F397826

General Info

Members Datasets Scaffolds Average Seq Length
304 219 295 217

Family's Representative Sequence

Representative Sequence 3300053145|Ga0500586_002014|Ga0500586_002014_834_1595
Length 253
Sequence LAHDIIGSRRIVVTGGYRLAWIIQDIAYPEDSMAAQPDFELYGFWRTSATYRVRVALNLKGLGAQEHVIDLDKGEQLGADFLKINPLGAIPALIEKGHAPLTQSTAILEFLDEIHPAPPLLPSDPHGRARVRALAAMLAGDTHPLITPRVRKYLSTVGGFDDAAVRAWLIHWFDTGIAAVEKRLASESATGTFCHGDQVGIADICLASITATMKVLNIPVKNAPTIDRIIATCEAMEAFAKADPMKQVGAPKG

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
7 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
8 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
9 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
113 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
203 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0.99
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.46
Nodule 0
Rhizoplane 2.96
Rhizosphere 59.87
Stem 0
Stem Tuber 0
Unclassified 21.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001533 3300001979 Bacteria 10622
2 JGI24737J22298_10002120 3300001990 Bacteria 7075
3 JGI24735J21928_10001392 3300002067 Bacteria 8554
4 JGI24749J21850_1000187 3300002076 Bacteria 9856
5 JGI24751J29686_10000112 3300002459 Bacteria 42533
6 rootH2_10011232 3300003320 Bacteria 1554
7 rootH2_10036142 3300003320 Bacteria 15654
8 rootL2_10121225 3300003322 Bacteria 2850
9 rootL2_10212375 3300003322 Bacteria 1353
10 rootH1_10104958 3300003323 Bacteria 8292
11 Ga0006562J51391_1001475 3300003578 Bacteria 3600
12 Ga0006562J51391_1001477 3300003578 Bacteria 4840
13 Ga0055533_1000762 3300003756 Bacteria 10264
14 Ga0055536_1019857 3300003781 Bacteria 2096
15 Ga0065165_1002346 3300005262 Bacteria 16454
16 Ga0065707_10084576 3300005295 Bacteria 7042
17 Ga0070670_100000069 3300005331 Bacteria 104077
18 Ga0070669_100000105 3300005353 Bacteria 80655
19 Ga0070667_100005699 3300005367 Bacteria 10403
20 Ga0070713_100062781 3300005436 Bacteria 3112
21 Ga0070710_10054929 3300005437 Bacteria 2248
22 Ga0070663_100056242 3300005455 Bacteria 2818
23 Ga0070662_100062886 3300005457 Bacteria 2713
24 Ga0068853_100189871 3300005539 Bacteria 1866
25 Ga0068855_100016003 3300005563 Bacteria 9022
26 Ga0068857_100004712 3300005577 Bacteria 11557
27 Ga0068857_100184821 3300005577 Bacteria 1897
28 Ga0068854_100000218 3300005578 Bacteria 38701
29 Ga0068854_100094861 3300005578 Bacteria 2226
30 Ga0068852_101018079 3300005616 Bacteria 847
31 Ga0068859_100004053 3300005617 Bacteria 14939
32 Ga0068864_100000079 3300005618 Bacteria 102835
33 Ga0068851_10003047 3300005834 Bacteria 7410
34 Ga0068858_100517819 3300005842 Bacteria 1153
35 Ga0068860_100641686 3300005843 Bacteria 1069
36 Ga0068862_100000033 3300005844 Bacteria 176515
37 Ga0070717_10026358 3300006028 Bacteria 4635
38 Ga0075365_10027770 3300006038 Bacteria 3604
39 Ga0070715_10230463 3300006163 Bacteria 957
40 Ga0070716_100009352 3300006173 Bacteria 4882
41 Ga0070712_100055195 3300006175 Bacteria 2781
42 Ga0075369_10109127 3300006186 Bacteria 1246
43 Ga0075366_10125100 3300006195 Bacteria 1550
44 Ga0075428_100052004 3300006844 Bacteria 4492
45 Ga0075431_100364447 3300006847 Unclassified 1451
46 Ga0097620_100004053 3300006931 Bacteria 14939
47 Ga0105240_10019848 3300009093 Bacteria 8977
48 Ga0105240_10183270 3300009093 Bacteria 2469
49 Ga0105240_10195995 3300009093 Bacteria 2372
50 Ga0105240_10254037 3300009093 Bacteria 2031
51 Ga0105240_10699162 3300009093 Bacteria 1107
52 Ga0105248_10000620 3300009177 Bacteria 40460
53 Ga0105248_10039014 3300009177 Bacteria 5317
54 Ga0105248_10060657 3300009177 Bacteria 4247
55 Ga0105248_10142690 3300009177 Bacteria 2702
56 Ga0105239_10000033 3300010375 Bacteria 223933
57 Ga0105239_10135014 3300010375 Bacteria 2747
58 Ga0157326_1000037 3300012513 Bacteria 11556
59 Ga0157373_10333805 3300013100 Bacteria 1080
60 Ga0157371_10165226 3300013102 Bacteria 1581
61 Ga0157369_10367677 3300013105 Bacteria 1493
62 Ga0157372_10346407 3300013307 Bacteria 1731
63 Ga0163163_10020871 3300014325 Bacteria 6176
64 Ga0183369_1003 3300015685 Bacteria 726443
65 Ga0163161_10134788 3300017792 Bacteria 1866
66 Ga0209258_101981 3300025242 Bacteria 5945
67 Ga0209675_1017258 3300025291 Bacteria 2067
68 Ga0209676_1006583 3300025292 Bacteria 5693
69 Ga0209564_1004510 3300025295 Bacteria 8475
70 Ga0209758_1001512 3300025297 Bacteria 26996
71 Ga0209758_1002311 3300025297 Bacteria 19712
72 Ga0207656_10044863 3300025321 Bacteria 1889
