ga0105240_10195995 | Ga0105240_101959952 | 212 |
| 86 | 3300009177 | Ga0105248_10000620 | Ga0105248_1000062019 | 212 |
| 87 | 3300012513 | Ga0157326_1000037 | Ga0157326_100003710 | 212 |
| 88 | 3300014325 | Ga0163163_10020871 | Ga0163163_100208714 | 212 |
| 89 | 3300025923 | Ga0207681_10000014 | Ga0207681_1000001422 | 212 |
| 90 | 3300025925 | Ga0207650_10000015 | Ga0207650_1000001523 | 212 |
| 91 | 3300025941 | Ga0207711_10000297 | Ga0207711_1000029760 | 212 |
| 92 | 3300025981 | Ga0207640_10009561 | Ga0207640_100095612 | 212 |
| 93 | 3300025986 | Ga0207658_10003316 | Ga0207658_100033169 | 212 |
| 94 | 3300026041 | Ga0207639_10118249 | Ga0207639_101182493 | 212 |
| 95 | 3300026095 | Ga0207676_10000071 | Ga0207676_1000007180 | 212 |
| 96 | 3300026116 | Ga0207674_10185143 | Ga0207674_101851431 | 212 |
| 97 | 3300026118 | Ga0207675_100001970 | Ga0207675_10000197022 | 212 |
| 98 | 3300028380 | Ga0268265_10000013 | Ga0268265_10000013327 | 212 |
| 99 | 3300049572 | Ga0501036_0309122 | Ga0501036_0309122_310_948 | 212 |
| 100 | 3300049579 | Ga0501043_0012219 | Ga0501043_0012219_4834_5472 | 212 |
| 101 | 3300049581 | Ga0501047_0011851 | Ga0501047_0011851_6225_6863 | 212 |
| 102 | 3300049655 | Ga0501208_017525 | Ga0501208_017525_185_826 | 212 |
| 103 | 3300049679 | Ga0501249_000212 | Ga0501249_000212_2332_2973 | 212 |
| 104 | 3300049822 | Ga0501035_0090295 | Ga0501035_0090295_1043_1681 | 212 |
| 105 | 3300010375 | Ga0105239_10135014 | Ga0105239_101350142 | 213 |
| 106 | 3300042438 | Ga0439459_0000632 | Ga0439459_0000632_2585_3229 | 213 |
| 107 | 3300046460 | Ga0495638_0009094 | Ga0495638_0009094_5949_6638 | 213 |
| 108 | 3300048929 | Ga0496126_0060819 | Ga0496126_0060819_2555_3199 | 213 |
| 109 | 3300005842 | Ga0068858_100517819 | Ga0068858_1005178192 | 214 |
| 110 | 3300026035 | Ga0207703_10130858 | Ga0207703_101308582 | 214 |
| 111 | 3300028577 | Ga0265318_10052001 | Ga0265318_100520012 | 214 |
| 112 | 3300044901 | Ga0466960_0049907 | Ga0466960_0049907_392_1060 | 214 |
| 113 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_365455_366099 | 214 |
| 114 | 3300046520 | Ga0495637_0000809 | Ga0495637_0000809_12800_13444 | 214 |
| 115 | 3300046522 | Ga0495643_0000006 | Ga0495643_0000006_55615_56259 | 214 |
| 116 | 3300046524 | Ga0495648_0133904 | Ga0495648_0133904_423_1067 | 214 |
| 117 | 3300046525 | Ga0495663_0000002 | Ga0495663_0000002_363785_364429 | 214 |
| 118 | 3300046558 | Ga0495633_0000053 | Ga0495633_0000053_40737_41381 | 214 |
| 119 | 3300046558 | Ga0495633_0000160 | Ga0495633_0000160_73356_74000 | 214 |
| 120 | 3300046692 | Ga0495671_0000008 | Ga0495671_0000008_55615_56259 | 214 |
| 121 | 3300047470 | Ga0495681_0002650 | Ga0495681_0002650_6354_6998 | 214 |
| 122 | 3300047472 | Ga0495686_0012360 | Ga0495686_0012360_889_1533 | 214 |
| 123 | 3300049581 | Ga0501047_0095668 | Ga0501047_0095668_1605_2249 | 214 |
| 124 | 3300049590 | Ga0501074_0250368 | Ga0501074_0250368_373_1017 | 214 |