73 Ga0207692_10001677 3300025898 Bacteria 8373
74 Ga0207647_10044398 3300025904 Bacteria 2777
75 Ga0207654_10116353 3300025911 Bacteria 1671
76 Ga0207695_10000322 3300025913 Bacteria 114700
77 Ga0207695_10005321 3300025913 Bacteria 17138
78 Ga0207695_10021909 3300025913 Bacteria 7273
79 Ga0207695_10027120 3300025913 Bacteria 6380
80 Ga0207693_10000982 3300025915 Bacteria 25565
81 Ga0207663_10000310 3300025916 Bacteria 21232
82 Ga0207681_10000014 3300025923 Bacteria 353422
83 Ga0207650_10000015 3300025925 Bacteria 369173
84 Ga0207700_10064164 3300025928 Bacteria 2796
85 Ga0207664_10014356 3300025929 Bacteria 5717
86 Ga0207665_10007935 3300025939 Bacteria 7011
87 Ga0207711_10000297 3300025941 Bacteria 53217
88 Ga0207711_10022192 3300025941 Bacteria 5308
89 Ga0207711_10093273 3300025941 Bacteria 2652
90 Ga0207667_10000344 3300025949 Bacteria 63681
91 Ga0207640_10002077 3300025981 Bacteria 10785
92 Ga0207640_10009561 3300025981 Bacteria 5433
93 Ga0207658_10003316 3300025986 Bacteria 11429
94 Ga0207703_10130858 3300026035 Bacteria 2167
95 Ga0207639_10118249 3300026041 Bacteria 2173
96 Ga0207678_10044754 3300026067 Bacteria 3828
97 Ga0207676_10000071 3300026095 Bacteria 104095
98 Ga0207674_10083258 3300026116 Bacteria 3199
99 Ga0207674_10185143 3300026116 Bacteria 2033
100 Ga0207675_100001970 3300026118 Bacteria 20462
101 Ga0268265_10000013 3300028380 Bacteria 341536
102 Ga0265318_10052001 3300028577 Bacteria 1538
103 Ga0307515_10213269 3300028794 Bacteria 1769
104 Ga0265760_10038589 3300031090 Bacteria 1420
105 Ga0265330_10012787 3300031235 Bacteria 3917
106 Ga0265328_10062328 3300031239 Bacteria 1369
107 Ga0265320_10006218 3300031240 Bacteria 7546
108 Ga0265340_10004964 3300031247 Bacteria 7395
109 Ga0265316_10192044 3300031344 Bacteria 1516
110 Ga0307513_10251217 3300031456 Bacteria 1565
111 Ga0265313_10045327 3300031595 Bacteria 2141
112 Ga0265313_10071902 3300031595 Bacteria 1591
113 Ga0316575_10041537 3300031665 Bacteria 1819
114 Ga0265314_10219713 3300031711 Bacteria 1110
115 Ga0307412_10257774 3300031911 Bacteria 1358
116 Ga0373934_0052630 3300035086 Bacteria 1615
117 Ga0373953_0029031 3300035117 Bacteria 2137
118 Ga0373954_0021698 3300035118 Bacteria 2908
119 Ga0373956_0124426 3300035119 Bacteria 1205
120 Ga0373955_0180461 3300035172 Bacteria 1252
121 Ga0316574_0219306 3300035398 Bacteria 1219
122 Ga0316574_0378321 3300035398 Unclassified 894
123 Ga0373935_0537078 3300035692 Bacteria 851
124 Ga0373937_0453011 3300036401 Bacteria 1218
125 Ga0451793_0852106 3300041452 Bacteria 2074
126 Ga0439459_0000632 3300042438 Bacteria 4759
127 Ga0466982_0000007 3300044672 Bacteria 250854
128 Ga0466964_0001144 3300044706 Bacteria 8954
129 Ga0466971_0001520 3300044719 Bacteria 9782
130 Ga0466968_0002636 3300044735 Bacteria 6602
131 Ga0466970_0408239 3300044765 Bacteria 775
132 Ga0466960_0003797 3300044901 Bacteria 5853
133 Ga0466960_0049907 3300044901 Bacteria 2016
134 Ga0451576_0816574 3300045051 Bacteria 979
135 Ga0495592_0227519 3300046454 Bacteria 1243
136 Ga0495629_0049462 3300046459 Bacteria 2946
137 Ga0495638_0000090 3300046460 Bacteria 148040
138 Ga0495638_0009094 3300046460 Bacteria 6993
139 Ga0495638_0009641 3300046460 Bacteria 6753
140 Ga0495653_0311001 3300046463 Bacteria 1024
141 Ga0495584_0021730 3300046491 Bacteria 3259
142 Ga0495607_0068010 3300046501 Bacteria 1999
143 Ga0495606_0140725 3300046507 Bacteria 1425
144 Ga0495606_0263120 3300046507 Bacteria 951
145 Ga0495608_0256467 3300046511 Bacteria 1089
146 Ga0495616_0050317 3300046513 Bacteria 2084
147 Ga0495618_0159300 3300046514 Bacteria 1439
148 Ga0495620_0026172 3300046515 Bacteria 2746
149 Ga0495620_0154650 3300046515 Bacteria 893
150 Ga0495630_0048759 3300046517 Bacteria 3170
151 Ga0495632_0000001 3300046519 Bacteria 873295
152 Ga0495632_0073449 3300046519 Bacteria 1640
153 Ga0495637_0000809 3300046520 Bacteria 20718
154 Ga0495643_0000006 3300046522 Bacteria 419524
155 Ga0495648_0006938 3300046524 Bacteria 9133
156 Ga0495648_0025933 3300046524 Bacteria 3957
157 Ga0495648_0133904 3300046524 Bacteria 1314
158 Ga0495648_0225249 3300046524 Bacteria 922
159 Ga0495663_0000002 3300046525 Bacteria 495384
160 Ga0495652_0222270 3300046529 Bacteria 1418
161 Ga0495654_0025978 3300046530 Bacteria 3015
162 Ga0495586_0108782 3300046535 Bacteria 1542
163 Ga0495587_0201818 3300046536 Bacteria 1124
164 Ga0495645_0062148 3300046543 Bacteria 2705
165 Ga0495622_0026821 3300046557 Bacteria 2689