| 125 | iso_pu_bacteria | 2602042107 | 2603858289 | 214 |
| 126 | iso_pu_bacteria | 2857524615 | 2857527709 | 214 |
| 127 | iso_pu_bacteria | 2893066018 | 2893067140 | 214 |
| 128 | iso_pu_bacteria | 2919073203 | 2919073570 | 214 |
| 129 | 3300031240 | Ga0265320_10006218 | Ga0265320_100062185 | 215 |
| 130 | 3300031595 | Ga0265313_10071902 | Ga0265313_100719022 | 215 |
| 131 | 3300041452 | Ga0451793_0852106 | Ga0451793_0852106_1374_2024 | 215 |
| 132 | 3300046460 | Ga0495638_0000090 | Ga0495638_0000090_112998_113648 | 215 |
| 133 | 3300006844 | Ga0075428_100052004 | Ga0075428_1000520043 | 216 |
| 134 | 3300006847 | Ga0075431_100364447 | Ga0075431_1003644472 | 216 |
| 135 | 3300009177 | Ga0105248_10039014 | Ga0105248_100390142 | 216 |
| 136 | 3300025297 | Ga0209758_1001512 | Ga0209758_100151222 | 216 |
| 137 | 3300025941 | Ga0207711_10022192 | Ga0207711_100221925 | 216 |
| 138 | 3300031456 | Ga0307513_10251217 | Ga0307513_102512171 | 216 |
| 139 | 3300031595 | Ga0265313_10045327 | Ga0265313_100453272 | 216 |
| 140 | 3300035398 | Ga0316574_0378321 | Ga0316574_0378321_177_854 | 216 |
| 141 | 3300046524 | Ga0495648_0225249 | Ga0495648_0225249_174_827 | 216 |
| 142 | 3300047469 | Ga0495673_0079008 | Ga0495673_0079008_291_944 | 216 |
| 143 | 3300047471 | Ga0495684_0606694 | Ga0495684_0606694_68_721 | 216 |
| 144 | 3300048921 | Ga0496118_0041772 | Ga0496118_0041772_1582_2235 | 216 |
| 145 | 3300048921 | Ga0496118_0197234 | Ga0496118_0197234_325_978 | 216 |
| 146 | 3300048924 | Ga0496121_0000754 | Ga0496121_0000754_4753_5406 | 216 |
| 147 | 3300048927 | Ga0496124_0493667 | Ga0496124_0493667_98_751 | 216 |
| 148 | 3300050493 | nmdc:mga0k408_31347_c1 | nmdc:mga0k408_31347_c1_1462_2112 | 216 |
| 149 | 3300050510 | nmdc:mga06r32_144485_c1 | nmdc:mga06r32_144485_c1_132_782 | 216 |
| 150 | 3300053090 | Ga0500646_0168314 | Ga0500646_0168314_36_689 | 216 |
| 151 | 3300053093 | Ga0500651_0019614 | Ga0500651_0019614_3375_4028 | 216 |
| 152 | 3300053098 | Ga0500650_0078375 | Ga0500650_0078375_88_741 | 216 |
| 153 | 3300053119 | Ga0500595_044095 | Ga0500595_044095_579_1232 | 216 |
| 154 | 3300053130 | Ga0500642_0139925 | Ga0500642_0139925_125_778 | 216 |
| 155 | 3300053177 | Ga0500636_0043148 | Ga0500636_0043148_1481_2134 | 216 |
| 156 | 3300035398 | Ga0316574_0219306 | Ga0316574_0219306_56_712 | 217 |
| 157 | 3300045051 | Ga0451576_0816574 | Ga0451576_0816574_79_960 | 217 |
| 158 | 3300048921 | Ga0496118_0290497 | Ga0496118_0290497_136_795 | 217 |
| 159 | 3300048928 | Ga0496125_0201544 | Ga0496125_0201544_103_777 | 217 |
| 160 | 3300048929 | Ga0496126_0409689 | Ga0496126_0409689_190_852 | 217 |
| 161 | 3300005455 | Ga0070663_100056242 | Ga0070663_1000562421 | 218 |
| 162 | 3300006186 | Ga0075369_10109127 | Ga0075369_101091272 | 218 |
| 163 | 3300025295 | Ga0209564_1004510 | Ga0209564_10045104 | 218 |
| 164 | 3300026067 | Ga0207678_10044754 | Ga0207678_100447545 | 218 |
| 165 | 3300028794 | Ga0307515_10213269 | Ga0307515_102132692 | 218 |