166 Ga0495633_0000053 3300046558 Bacteria 152374
167 Ga0495633_0000160 3300046558 Bacteria 88116
168 Ga0495634_0076464 3300046642 Bacteria 2197
169 Ga0495661_0005736 3300046665 Bacteria 8791
170 Ga0495588_0082302 3300046674 Bacteria 1681
171 Ga0495657_0254884 3300046675 Bacteria 1055
172 Ga0495599_0037857 3300046678 Bacteria 3030
173 Ga0495670_0009580 3300046691 Bacteria 4758
174 Ga0495671_0000008 3300046692 Bacteria 419524
175 Ga0495600_0095752 3300046809 Bacteria 1935
176 Ga0495660_0189555 3300046810 Bacteria 989
177 Ga0495604_0772399 3300047317 Bacteria 607
178 Ga0495674_0070907 3300047319 Bacteria 3010
179 Ga0495672_0117226 3300047320 Bacteria 1421
180 Ga0495680_0117356 3300047322 Bacteria 1967
181 Ga0495673_0079008 3300047469 Bacteria 1366
182 Ga0495681_0002650 3300047470 Bacteria 12688
183 Ga0495681_0114624 3300047470 Bacteria 1163
184 Ga0495684_0036355 3300047471 Bacteria 3776
185 Ga0495684_0606694 3300047471 Bacteria 738
186 Ga0495686_0012360 3300047472 Bacteria 5975
187 Ga0495626_0095829 3300048091 Bacteria 1299
188 Ga0496100_0035139 3300048903 Bacteria 3151
189 Ga0496101_0047558 3300048904 Bacteria 3080
190 Ga0496102_0427036 3300048905 Bacteria 1245
191 Ga0496105_0001744 3300048908 Bacteria 15551
192 Ga0496106_0000034 3300048909 Bacteria 130368
193 Ga0496106_0184891 3300048909 Bacteria 1655
194 Ga0496115_0061497 3300048918 Bacteria 3027
195 Ga0496116_0002501 3300048919 Bacteria 19243
196 Ga0496116_0024416 3300048919 Bacteria 4472
197 Ga0496116_0188500 3300048919 Bacteria 1095
198 Ga0496117_0040887 3300048920 Bacteria 3404
199 Ga0496117_0102882 3300048920 Bacteria 1801
200 Ga0496117_0105119 3300048920 Bacteria 1775
201 Ga0496117_0190091 3300048920 Bacteria 1170
202 Ga0496118_0029916 3300048921 Bacteria 4557
203 Ga0496118_0032086 3300048921 Bacteria 4337
204 Ga0496118_0041772 3300048921 Bacteria 3626
205 Ga0496118_0050225 3300048921 Bacteria 3203
206 Ga0496118_0197234 3300048921 Bacteria 1197
207 Ga0496118_0290497 3300048921 Bacteria 904
208 Ga0496119_0000113 3300048922 Bacteria 114626
209 Ga0496119_0040222 3300048922 Bacteria 2993
210 Ga0496119_0119010 3300048922 Bacteria 1455
211 Ga0496120_0000450 3300048923 Bacteria 65290
212 Ga0496120_0022211 3300048923 Bacteria 3994
213 Ga0496120_0063746 3300048923 Bacteria 2049
214 Ga0496121_0000754 3300048924 Bacteria 59457
215 Ga0496121_0008874 3300048924 Bacteria 11691
216 Ga0496121_0009082 3300048924 Bacteria 11508
217 Ga0496121_0015428 3300048924 Bacteria 8008
218 Ga0496121_0036583 3300048924 Bacteria 4373
219 Ga0496121_0151705 3300048924 Bacteria 1704
220 Ga0496121_0205185 3300048924 Bacteria 1401
221 Ga0496122_0021346 3300048925 Bacteria 5800
222 Ga0496122_0047309 3300048925 Bacteria 3322
223 Ga0496122_0110492 3300048925 Bacteria 1806
224 Ga0496123_0114165 3300048926 Bacteria 1536
225 Ga0496124_0068935 3300048927 Bacteria 2938
226 Ga0496124_0125175 3300048927 Bacteria 2048
227 Ga0496124_0223292 3300048927 Bacteria 1415
228 Ga0496124_0493667 3300048927 Bacteria 823
229 Ga0496125_0000406 3300048928 Bacteria 80645
230 Ga0496125_0000516 3300048928 Bacteria 67232
231 Ga0496125_0009348 3300048928 Bacteria 10099
232 Ga0496125_0016585 3300048928 Bacteria 7065
233 Ga0496125_0201544 3300048928 Bacteria 1302
234 Ga0496126_0000160 3300048929 Bacteria 155144
235 Ga0496126_0000389 3300048929 Bacteria 90452
236 Ga0496126_0035911 3300048929 Bacteria 4639
237 Ga0496126_0056073 3300048929 Bacteria 3563
238 Ga0496126_0060819 3300048929 Bacteria 3396
239 Ga0496126_0194109 3300048929 Bacteria 1718
240 Ga0496126_0403931 3300048929 Bacteria 1107
241 Ga0496126_0409689 3300048929 Bacteria 1098
242 Ga0496126_0650579 3300048929 Bacteria 825
243 Ga0501036_0309122 3300049572 Bacteria 1322
244 Ga0501043_0012219 3300049579 Bacteria 6712
245 Ga0501046_0149780 3300049580 Bacteria 1761
246 Ga0501047_0011851 3300049581 Bacteria 8246
247 Ga0501047_0095668 3300049581 Bacteria 2849
248 Ga0501074_0250368 3300049590 Bacteria 1260
249 Ga0501208_017525 3300049655 Bacteria 1130
250 Ga0501249_000212 3300049679 Bacteria 17798
251 Ga0501035_0090295 3300049822 Bacteria 2697
252 Ga0501035_0092550 3300049822 Bacteria 2660
253 Ga0501035_0327421 3300049822 Bacteria 1286
254 Ga0501044_0316406 3300049823 Bacteria 1486
255 Ga0501044_0410362 3300049823 Bacteria 1266
256 nmdc:mga0yw44_191561_c1 3300050492 Bacteria 1349
257 nmdc:mga0yw44_54513_c1 3300050492 Bacteria 2430
258 nmdc:mga0k408_31347_c1 3300050493 Bacteria 3035