| 166 | 3300031665 | Ga0316575_10041537 | Ga0316575_100415372 | 218 |
| 167 | 3300046501 | Ga0495607_0068010 | Ga0495607_0068010_1198_1863 | 218 |
| 168 | 3300046507 | Ga0495606_0263120 | Ga0495606_0263120_175_840 | 218 |
| 169 | 3300046513 | Ga0495616_0050317 | Ga0495616_0050317_222_887 | 218 |
| 170 | 3300046515 | Ga0495620_0026172 | Ga0495620_0026172_889_1554 | 218 |
| 171 | 3300046519 | Ga0495632_0073449 | Ga0495632_0073449_58_723 | 218 |
| 172 | 3300046524 | Ga0495648_0006938 | Ga0495648_0006938_40_705 | 218 |
| 173 | 3300046524 | Ga0495648_0025933 | Ga0495648_0025933_637_1302 | 218 |
| 174 | 3300046530 | Ga0495654_0025978 | Ga0495654_0025978_926_1591 | 218 |
| 175 | 3300046557 | Ga0495622_0026821 | Ga0495622_0026821_925_1590 | 218 |
| 176 | 3300046674 | Ga0495588_0082302 | Ga0495588_0082302_729_1394 | 218 |
| 177 | 3300046691 | Ga0495670_0009580 | Ga0495670_0009580_3100_3765 | 218 |
| 178 | 3300046810 | Ga0495660_0189555 | Ga0495660_0189555_46_711 | 218 |
| 179 | 3300047320 | Ga0495672_0117226 | Ga0495672_0117226_317_982 | 218 |
| 180 | 3300047470 | Ga0495681_0114624 | Ga0495681_0114624_273_938 | 218 |
| 181 | 3300048091 | Ga0495626_0095829 | Ga0495626_0095829_516_1181 | 218 |
| 182 | 3300048919 | Ga0496116_0002501 | Ga0496116_0002501_16292_16957 | 218 |
| 183 | 3300048920 | Ga0496117_0190091 | Ga0496117_0190091_28_693 | 218 |
| 184 | 3300048923 | Ga0496120_0063746 | Ga0496120_0063746_334_999 | 218 |
| 185 | 3300048924 | Ga0496121_0009082 | Ga0496121_0009082_1087_1752 | 218 |
| 186 | 3300048925 | Ga0496122_0047309 | Ga0496122_0047309_1331_1996 | 218 |
| 187 | 3300048925 | Ga0496122_0110492 | Ga0496122_0110492_712_1377 | 218 |
| 188 | 3300048927 | Ga0496124_0223292 | Ga0496124_0223292_737_1402 | 218 |
| 189 | 3300048928 | Ga0496125_0000406 | Ga0496125_0000406_38042_38707 | 218 |
| 190 | 3300048928 | Ga0496125_0000516 | Ga0496125_0000516_11449_12114 | 218 |
| 191 | 3300048928 | Ga0496125_0009348 | Ga0496125_0009348_7216_7881 | 218 |
| 192 | 3300048928 | Ga0496125_0016585 | Ga0496125_0016585_5967_6632 | 218 |
| 193 | 3300048929 | Ga0496126_0035911 | Ga0496126_0035911_1636_2301 | 218 |
| 194 | 3300048929 | Ga0496126_0403931 | Ga0496126_0403931_375_1040 | 218 |
| 195 | 3300050492 | nmdc:mga0yw44_191561_c1 | nmdc:mga0yw44_191561_c1_442_1107 | 218 |
| 196 | 3300050516 | nmdc:mga0sz30_70782_c1 | nmdc:mga0sz30_70782_c1_263_928 | 218 |
| 197 | 3300053088 | Ga0500644_0062359 | Ga0500644_0062359_200_865 | 218 |
| 198 | 3300053093 | Ga0500651_0100217 | Ga0500651_0100217_711_1376 | 218 |
| 199 | 3300053094 | Ga0500566_0013145 | Ga0500566_0013145_3358_4023 | 218 |
| 200 | 3300053096 | Ga0500641_0007449 | Ga0500641_0007449_622_1287 | 218 |
| 201 | 3300053098 | Ga0500650_0056633 | Ga0500650_0056633_525_1190 | 218 |
| 202 | 3300053104 | Ga0500556_0000016 | Ga0500556_0000016_171844_172509 | 218 |
| 203 | 3300053116 | Ga0500592_009470 | Ga0500592_009470_531_1196 | 218 |
| 204 | 3300053122 | Ga0500608_000117 | Ga0500608_000117_22457_23122 | 218 |
| 205 | 3300053130 | Ga0500642_0000201 | Ga0500642_0000201_2512_3177 | 218 |
| 206 | 3300053131 | Ga0500652_000225 | Ga0500652_000225_14795_15460 | 218 |
| 207 | 3300053134 | Ga0500658_0101442 | Ga0500658_0101442_228_893 | 218 |
| 208 | 3300053136 | Ga0500559_0000161 | Ga0500559_0000161_22505_23170 | 218 |
| 209 | 3300053139 | Ga0500568_0002573 | Ga0500568_0002573_9234_9899 | 218 |
| 210 | 3300053142 | Ga0500577_0004191 | Ga0500577_0004191_2611_3276 | 218 |
| 211 | 3300053142 | Ga0500577_0201034 | Ga0500577_0201034_58_723 | 218 |
| 212 | 3300053145 | Ga0500586_002014 | Ga0500586_002014_834_1595 | 218 |
| 213 | 3300053153 | Ga0500616_0000169 | Ga0500616_0000169_85905_86570 | 218 |
| 214 | 3300053177 | Ga0500636_0002058 | Ga0500636_0002058_385_1050 | 218 |
| 215 | 3300053723 | Ga0500567_059938 | Ga0500567_059938_57_818 | 218 |
| 216 | 3300053727 | Ga0500611_022942 | Ga0500611_022942_442_1107 | 218 |
| 217 | 3300053730 | Ga0500645_021313 | Ga0500645_021313_817_1482 | 218 |
| 218 | 3300003320 | rootH2_10036142 | rootH2_1003614210 | 219 |
| 219 | 3300003323 | rootH1_10104958 | rootH1_101049583 | 219 |
| 220 | 3300005577 | Ga0068857_100004712 | Ga0068857_1000047122 | 219 |
| 221 | 3300006038 | Ga0075365_10027770 | Ga0075365_100277703 | 219 |
| 222 | 3300009093 | Ga0105240_10183270 | Ga0105240_101832702 | 219 |
| 223 | 3300009093 | Ga0105240_10254037 | Ga0105240_102540372 | 219 |
| 224 | 3300009177 | Ga0105248_10060657 | Ga0105248_100606572 | 219 |
| 225 | 3300009177 | Ga0105248_10142690 | Ga0105248_101426902 | 219 |
| 226 | 3300010375 | Ga0105239_10000033 | Ga0105239_10000033146 | 219 |
| 227 | 3300025913 | Ga0207695_10000322 | Ga0207695_1000032247 | 219 |
| 228 | 3300025913 | Ga0207695_10005321 | Ga0207695_1000532116 | 219 |
| 229 | 3300025941 | Ga0207711_10093273 | Ga0207711_100932733 | 219 |
| 230 | 3300026116 | Ga0207674_10083258 | Ga0207674_100832582 | 219 |
| 231 | 3300031911 | Ga0307412_10257774 | Ga0307412_102577742 | 219 |
| 232 | 3300046460 | Ga0495638_0009641 | Ga0495638_0009641_2166_2843 | 219 |
| 233 | 3300046507 | Ga0495606_0140725 | Ga0495606_0140725_275_952 | 219 |
| 234 | 3300046665 | Ga0495661_0005736 | Ga0495661_0005736_1422_2099 | 219 |
| 235 | 3300048903 | Ga0496100_0035139 | Ga0496100_0035139_110_823 | 219 |
| 236 | 3300048904 | Ga0496101_0047558 | Ga0496101_0047558_70_783 | 219 |
| 237 | 3300048905 | Ga0496102_0427036 | Ga0496102_0427036_110_769 | 219 |
| 238 | 3300048908 | Ga0496105_0001744 | Ga0496105_0001744_14469_15128 | 219 |
| 239 | 3300048909 | Ga0496106_0000034 | Ga0496106_0000034_99064_99804 | 219 |
| 240 | 3300048909 | Ga0496106_0184891 | Ga0496106_0184891_973_1632 | 219 |
| 241 | 3300048918 | Ga0496115_0061497 | Ga0496115_0061497_2144_2857 | 219 |
| 242 | 3300048919 | Ga0496116_0024416 | Ga0496116_0024416_2816_3499 | 219 |
| 243 | 3300048919 | Ga0496116_0188500 | Ga0496116_0188500_282_962 | 219 |
| 244 | 3300048920 | Ga0496117_0102882 | Ga0496117_0102882_68_781 | 219 |