259 nmdc:mga06r32_144485_c1 3300050510 Bacteria 2356
260 nmdc:mga0sz30_70782_c1 3300050516 Bacteria 1501
261 Ga0495601_0066444 3300053077 Bacteria 2295
262 Ga0495612_0025945 3300053078 Bacteria 2354
263 Ga0495595_0269041 3300053084 Bacteria 854
264 Ga0500644_0062359 3300053088 Bacteria 1317
265 Ga0500646_0006392 3300053090 Bacteria 2997
266 Ga0500646_0168314 3300053090 Bacteria 736
267 Ga0500651_0019614 3300053093 Bacteria 4203
268 Ga0500651_0037570 3300053093 Bacteria 3052
269 Ga0500651_0100217 3300053093 Bacteria 1776
270 Ga0500566_0013145 3300053094 Bacteria 4876
271 Ga0500641_0007449 3300053096 Bacteria 3904
272 Ga0500650_0056633 3300053098 Bacteria 1826
273 Ga0500650_0078375 3300053098 Bacteria 1545
274 Ga0500556_0000016 3300053104 Bacteria 194958
275 Ga0500569_074651 3300053109 Bacteria 1073
276 Ga0500592_009470 3300053116 Bacteria 1549
277 Ga0500595_044095 3300053119 Bacteria 1415
278 Ga0500608_000117 3300053122 Bacteria 32871
279 Ga0500618_002694 3300053125 Bacteria 6490
280 Ga0500642_0000201 3300053130 Bacteria 24478
281 Ga0500642_0139925 3300053130 Bacteria 1135
282 Ga0500652_000225 3300053131 Bacteria 21717
283 Ga0500658_0101442 3300053134 Bacteria 1256
284 Ga0500559_0000161 3300053136 Bacteria 53055
285 Ga0500568_0002573 3300053139 Bacteria 10565
286 Ga0500577_0004191 3300053142 Bacteria 3793
287 Ga0500577_0201034 3300053142 Bacteria 860
288 Ga0500586_002014 3300053145 Bacteria 4465
289 Ga0500616_0000169 3300053153 Bacteria 109205
290 Ga0500636_0002058 3300053177 Bacteria 11095
291 Ga0500636_0043148 3300053177 Bacteria 2663
292 Ga0500567_059938 3300053723 Bacteria 1708
293 Ga0500611_022942 3300053727 Bacteria 1210
294 Ga0500645_021313 3300053730 Bacteria 2001
295 Ga0466962_0001170 3300061719 Bacteria 12074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10121225 rootL2_101212255 186
2 3300047317 Ga0495604_0772399 Ga0495604_0772399_13_576 186
3 3300048922 Ga0496119_0119010 Ga0496119_0119010_10_573 186
4 3300053125 Ga0500618_002694 Ga0500618_002694_3463_4026 186
5 3300053084 Ga0495595_0269041 Ga0495595_0269041_32_610 191
6 3300017792 Ga0163161_10134788 Ga0163161_101347882 196
7 3300046491 Ga0495584_0021730 Ga0495584_0021730_2636_3229 197
8 3300046515 Ga0495620_0154650 Ga0495620_0154650_21_617 197
9 3300048920 Ga0496117_0105119 Ga0496117_0105119_503_1105 200
10 3300048921 Ga0496118_0050225 Ga0496118_0050225_694_1296 200
11 3300048927 Ga0496124_0125175 Ga0496124_0125175_1076_1678 200
12 3300048929 Ga0496126_0194109 Ga0496126_0194109_764_1366 200
13 3300048920 Ga0496117_0040887 Ga0496117_0040887_181_813 205
14 3300013100 Ga0157373_10333805 Ga0157373_103338051 206
15 3300013307 Ga0157372_10346407 Ga0157372_103464072 206
16 3300003781 Ga0055536_1019857 Ga0055536_10198572 208
17 3300013102 Ga0157371_10165226 Ga0157371_101652262 208
18 3300025291 Ga0209675_1017258 Ga0209675_10172582 208
19 3300025292 Ga0209676_1006583 Ga0209676_10065832 208
20 iso_pu_bacteria 2643221541 2643726999 208
21 iso_pu_bacteria 2643221605 2644040469 208
22 iso_pu_bacteria 2643221606 2644045960 208
23 iso_pu_bacteria 2643221671 2644393229 208
24 3300005436 Ga0070713_100062781 Ga0070713_1000627812 209
25 3300005437 Ga0070710_10054929 Ga0070710_100549291 209
26 3300006028 Ga0070717_10026358 Ga0070717_100263582 209
27 3300006163 Ga0070715_10230463 Ga0070715_102304632 209
28 3300006173 Ga0070716_100009352 Ga0070716_1000093526 209
29 3300006175 Ga0070712_100055195 Ga0070712_1000551953 209
30 3300025898 Ga0207692_10001677 Ga0207692_100016777 209
31 3300025915 Ga0207693_10000982 Ga0207693_100009823 209
32 3300025916 Ga0207663_10000310 Ga0207663_1000031015 209
33 3300025928 Ga0207700_10064164 Ga0207700_100641641 209
34 3300025929 Ga0207664_10014356 Ga0207664_100143565 209
35 3300025939 Ga0207665_10007935 Ga0207665_100079354 209
36 3300031090 Ga0265760_10038589 Ga0265760_100385892 209
37 3300031235 Ga0265330_10012787 Ga0265330_100127871 209
38 3300031239 Ga0265328_10062328 Ga0265328_100623282 209
39 3300031247 Ga0265340_10004964 Ga0265340_100049644 209
40 3300031344 Ga0265316_10192044 Ga0265316_101920441 209
41 3300031711 Ga0265314_10219713 Ga0265314_102197131 209
42 3300035086 Ga0373934_0052630 Ga0373934_0052630_73_705 209
43 3300035117 Ga0373953_0029031 Ga0373953_0029031_426_1058 209
44 3300035118 Ga0373954_0021698 Ga0373954_0021698_2076_2708 209
45 3300035119 Ga0373956_0124426 Ga0373956_0124426_200_832 209
46 3300035172 Ga0373955_0180461 Ga0373955_0180461_358_990 209
47 3300035692 Ga0373935_0537078 Ga0373935_0537078_53_685 209
48 3300036401 Ga0373937_0453011 Ga0373937_0453011_537_1169 209
49 3300046454 Ga0495592_0227519 Ga0495592_0227519_259_891 209
50 3300046459 Ga0495629_0049462 Ga0495629_0049462_591_1223 209
51 3300046463 Ga0495653_0311001 Ga0495653_0311001_256_888 209
52 3300046511 Ga0495608_0256467 Ga0495608_0256467_65_697 209
53 3300046514 Ga0495618_0159300 Ga0495618_0159300_610_1242 209
54 3300046517 Ga0495630_0048759 Ga0495630_0048759_1065_1697 209
55 3300046529 Ga0495652_0222270 Ga0495652_0222270_432_1064 209
56 3300046535 Ga0495586_0108782 Ga0495586_0108782_644_1276 209
57 3300046536 Ga0495587_0201818 Ga0495587_0201818_358_990 209
58 3300046543 Ga0495645_0062148 Ga0495645_0062148_1246_1878 209
59 3300046642 Ga0495634_0076464 Ga0495634_0076464_359_991 209
60 3300046675 Ga0495657_0254884 Ga0495657_0254884_393_1025 209
61 3300046678 Ga0495599_0037857 Ga0495599_0037857_1689_2321 209
62 3300046809 Ga0495600_0095752 Ga0495600_0095752_630_1262 209
63 3300047319 Ga0495674_0070907 Ga0495674_0070907_50_682 209
64 3300047322 Ga0495680_0117356 Ga0495680_0117356_745_1377 209
65 3300047471 Ga0495684_0036355 Ga0495684_0036355_432_1064 209
66 3300053077 Ga0495601_0066444 Ga0495601_0066444_1407_2039 209
67 3300053078 Ga0495612_0025945 Ga0495612_0025945_537_1169 209
68 iso_pu_bacteria 2926754445 2926760251 210
69 3300002076 JGI24749J21850_1000187 JGI24749J21850_100018711 212
70 3300002459 JGI24751J29686_10000112 JGI24751J29686_1000011219 212
71 3300005295 Ga0065707_10084576 Ga0065707_100845766 212
72 3300005331 Ga0070670_100000069 Ga0070670_10000006980 212
73 3300005353 Ga0070669_100000105 Ga0070669_10000010565 212
74 3300005367 Ga0070667_100005699 Ga0070667_1000056993 212
75 3300005539 Ga0068853_100189871 Ga0068853_1001898713 212
76 3300005577 Ga0068857_100184821 Ga0068857_1001848212 212
77 3300005578 Ga0068854_100094861 Ga0068854_1000948611 212
78 3300005616 Ga0068852_101018079 Ga0068852_1010180791 212
79 3300005617 Ga0068859_100004053 Ga0068859_10000405313 212
80 3300005618 Ga0068864_100000079 Ga0068864_10000007981 212
81 3300005843 Ga0068860_100641686 Ga0068860_1006416861 212
82 3300005844 Ga0068862_100000033 Ga0068862_100000033157 212
83 3300006195 Ga0075366_10125100 Ga0075366_101251002 212
84 3300006931 Ga0097620_100004053 Ga0097620_1000040535 212
85 3300009093 Ga0105240_10195995 Ga0105240_101959952 212
86 3300009177 Ga0105248_10000620 Ga0105248_1000062019 212
87 3300012513 Ga0157326_1000037 Ga0157326_100003710 212
88 3300014325 Ga0163163_10020871 Ga0163163_100208714 212
89 3300025923 Ga0207681_10000014 Ga0207681_1000001422 212
90 3300025925 Ga0207650_10000015 Ga0207650_1000001523 212
91 3300025941 Ga0207711_10000297 Ga0207711_1000029760 212
92 3300025981 Ga0207640_10009561 Ga0207640_100095612 212
93 3300025986 Ga0207658_10003316 Ga0207658_100033169 212
94 3300026041 Ga0207639_10118249 Ga0207639_101182493 212
95 3300026095 Ga0207676_10000071 Ga0207676_1000007180 212
96 3300026116 Ga0207674_10185143 Ga0207674_101851431 212
97 3300026118 Ga0207675_100001970 Ga0207675_10000197022 212
98 3300028380 Ga0268265_10000013 Ga0268265_10000013327 212
99 3300049572 Ga0501036_0309122 Ga0501036_0309122_310_948 212
100 3300049579 Ga0501043_0012219 Ga0501043_0012219_4834_5472 212
101 3300049581 Ga0501047_0011851 Ga0501047_0011851_6225_6863 212
102 3300049655 Ga0501208_017525 Ga0501208_017525_185_826 212
103 3300049679 Ga0501249_000212 Ga0501249_000212_2332_2973 212
104 3300049822 Ga0501035_0090295 Ga0501035_0090295_1043_1681 212
105 3300010375 Ga0105239_10135014 Ga0105239_101350142 213
106 3300042438 Ga0439459_0000632 Ga0439459_0000632_2585_3229 213
107 3300046460 Ga0495638_0009094 Ga0495638_0009094_5949_6638 213
108 3300048929 Ga0496126_0060819 Ga0496126_0060819_2555_3199 213
109 3300005842 Ga0068858_100517819 Ga0068858_1005178192 214
110 3300026035 Ga0207703_10130858 Ga0207703_101308582 214
111 3300028577 Ga0265318_10052001 Ga0265318_100520012 214
112 3300044901 Ga0466960_0049907 Ga0466960_0049907_392_1060 214
113 3300046519 Ga0495632_0000001 Ga0495632_0000001_365455_366099 214
114 3300046520 Ga0495637_0000809 Ga0495637_0000809_12800_13444 214
115 3300046522 Ga0495643_0000006 Ga0495643_0000006_55615_56259 214
116 3300046524 Ga0495648_0133904 Ga0495648_0133904_423_1067 214
117 3300046525 Ga0495663_0000002 Ga0495663_0000002_363785_364429 214
118 3300046558 Ga0495633_0000053 Ga0495633_0000053_40737_41381 214
119 3300046558 Ga0495633_0000160 Ga0495633_0000160_73356_74000 214
120 3300046692 Ga0495671_0000008 Ga0495671_0000008_55615_56259 214
121 3300047470 Ga0495681_0002650 Ga0495681_0002650_6354_6998 214
122 3300047472 Ga0495686_0012360 Ga0495686_0012360_889_1533 214
123 3300049581 Ga0501047_0095668 Ga0501047_0095668_1605_2249 214
124 3300049590 Ga0501074_0250368 Ga0501074_0250368_373_1017 214
125 iso_pu_bacteria 2602042107 2603858289 214
126 iso_pu_bacteria 2857524615 2857527709 214
127 iso_pu_bacteria 2893066018 2893067140 214
128 iso_pu_bacteria 2919073203 2919073570 214
129 3300031240 Ga0265320_10006218 Ga0265320_100062185 215
130 3300031595 Ga0265313_10071902 Ga0265313_100719022 215
131 3300041452 Ga0451793_0852106 Ga0451793_0852106_1374_2024 215
132 3300046460 Ga0495638_0000090 Ga0495638_0000090_112998_113648 215
133 3300006844 Ga0075428_100052004 Ga0075428_1000520043 216
134 3300006847 Ga0075431_100364447 Ga0075431_1003644472 216
135 3300009177 Ga0105248_10039014 Ga0105248_100390142 216
136 3300025297 Ga0209758_1001512 Ga0209758_100151222 216
137 3300025941 Ga0207711_10022192 Ga0207711_100221925 216
138 3300031456 Ga0307513_10251217 Ga0307513_102512171 216
139 3300031595 Ga0265313_10045327 Ga0265313_100453272 216
140 3300035398 Ga0316574_0378321 Ga0316574_0378321_177_854 216
141 3300046524 Ga0495648_0225249 Ga0495648_0225249_174_827 216
142 3300047469 Ga0495673_0079008 Ga0495673_0079008_291_944 216
143 3300047471 Ga0495684_0606694 Ga0495684_0606694_68_721 216
144 3300048921 Ga0496118_0041772 Ga0496118_0041772_1582_2235 216
145 3300048921 Ga0496118_0197234 Ga0496118_0197234_325_978 216
146 3300048924 Ga0496121_0000754 Ga0496121_0000754_4753_5406 216
147 3300048927 Ga0496124_0493667 Ga0496124_0493667_98_751 216
148 3300050493 nmdc:mga0k408_31347_c1 nmdc:mga0k408_31347_c1_1462_2112 216
149 3300050510 nmdc:mga06r32_144485_c1 nmdc:mga06r32_144485_c1_132_782 216
150 3300053090 Ga0500646_0168314 Ga0500646_0168314_36_689 216
151 3300053093 Ga0500651_0019614 Ga0500651_0019614_3375_4028 216
152 3300053098 Ga0500650_0078375 Ga0500650_0078375_88_741 216
153 3300053119 Ga0500595_044095 Ga0500595_044095_579_1232 216
154 3300053130 Ga0500642_0139925 Ga0500642_0139925_125_778 216
155 3300053177 Ga0500636_0043148 Ga0500636_0043148_1481_2134 216
156 3300035398 Ga0316574_0219306 Ga0316574_0219306_56_712 217
157 3300045051 Ga0451576_0816574 Ga0451576_0816574_79_960 217
158 3300048921 Ga0496118_0290497 Ga0496118_0290497_136_795 217
159 3300048928 Ga0496125_0201544 Ga0496125_0201544_103_777 217
160 3300048929 Ga0496126_0409689 Ga0496126_0409689_190_852 217
161 3300005455 Ga0070663_100056242 Ga0070663_1000562421 218
162 3300006186 Ga0075369_10109127 Ga0075369_101091272 218
163 3300025295 Ga0209564_1004510 Ga0209564_10045104 218
164 3300026067 Ga0207678_10044754 Ga0207678_100447545 218
165 3300028794 Ga0307515_10213269 Ga0307515_102132692 218
166 3300031665 Ga0316575_10041537 Ga0316575_100415372 218
167 3300046501 Ga0495607_0068010 Ga0495607_0068010_1198_1863 218
168 3300046507 Ga0495606_0263120 Ga0495606_0263120_175_840 218
169 3300046513 Ga0495616_0050317 Ga0495616_0050317_222_887 218
170 3300046515 Ga0495620_0026172 Ga0495620_0026172_889_1554 218
171 3300046519 Ga0495632_0073449 Ga0495632_0073449_58_723 218
172 3300046524 Ga0495648_0006938 Ga0495648_0006938_40_705 218
173 3300046524 Ga0495648_0025933 Ga0495648_0025933_637_1302 218
174 3300046530 Ga0495654_0025978 Ga0495654_0025978_926_1591 218
175 3300046557 Ga0495622_0026821 Ga0495622_0026821_925_1590 218
176 3300046674 Ga0495588_0082302 Ga0495588_0082302_729_1394 218
177 3300046691 Ga0495670_0009580 Ga0495670_0009580_3100_3765 218
178 3300046810 Ga0495660_0189555 Ga0495660_0189555_46_711 218
179 3300047320 Ga0495672_0117226 Ga0495672_0117226_317_982 218
180 3300047470 Ga0495681_0114624 Ga0495681_0114624_273_938 218
181 3300048091 Ga0495626_0095829 Ga0495626_0095829_516_1181 218
182 3300048919 Ga0496116_0002501 Ga0496116_0002501_16292_16957 218
183 3300048920 Ga0496117_0190091 Ga0496117_0190091_28_693 218
184 3300048923 Ga0496120_0063746 Ga0496120_0063746_334_999 218
185 3300048924 Ga0496121_0009082 Ga0496121_0009082_1087_1752 218
186 3300048925 Ga0496122_0047309 Ga0496122_0047309_1331_1996 218
187 3300048925 Ga0496122_0110492 Ga0496122_0110492_712_1377 218
188 3300048927 Ga0496124_0223292 Ga0496124_0223292_737_1402 218
189 3300048928 Ga0496125_0000406 Ga0496125_0000406_38042_38707 218
190 3300048928 Ga0496125_0000516 Ga0496125_0000516_11449_12114 218
191 3300048928 Ga0496125_0009348 Ga0496125_0009348_7216_7881 218
192 3300048928 Ga0496125_0016585 Ga0496125_0016585_5967_6632 218
193 3300048929 Ga0496126_0035911 Ga0496126_0035911_1636_2301 218
194 3300048929 Ga0496126_0403931 Ga0496126_0403931_375_1040 218
195 3300050492 nmdc:mga0yw44_191561_c1 nmdc:mga0yw44_191561_c1_442_1107 218
196 3300050516 nmdc:mga0sz30_70782_c1 nmdc:mga0sz30_70782_c1_263_928 218
197 3300053088 Ga0500644_0062359 Ga0500644_0062359_200_865 218
198 3300053093 Ga0500651_0100217 Ga0500651_0100217_711_1376 218
199 3300053094 Ga0500566_0013145 Ga0500566_0013145_3358_4023 218
200 3300053096 Ga0500641_0007449 Ga0500641_0007449_622_1287 218
201 3300053098 Ga0500650_0056633 Ga0500650_0056633_525_1190 218
202 3300053104 Ga0500556_0000016 Ga0500556_0000016_171844_172509 218
203 3300053116 Ga0500592_009470 Ga0500592_009470_531_1196 218
204 3300053122 Ga0500608_000117 Ga0500608_000117_22457_23122 218
205 3300053130 Ga0500642_0000201 Ga0500642_0000201_2512_3177 218
206 3300053131 Ga0500652_000225 Ga0500652_000225_14795_15460 218
207 3300053134 Ga0500658_0101442 Ga0500658_0101442_228_893 218
208 3300053136 Ga0500559_0000161 Ga0500559_0000161_22505_23170 218
209 3300053139 Ga0500568_0002573 Ga0500568_0002573_9234_9899 218
210 3300053142 Ga0500577_0004191 Ga0500577_0004191_2611_3276 218
211 3300053142 Ga0500577_0201034 Ga0500577_0201034_58_723 218
212 3300053145 Ga0500586_002014 Ga0500586_002014_834_1595 218
213 3300053153 Ga0500616_0000169 Ga0500616_0000169_85905_86570 218
214 3300053177 Ga0500636_0002058 Ga0500636_0002058_385_1050 218
215 3300053723 Ga0500567_059938 Ga0500567_059938_57_818 218
216 3300053727 Ga0500611_022942 Ga0500611_022942_442_1107 218
217 3300053730 Ga0500645_021313 Ga0500645_021313_817_1482 218
218 3300003320 rootH2_10036142 rootH2_1003614210 219
219 3300003323 rootH1_10104958 rootH1_101049583 219
220 3300005577 Ga0068857_100004712 Ga0068857_1000047122 219
221 3300006038 Ga0075365_10027770 Ga0075365_100277703 219
222 3300009093 Ga0105240_10183270 Ga0105240_101832702 219
223 3300009093 Ga0105240_10254037 Ga0105240_102540372 219
224 3300009177 Ga0105248_10060657 Ga0105248_100606572 219
225 3300009177 Ga0105248_10142690 Ga0105248_101426902 219
226 3300010375 Ga0105239_10000033 Ga0105239_10000033146 219
227 3300025913 Ga0207695_10000322 Ga0207695_1000032247 219
228 3300025913 Ga0207695_10005321 Ga0207695_1000532116 219
229 3300025941 Ga0207711_10093273 Ga0207711_100932733 219
230 3300026116 Ga0207674_10083258 Ga0207674_100832582 219
231 3300031911 Ga0307412_10257774 Ga0307412_102577742 219
232 3300046460 Ga0495638_0009641 Ga0495638_0009641_2166_2843 219
233 3300046507 Ga0495606_0140725 Ga0495606_0140725_275_952 219
234 3300046665 Ga0495661_0005736 Ga0495661_0005736_1422_2099 219
235 3300048903 Ga0496100_0035139 Ga0496100_0035139_110_823 219
236 3300048904 Ga0496101_0047558 Ga0496101_0047558_70_783 219
237 3300048905 Ga0496102_0427036 Ga0496102_0427036_110_769 219
238 3300048908 Ga0496105_0001744 Ga0496105_0001744_14469_15128 219
239 3300048909 Ga0496106_0000034 Ga0496106_0000034_99064_99804 219
240 3300048909 Ga0496106_0184891 Ga0496106_0184891_973_1632 219
241 3300048918 Ga0496115_0061497 Ga0496115_0061497_2144_2857 219
242 3300048919 Ga0496116_0024416 Ga0496116_0024416_2816_3499 219
243 3300048919 Ga0496116_0188500 Ga0496116_0188500_282_962 219
244 3300048920 Ga0496117_0102882 Ga0496117_0102882_68_781 219
245 3300048921 Ga0496118_0029916 Ga0496118_0029916_225_884 219
246 3300048921 Ga0496118_0032086 Ga0496118_0032086_3402_4079 219
247 3300048922 Ga0496119_0000113 Ga0496119_0000113_83446_84105 219
248 3300048922 Ga0496119_0040222 Ga0496119_0040222_475_1143 219
249 3300048923 Ga0496120_0000450 Ga0496120_0000450_2013_2681 219
250 3300048923 Ga0496120_0022211 Ga0496120_0022211_2021_2680 219
251 3300048924 Ga0496121_0008874 Ga0496121_0008874_3043_3783 219
252 3300048924 Ga0496121_0015428 Ga0496121_0015428_7217_7876 219
253 3300048924 Ga0496121_0036583 Ga0496121_0036583_1235_1903 219
254 3300048924 Ga0496121_0151705 Ga0496121_0151705_20_679 219
255 3300048924 Ga0496121_0205185 Ga0496121_0205185_646_1314 219
256 3300048925 Ga0496122_0021346 Ga0496122_0021346_1471_2148 219
257 3300048926 Ga0496123_0114165 Ga0496123_0114165_599_1267 219
258 3300048927 Ga0496124_0068935 Ga0496124_0068935_44_721 219
259 3300048929 Ga0496126_0000160 Ga0496126_0000160_25173_25886 219
260 3300048929 Ga0496126_0000389 Ga0496126_0000389_65620_66297 219
261 3300048929 Ga0496126_0056073 Ga0496126_0056073_1978_2646 219
262 3300048929 Ga0496126_0650579 Ga0496126_0650579_36_719 219
263 3300050492 nmdc:mga0yw44_54513_c1 nmdc:mga0yw44_54513_c1_803_1480 219
264 3300053090 Ga0500646_0006392 Ga0500646_0006392_1664_2341 219
265 3300053093 Ga0500651_0037570 Ga0500651_0037570_726_1403 219
266 3300053109 Ga0500569_074651 Ga0500569_074651_280_957 219
267 3300002067 JGI24735J21928_10001392 JGI24735J21928_100013924 220
268 3300003756 Ga0055533_1000762 Ga0055533_10007628 220
269 3300025242 Ga0209258_101981 Ga0209258_1019814 220
270 3300001979 JGI24740J21852_10001533 JGI24740J21852_1000153311 221
271 3300001990 JGI24737J22298_10002120 JGI24737J22298_100021203 221
272 3300003320 rootH2_10011232 rootH2_100112322 221
273 3300003322 rootL2_10212375 rootL2_102123752 221
274 3300003578 Ga0006562J51391_1001475 Ga0006562J51391_10014754 221
275 3300003578 Ga0006562J51391_1001477 Ga0006562J51391_10014775 221
276 3300005262 Ga0065165_1002346 Ga0065165_10023466 221
277 3300005457 Ga0070662_100062886 Ga0070662_1000628862 221
278 3300005563 Ga0068855_100016003 Ga0068855_1000160032 221
279 3300005578 Ga0068854_100000218 Ga0068854_10000021836 221
280 3300005834 Ga0068851_10003047 Ga0068851_100030477 221
281 3300009093 Ga0105240_10019848 Ga0105240_100198488 221
282 3300009093 Ga0105240_10699162 Ga0105240_106991622 221
283 3300013105 Ga0157369_10367677 Ga0157369_103676772 221
284 3300015685 Ga0183369_1003 Ga0183369_1003162 221
285 3300025297 Ga0209758_1002311 Ga0209758_10023117 221
286 3300025321 Ga0207656_10044863 Ga0207656_100448632 221
287 3300025904 Ga0207647_10044398 Ga0207647_100443982 221
288 3300025911 Ga0207654_10116353 Ga0207654_101163531 221
289 3300025913 Ga0207695_10021909 Ga0207695_100219092 221
290 3300025913 Ga0207695_10027120 Ga0207695_100271202 221
291 3300025949 Ga0207667_10000344 Ga0207667_1000034441 221
292 3300025981 Ga0207640_10002077 Ga0207640_1000207710 221
293 3300044672 Ga0466982_0000007 Ga0466982_0000007_212878_213543 221
294 3300044706 Ga0466964_0001144 Ga0466964_0001144_3014_3679 221
295 3300044719 Ga0466971_0001520 Ga0466971_0001520_6828_7493 221
296 3300044735 Ga0466968_0002636 Ga0466968_0002636_1716_2381 221
297 3300044765 Ga0466970_0408239 Ga0466970_0408239_50_715 221
298 3300044901 Ga0466960_0003797 Ga0466960_0003797_3568_4233 221
299 3300049580 Ga0501046_0149780 Ga0501046_0149780_655_1323 221
300 3300049822 Ga0501035_0092550 Ga0501035_0092550_397_1065 221
301 3300049822 Ga0501035_0327421 Ga0501035_0327421_318_986 221
302 3300049823 Ga0501044_0316406 Ga0501044_0316406_210_878 221
303 3300049823 Ga0501044_0410362 Ga0501044_0410362_393_1061 221
304 3300061719 Ga0466962_0001170 Ga0466962_0001170_9736_10401 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

48

114

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

37

113

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

41

119

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9869 6 218
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9778 6 218
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.973 5 218
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9721 5 219
2cz2-assembly1.cif.gz_A-2 crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) 0.969 5 219
ID Description Score Start End Superfamily
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9848 89 218 1.20.1050.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9818 8 75 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9783 5 82 3.40.30.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9774 89 218 1.20.1050.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9764 8 83 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A523JPW8-F1-model_v4 Maleylacetoacetate isomerase 0.9975 6 100 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A0Q4H1E7-F1-model_v4 Maleylacetoacetate isomerase 0.9951 6 218 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A1F3ZLJ3-F1-model_v4 Maleylacetoacetate isomerase 0.9943 6 218 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A0M9I1N3-F1-model_v4 deleted 0.9933 6 218
AF-A0A1G3HVQ6-F1-model_v4 Maleylacetoacetate isomerase 0.9931 6 162 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
95.94 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map