| 245 | 3300048921 | Ga0496118_0029916 | Ga0496118_0029916_225_884 | 219 |
| 246 | 3300048921 | Ga0496118_0032086 | Ga0496118_0032086_3402_4079 | 219 |
| 247 | 3300048922 | Ga0496119_0000113 | Ga0496119_0000113_83446_84105 | 219 |
| 248 | 3300048922 | Ga0496119_0040222 | Ga0496119_0040222_475_1143 | 219 |
| 249 | 3300048923 | Ga0496120_0000450 | Ga0496120_0000450_2013_2681 | 219 |
| 250 | 3300048923 | Ga0496120_0022211 | Ga0496120_0022211_2021_2680 | 219 |
| 251 | 3300048924 | Ga0496121_0008874 | Ga0496121_0008874_3043_3783 | 219 |
| 252 | 3300048924 | Ga0496121_0015428 | Ga0496121_0015428_7217_7876 | 219 |
| 253 | 3300048924 | Ga0496121_0036583 | Ga0496121_0036583_1235_1903 | 219 |
| 254 | 3300048924 | Ga0496121_0151705 | Ga0496121_0151705_20_679 | 219 |
| 255 | 3300048924 | Ga0496121_0205185 | Ga0496121_0205185_646_1314 | 219 |
| 256 | 3300048925 | Ga0496122_0021346 | Ga0496122_0021346_1471_2148 | 219 |
| 257 | 3300048926 | Ga0496123_0114165 | Ga0496123_0114165_599_1267 | 219 |
| 258 | 3300048927 | Ga0496124_0068935 | Ga0496124_0068935_44_721 | 219 |
| 259 | 3300048929 | Ga0496126_0000160 | Ga0496126_0000160_25173_25886 | 219 |
| 260 | 3300048929 | Ga0496126_0000389 | Ga0496126_0000389_65620_66297 | 219 |
| 261 | 3300048929 | Ga0496126_0056073 | Ga0496126_0056073_1978_2646 | 219 |
| 262 | 3300048929 | Ga0496126_0650579 | Ga0496126_0650579_36_719 | 219 |
| 263 | 3300050492 | nmdc:mga0yw44_54513_c1 | nmdc:mga0yw44_54513_c1_803_1480 | 219 |
| 264 | 3300053090 | Ga0500646_0006392 | Ga0500646_0006392_1664_2341 | 219 |
| 265 | 3300053093 | Ga0500651_0037570 | Ga0500651_0037570_726_1403 | 219 |
| 266 | 3300053109 | Ga0500569_074651 | Ga0500569_074651_280_957 | 219 |
| 267 | 3300002067 | JGI24735J21928_10001392 | JGI24735J21928_100013924 | 220 |
| 268 | 3300003756 | Ga0055533_1000762 | Ga0055533_10007628 | 220 |
| 269 | 3300025242 | Ga0209258_101981 | Ga0209258_1019814 | 220 |
| 270 | 3300001979 | JGI24740J21852_10001533 | JGI24740J21852_1000153311 | 221 |
| 271 | 3300001990 | JGI24737J22298_10002120 | JGI24737J22298_100021203 | 221 |
| 272 | 3300003320 | rootH2_10011232 | rootH2_100112322 | 221 |
| 273 | 3300003322 | rootL2_10212375 | rootL2_102123752 | 221 |
| 274 | 3300003578 | Ga0006562J51391_1001475 | Ga0006562J51391_10014754 | 221 |
| 275 | 3300003578 | Ga0006562J51391_1001477 | Ga0006562J51391_10014775 | 221 |
| 276 | 3300005262 | Ga0065165_1002346 | Ga0065165_10023466 | 221 |
| 277 | 3300005457 | Ga0070662_100062886 | Ga0070662_1000628862 | 221 |
| 278 | 3300005563 | Ga0068855_100016003 | Ga0068855_1000160032 | 221 |
| 279 | 3300005578 | Ga0068854_100000218 | Ga0068854_10000021836 | 221 |
| 280 | 3300005834 | Ga0068851_10003047 | Ga0068851_100030477 | 221 |
| 281 | 3300009093 | Ga0105240_10019848 | Ga0105240_100198488 | 221 |
| 282 | 3300009093 | Ga0105240_10699162 | Ga0105240_106991622 | 221 |
| 283 | 3300013105 | Ga0157369_10367677 | Ga0157369_103676772 | 221 |
| 284 | 3300015685 | Ga0183369_1003 | Ga0183369_1003162 | 221 |
| 285 | 3300025297 | Ga0209758_1002311 | Ga0209758_10023117 | 221 |
| 286 | 3300025321 | Ga0207656_10044863 | Ga0207656_100448632 | 221 |
| 287 | 3300025904 | Ga0207647_10044398 | Ga0207647_100443982 | 221 |
| 288 | 3300025911 | Ga0207654_10116353 | Ga0207654_101163531 | 221 |
| 289 | 3300025913 | Ga0207695_10021909 | Ga0207695_100219092 | 221 |
| 290 | 3300025913 | Ga0207695_10027120 | Ga0207695_100271202 | 221 |
| 291 | 3300025949 | Ga0207667_10000344 | Ga0207667_1000034441 | 221 |
| 292 | 3300025981 | Ga0207640_10002077 | Ga0207640_1000207710 | 221 |
| 293 | 3300044672 | Ga0466982_0000007 | Ga0466982_0000007_212878_213543 | 221 |
| 294 | 3300044706 | Ga0466964_0001144 | Ga0466964_0001144_3014_3679 | 221 |
| 295 | 3300044719 | Ga0466971_0001520 | Ga0466971_0001520_6828_7493 | 221 |
| 296 | 3300044735 | Ga0466968_0002636 | Ga0466968_0002636_1716_2381 | 221 |
| 297 | 3300044765 | Ga0466970_0408239 | Ga0466970_0408239_50_715 | 221 |
| 298 | 3300044901 | Ga0466960_0003797 | Ga0466960_0003797_3568_4233 | 221 |
| 299 | 3300049580 | Ga0501046_0149780 | Ga0501046_0149780_655_1323 | 221 |
| 300 | 3300049822 | Ga0501035_0092550 | Ga0501035_0092550_397_1065 | 221 |
| 301 | 3300049822 | Ga0501035_0327421 | Ga0501035_0327421_318_986 | 221 |
| 302 | 3300049823 | Ga0501044_0316406 | Ga0501044_0316406_210_878 | 221 |
| 303 | 3300049823 | Ga0501044_0410362 | Ga0501044_0410362_393_1061 | 221 |
| 304 | 3300061719 | Ga0466962_0001170 | Ga0466962_0001170_9736_10401 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9869 | 6 | 218 |
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9778 | 6 | 218 |
| 1fw1-assembly1.cif.gz_A-2 | glutathione transferase zeta/maleylacetoacetate isomerase | 0.973 | 5 | 218 |
| 2cz3-assembly1.cif.gz_A | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) | 0.9721 | 5 | 219 |
| 2cz2-assembly1.cif.gz_A-2 | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) | 0.969 | 5 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9848 | 89 | 218 | 1.20.1050.10 |
| af_A0A1D6HAW8_13_80_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9818 | 8 | 75 | 3.40.30.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9783 | 5 | 82 | 3.40.30.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9774 | 89 | 218 | 1.20.1050.10 |
| af_A0A0B5EC52_24_99_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9764 | 8 | 83 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523JPW8-F1-model_v4 | Maleylacetoacetate isomerase | 0.9975 | 6 | 100 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A0Q4H1E7-F1-model_v4 | Maleylacetoacetate isomerase | 0.9951 | 6 | 218 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A1F3ZLJ3-F1-model_v4 | Maleylacetoacetate isomerase | 0.9943 | 6 | 218 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A0M9I1N3-F1-model_v4 | deleted | 0.9933 | 6 | 218 |
|
| AF-A0A1G3HVQ6-F1-model_v4 | Maleylacetoacetate isomerase | 0.9931 | 6 | 162 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar