F397789

General Info

Members Datasets Scaffolds Average Seq Length
304 169 608 316

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0173249|Ga0501036_0173249_124_1134
Length 328
Sequence MFENLPFFFPEQASAQAGQVDAVYFFLVAVSAFFSVFAVKYRRRNDEQIGAAIHGSLVLELLWTFIPLGIVMIMFAWGAKVFFDLHRPPPGAMEVFVVGKQWMWKVQHLDGQREINELHVPVGRPVKLIMGSEDVLHSYYIPAFRVKADVVPGRYNTLWFTATKPGQYHLFCAEYCGTKHSGMIGSIVAMEPTDFQKWLSGGRAEDSPAAAGAKLFQDLVCNTCHMGDTQGRGPVLTGVYGKPVQLEGGGTVIADDAYIRESIVNPQAKIVAGFQPIMPTFQGLVTEEQLLQLIAYVRSLGSQGAAPSPSGTAAPTMPQNTSTPGNKR

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
112 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
113 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 5.59
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0173249 3300049572 Bacteria 1818
2 Ga0065712_10006053 3300005290 Bacteria 4589
3 Ga0065712_10014902 3300005290 Bacteria 1569
4 Ga0065712_10068753 3300005290 Bacteria 9147
5 Ga0065712_10098664 3300005290 Bacteria 2113
6 Ga0065715_10010201 3300005293 Bacteria 4637
7 Ga0065715_10029392 3300005293 Bacteria 1996
8 Ga0065715_10031332 3300005293 Bacteria 1265
9 Ga0065715_10098013 3300005293 Bacteria 3575
10 Ga0065715_10115744 3300005293 Bacteria 2405
11 Ga0065715_10152717 3300005293 Bacteria 1704
12 Ga0065707_10097888 3300005295 Bacteria 3109
13 Ga0070676_10028787 3300005328 Bacteria 3156
14 Ga0070683_100019136 3300005329 Bacteria 6077
15 Ga0070683_100024420 3300005329 Bacteria 5414
16 Ga0070683_100066395 3300005329 Bacteria 3361
17 Ga0070690_100011506 3300005330 Bacteria 5176
18 Ga0070670_100019615 3300005331 Bacteria 5804
19 Ga0070670_100033626 3300005331 Bacteria 4416
20 Ga0070670_100138096 3300005331 Bacteria 2107
21 Ga0070670_100290760 3300005331 Bacteria 1428
22 Ga0070677_10153531 3300005333 Bacteria 1074
23 Ga0068869_100056450 3300005334 Bacteria 2864
24 Ga0070666_10056361 3300005335 Bacteria 2654
25 Ga0068868_100072673 3300005338 Bacteria 2744
26 Ga0070689_100025086 3300005340 Bacteria 4477
27 Ga0070661_100193671 3300005344 Bacteria 1551
28 Ga0070669_100016181 3300005353 Bacteria 5320
29 Ga0070669_100025590 3300005353 Bacteria 4239
30 Ga0070675_100082354 3300005354 Bacteria 2685
31 Ga0070671_100186828 3300005355 Bacteria 1756
32 Ga0070674_100002687 3300005356 Bacteria 9845
33 Ga0070674_100141867 3300005356 Bacteria 1804
34 Ga0070674_100280317 3300005356 Bacteria 1321
35 Ga0070673_100001367 3300005364 Bacteria 14268
36 Ga0070673_100067900 3300005364 Bacteria 2853
37 Ga0070667_100198191 3300005367 Bacteria 1781
38 Ga0070667_100371556 3300005367 Bacteria 1297
39 Ga0070709_10044907 3300005434 Bacteria 2739
40 Ga0070713_100024748 3300005436 Bacteria 4683
41 Ga0070701_10012849 3300005438 Bacteria 3789
42 Ga0070678_100105065 3300005456 Bacteria 2198
43 Ga0070662_100071530 3300005457 Bacteria 2558
44 Ga0070662_100113814 3300005457 Bacteria 2065
45 Ga0070681_10401534 3300005458 Bacteria 1282
46 Ga0070681_10483586 3300005458 Bacteria 1151
47 Ga0070706_100136915 3300005467 Bacteria 2285
48 Ga0070699_100007883 3300005518 Bacteria 9254
49 Ga0070684_100015869 3300005535 Bacteria 6147
50 Ga0070672_100019537 3300005543 Bacteria 4919
51 Ga0070672_100034947 3300005543 Unclassified 3817
52 Ga0070672_100106800 3300005543 Bacteria 2278
53 Ga0070672_100347957 3300005543 Bacteria 1263
54 Ga0070686_100143857 3300005544 Bacteria 1663
55 Ga0070704_100098648 3300005549 Bacteria 2195
56 Ga0070664_100024159 3300005564 Bacteria 5026
57 Ga0070664_100081973 3300005564 Bacteria 2781
58 Ga0068857_100192097 3300005577 Bacteria 1860
59 Ga0070702_100011494 3300005615 Bacteria 4404
60 Ga0070702_100280914 3300005615 Bacteria 1143
61 Ga0068859_100084540 3300005617 Bacteria 3218
62 Ga0068864_100129307 3300005618 Bacteria 2267
63 Ga0068866_10083797 3300005718 Bacteria 1719
64 Ga0068862_100101378 3300005844 Bacteria 2518
65 Ga0068862_100103800 3300005844 Bacteria 2490
66 Ga0075365_10015716 3300006038 Bacteria 4584
67 Ga0075364_10096069 3300006051 Bacteria 1970
68 Ga0075367_10078988 3300006178 Bacteria 1988
69 Ga0097621_100276337 3300006237 Bacteria 1477
70 Ga0075428_100002397 3300006844 Bacteria 20349
71 Ga0075428_100004241 3300006844 Bacteria 15786
72 Ga0075428_100333130 3300006844 Bacteria 1630
73 Ga0075430_100000820 3300006846 Bacteria 24262
74 Ga0075430_100003080 3300006846 Bacteria 13926
75 Ga0075430_100043677 3300006846 Bacteria 3789
76 Ga0075430_100194631 3300006846 Bacteria 1685
77 Ga0075431_100018806 3300006847 Bacteria 7039
78 Ga0075431_100029475 3300006847 Bacteria 5650
79 Ga0075433_10003978 3300006852 Bacteria 11436
80 Ga0075433_10008532 3300006852 Bacteria 8173
81 Ga0075433_10131632 3300006852 Bacteria 2222
82 Ga0075429_100015251 3300006880 Bacteria 6658
83 Ga0075429_100132420 3300006880 Bacteria 2181
84 Ga0068865_100045510 3300006881 Bacteria 3008
85 Ga0097620_100084549 3300006931 Bacteria 3218
86 Ga0075435_100002073 3300007076 Bacteria 13146
87 Ga0075435_100055808 3300007076 Bacteria 3192
88 Ga0075435_100061996 3300007076 Bacteria 3034
89 Ga0111539_10002799 3300009094 Bacteria 23156
90 Ga0111539_10119487 3300009094 Bacteria 3089
91 Ga0111539_10141335 3300009094 Bacteria 2818
92 Ga0111539_10281409 3300009094 Bacteria 1935
93 Ga0111539_10499442 3300009094 Bacteria 1417
94 Ga0105247_10279739 3300009101 Bacteria 1151
95 Ga0114129_10003440 3300009147 Bacteria 22260
96 Ga0114129_10006116 3300009147 Bacteria 17071
97 Ga0114129_10012984 3300009147 Bacteria 11859
98 Ga0114129_10023521 3300009147 Bacteria 8733
99 Ga0114129_10223130 3300009147 Bacteria 2541
100 Ga0105242_10005588 3300009176 Bacteria 9701
101 Ga0105248_10203608 3300009177 Bacteria 2230
102 Ga0105249_10001631 3300009553 Bacteria 19642
103 Ga0105249_10171907 3300009553 Bacteria 2102
104 Ga0105249_10214686 3300009553 Bacteria 1890
105 Ga0105239_10058216 3300010375 Bacteria 4240
106 Ga0157378_10105909 3300013297 Bacteria 2572
107 Ga0157378_10212495 3300013297 Bacteria 1835
108 Ga0163162_10312551 3300013306 Bacteria 1704
109 Ga0163163_10094617 3300014325 Bacteria 3006
110 Ga0163163_10126584 3300014325 Bacteria 2593
111 Ga0157380_10164744 3300014326 Bacteria 1930
112 Ga0157379_10159117 3300014968 Bacteria 2038
113 Ga0207697_10000903 3300025315 Bacteria 16780
114 Ga0207645_10005532 3300025907 Bacteria 9148
115 Ga0207643_10050441 3300025908 Bacteria 2359
116 Ga0207684_10278444 3300025910 Bacteria 1443
117 Ga0207707_10309584 3300025912 Bacteria 1365
118 Ga0207707_10436879 3300025912 Bacteria 1121
119 Ga0207663_10182761 3300025916 Bacteria 1499
120 Ga0207657_10090833 3300025919 Bacteria 2548
121 Ga0207681_10033905 3300025923 Bacteria 3352
122 Ga0207650_10012581 3300025925 Bacteria 5839
123 Ga0207650_10014894 3300025925 Bacteria 5410
124 Ga0207650_10057984 3300025925 Bacteria 2882
125 Ga0207650_10285026 3300025925 Bacteria 1346
126 Ga0207659_10144830 3300025926 Bacteria 1849
127 Ga0207659_10200653 3300025926 Bacteria 1593
128 Ga0207687_10391491 3300025927 Bacteria 1141
129 Ga0207700_10070980 3300025928 Bacteria 2680
130 Ga0207644_10023383 3300025931 Bacteria 4233
131 Ga0207690_10133048 3300025932 Bacteria 1823
132 Ga0207706_10020799 3300025933 Bacteria 5894
133 Ga0207706_10051219 3300025933 Bacteria 3646
134 Ga0207706_10109722 3300025933 Bacteria 2428
135 Ga0207669_10077612 3300025937 Bacteria 2113
136 Ga0207704_10056194 3300025938 Bacteria 2410
137 Ga0207704_10205293 3300025938 Bacteria 1446
138 Ga0207691_10001855 3300025940 Bacteria 20651
139 Ga0207691_10098126 3300025940 Bacteria 2617
140 Ga0207691_10139894 3300025940 Bacteria 2134
141 Ga0207691_10225253 3300025940 Bacteria 1625
142 Ga0207711_10020787 3300025941 Bacteria 5477
143 Ga0207689_10037405 3300025942 Bacteria 4025
144 Ga0207661_10001184 3300025944 Bacteria 17452
145 Ga0207661_10024745 3300025944 Bacteria 4554
146 Ga0207679_10058541 3300025945 Bacteria 2856
147 Ga0207651_10001825 3300025960 Bacteria 9920
148 Ga0207651_10049389 3300025960 Bacteria 2850
149 Ga0207703_10078232 3300026035 Bacteria 2747
150 Ga0207678_10062864 3300026067 Bacteria 3190
151 Ga0207708_10001705 3300026075 Bacteria 16254
152 Ga0207708_10102744 3300026075 Bacteria 2213
153 Ga0207708_10124938 3300026075 Bacteria 2007
154 Ga0207648_10009413 3300026089 Bacteria 9359
155 Ga0207676_10195428 3300026095 Bacteria 1784
156 Ga0207674_10029219 3300026116 Bacteria 5806
157 Ga0207675_100021642 3300026118 Bacteria 5987
158 Ga0207683_10076284 3300026121 Bacteria 2967
159 Ga0207683_10220275 3300026121 Bacteria 1729
160 Ga0207428_10000518 3300027907 Bacteria 46060
161 Ga0207428_10055876 3300027907 Bacteria 3137
162 Ga0207428_10113034 3300027907 Unclassified 2088
163 Ga0268265_10085363 3300028380 Bacteria 2505
164 Ga0268265_10386491 3300028380 Bacteria 1289
165 Ga0268265_10451020 3300028380 Bacteria 1201
166 Ga0307408_100008260 3300031548 Bacteria 6871
167 Ga0307408_100030739 3300031548 Bacteria 3732
168 Ga0307408_100033046 3300031548 Bacteria 3611
169 Ga0307408_100057311 3300031548 Bacteria 2828
170 Ga0307408_100063044 3300031548 Bacteria 2711
171 Ga0307408_100067261 3300031548 Bacteria 2634
172 Ga0307408_100174392 3300031548 Bacteria 1719
173 Ga0307405_10083995 3300031731 Bacteria 2089
174 Ga0307413_10008706 3300031824 Bacteria 4810
175 Ga0307410_10012396 3300031852 Bacteria 4929
176 Ga0307410_10163683 3300031852 Bacteria 1669
177 Ga0307412_10061277 3300031911 Bacteria 2529
178 Ga0307412_10330163 3300031911 Bacteria 1217
179 Ga0307409_100037781 3300031995 Bacteria 3563
180 Ga0307409_100095927 3300031995 Unclassified 2445
181 Ga0307409_100283811 3300031995 Bacteria 1532
182 Ga0307409_100406863 3300031995 Bacteria 1301
183 Ga0307416_100004530 3300032002 Bacteria 8392
184 Ga0307416_100094663 3300032002 Bacteria 2576
185 Ga0307416_100136876 3300032002 Bacteria 2218
186 Ga0307416_100198598 3300032002 Bacteria 1900
187 Ga0307416_100673099 3300032002 Bacteria 1122
188 Ga0307414_10046259 3300032004 Bacteria 2986
189 Ga0307411_10009206 3300032005 Bacteria 5175
190 Ga0307415_100011952 3300032126 Bacteria 4998
191 Ga0307415_100060689 3300032126 Bacteria 2614
192 Ga0307415_100372217 3300032126 Bacteria 1210
193 Ga0373943_0055596 3300035170 Bacteria 1961
194 Ga0373925_0006140 3300037068 Bacteria 8873
195 Ga0439431_0005275 3300041997 Bacteria 2851
196 Ga0439433_0013820 3300041999 Bacteria 1775
197 Ga0439441_004761 3300042001 Bacteria 2074
198 Ga0439445_0041152 3300042004 Bacteria 1228
199 Ga0439450_041427 3300042008 Bacteria 1070
200 Ga0439446_0023429 3300042156 Bacteria 1757
201 Ga0439435_0014837 3300042436 Bacteria 1930
202 Ga0439464_0002388 3300042439 Bacteria 4614
203 Ga0439460_0025216 3300042461 Bacteria 1654
204 Ga0451577_0017416 3300042876 Bacteria 6639
205 Ga0453684_0421175 3300044712 Bacteria 1491
206 Ga0466967_0102799 3300045976 Bacteria 2614
207 Ga0495603_0037596 3300046455 Bacteria 2905
208 Ga0496100_0294353 3300048903 Bacteria 1213
209 Ga0496102_0270419 3300048905 Bacteria 1602
210 Ga0496104_0018597 3300048907 Bacteria 6342
211 Ga0496106_0061684 3300048909 Bacteria 2845
212 Ga0496106_0121173 3300048909 Bacteria 2045
213 Ga0496108_0171579 3300048911 Bacteria 1877
214 Ga0496109_0001663 3300048912 Bacteria 18543
215 Ga0496110_0038212 3300048913 Bacteria 4175
216 Ga0496110_0201859 3300048913 Bacteria 1807
217 Ga0496111_0019769 3300048914 Bacteria 4684
218 Ga0496111_0135377 3300048914 Bacteria 1825
219 Ga0496112_0038353 3300048915 Bacteria 4677
220 Ga0496112_0178693 3300048915 Bacteria 2086
221 Ga0496112_0265529 3300048915 Bacteria 1665
222 Ga0496112_0299256 3300048915 Bacteria 1554
223 Ga0496113_0089300 3300048916 Bacteria 2372
224 Ga0496114_0149105 3300048917 Bacteria 2029
225 Ga0501036_0011290 3300049572 Bacteria 7391
226 Ga0501036_0037738 3300049572 Bacteria 4087
227 Ga0501036_0093194 3300049572 Bacteria 2545
228 Ga0501039_0109319 3300049575 Bacteria 2161
229 Ga0501039_0229264 3300049575 Bacteria 1460
230 Ga0501041_0124560 3300049577 Bacteria 1603
231 Ga0501043_0280186 3300049579 Unclassified 1278
232 Ga0501046_0240416 3300049580 Bacteria 1336
233 Ga0501048_0017885 3300049582 Bacteria 5215
234 Ga0501068_0214419 3300049584 Bacteria 1223
235 Ga0501070_0241973 3300049586 Bacteria 1477
236 Ga0501071_0055010 3300049587 Bacteria 2872
237 Ga0501071_0072687 3300049587 Bacteria 2508
238 Ga0501071_0077265 3300049587 Bacteria 2432
239 Ga0501071_0163035 3300049587 Bacteria 1667
240 Ga0501072_0030777 3300049588 Bacteria 4199
241 Ga0501072_0269975 3300049588 Bacteria 1353
242 Ga0501072_0314585 3300049588 Bacteria 1244
243 Ga0501073_0162165 3300049589 Bacteria 1549
244 Ga0501074_0221882 3300049590 Bacteria 1346
245 Ga0501075_0008784 3300049591 Bacteria 7042
246 Ga0501076_0018833 3300049592 Bacteria 5268
247 Ga0501076_0177818 3300049592 Bacteria 1734
248 Ga0501076_0419905 3300049592 Bacteria 1100
249 Ga0501077_0063377 3300049593 Bacteria 2345
250 Ga0501077_0110082 3300049593 Bacteria 1745
251 Ga0501079_0035289 3300049741 Bacteria 3849
252 Ga0501079_0059057 3300049741 Bacteria 2959
253 Ga0501080_0111486 3300049742 Bacteria 2536
254 Ga0501081_0033872 3300049743 Bacteria 3473
255 Ga0501081_0051466 3300049743 Bacteria 2841
256 Ga0501081_0097106 3300049743 Bacteria 2079
257 Ga0501083_0074453 3300049744 Bacteria 2256
258 Ga0501045_0033131 3300049824 Bacteria 3746
259 Ga0501045_0218994 3300049824 Bacteria 1418
260 Ga0501045_0230617 3300049824 Bacteria 1378
261 nmdc:mga00v17_6197_c1 3300050491 Bacteria 6342
262 nmdc:mga00v17_71378_c1 3300050491 Bacteria 2152
263 nmdc:mga00v17_9076_c1 3300050491 Bacteria 5368
264 nmdc:mga0yw44_1915_c1 3300050492 Bacteria 8595
265 nmdc:mga07m45_30038_c1 3300050496 Bacteria 3009
266 nmdc:mga05p37_114338_c1 3300050507 Bacteria 3318
267 nmdc:mga05p37_163122_c1 3300050507 Bacteria 2721
268 nmdc:mga05p37_3545_c1 3300050507 Bacteria 18216
269 nmdc:mga05p37_36705_c1 3300050507 Bacteria 6011
270 nmdc:mga09592_21879_c1 3300050508 Bacteria 5273
271 nmdc:mga09592_48333_c1 3300050508 Bacteria 3586
272 nmdc:mga0qj67_152975_c1 3300050509 Bacteria 1872
273 nmdc:mga0qj67_169457_c1 3300050509 Bacteria 1773
274 nmdc:mga0qj67_3125_c1 3300050509 Bacteria 11918
275 nmdc:mga0qj67_76601_c1 3300050509 Bacteria 2675
276 nmdc:mga06r32_117234_c1 3300050510 Bacteria 2624
277 nmdc:mga06r32_120580_c1 3300050510 Bacteria 2586
278 nmdc:mga06r32_68453_c1 3300050510 Bacteria 3430
279 nmdc:mga08y16_199627_c1 3300050511 Bacteria 2073
280 nmdc:mga08y16_28024_c1 3300050511 Bacteria 5938
281 nmdc:mga08y16_29705_c1 3300050511 Bacteria 5755
282 nmdc:mga08y16_407716_c1 3300050511 Bacteria 1390
283 nmdc:mga08y16_91480_c1 3300050511 Bacteria 3171
284 nmdc:mga0n895_5649_c1 3300050512 Bacteria 10482
285 nmdc:mga0rr50_57068_c1 3300050513 Bacteria 2919
286 nmdc:mga08x19_86374_c1 3300050514 Bacteria 2065
287 nmdc:mga08x19_9975_c1 3300050514 Bacteria 5694
288 nmdc:mga0a205_236388_c1 3300050515 Bacteria 1709
289 nmdc:mga0a205_264086_c1 3300050515 Bacteria 1599
290 nmdc:mga0a205_39297_c1 3300050515 Bacteria 4555
291 nmdc:mga0a205_5842_c1 3300050515 Bacteria 11084
292 nmdc:mga0a205_92386_c1 3300050515 Bacteria 2924
293 Ga0501084_0009049 3300054114 Bacteria 8239
294 Ga0501084_0161484 3300054114 Bacteria 1890
295 Ga0501084_0202906 3300054114 Bacteria 1673
296 Ga0590071_003447 3300059421 Bacteria 3884
297 Ga0590071_008759 3300059421 Bacteria 2378
298 Ga0590074_008324 3300059423 Bacteria 1726
299 Ga0590074_013946 3300059423 Bacteria 1359
300 Ga0590075_000106 3300059424 Bacteria 21524
301 Ga0590075_007659 3300059424 Bacteria 2571
302 Ga0590077_001138 3300059426 Bacteria 6500
303 Ga0501082_0114004 3300060353 Bacteria 2341
304 Ga0501082_0215563 3300060353 Bacteria 1670
305 Ga0501036_0173249
306 Ga0065712_10006053
307 Ga0065712_10014902
308 Ga0065712_10068753
309 Ga0065712_10098664
310 Ga0065715_10010201
311 Ga0065715_10029392
312 Ga0065715_10031332
313 Ga0065715_10098013
314 Ga0065715_10115744
315 Ga0065715_10152717
316 Ga0065707_10097888
317 Ga0070676_10028787
318 Ga0070683_100019136
319 Ga0070683_100024420
320 Ga0070683_100066395
321 Ga0070690_100011506
322 Ga0070670_100019615
323 Ga0070670_100033626
324 Ga0070670_100138096
325 Ga0070670_100290760
326 Ga0070677_10153531
327 Ga0068869_100056450
328 Ga0070666_10056361
329 Ga0068868_100072673
330 Ga0070689_100025086
331 Ga0070661_100193671
332 Ga0070669_100016181
333 Ga0070669_100025590
334 Ga0070675_100082354
335 Ga0070671_100186828
336 Ga0070674_100002687
337 Ga0070674_100141867
338 Ga0070674_100280317
339 Ga0070673_100001367
340 Ga0070673_100067900
341 Ga0070667_100198191
342 Ga0070667_100371556
343 Ga0070709_10044907
344 Ga0070713_100024748
345 Ga0070701_10012849
346 Ga0070678_100105065
347 Ga0070662_100071530
348 Ga0070662_100113814
349 Ga0070681_10401534
350 Ga0070681_10483586
351 Ga0070706_100136915
352 Ga0070699_100007883
353 Ga0070684_100015869
354 Ga0070672_100019537
355 Ga0070672_100034947
356 Ga0070672_100106800
357 Ga0070672_100347957
358 Ga0070686_100143857
359 Ga0070704_100098648
360 Ga0070664_100024159
361 Ga0070664_100081973
362 Ga0068857_100192097
363 Ga0070702_100011494
364 Ga0070702_100280914
365 Ga0068859_100084540
366 Ga0068864_100129307
367 Ga0068866_10083797
368 Ga0068862_100101378
369 Ga0068862_100103800
370 Ga0075365_10015716
371 Ga0075364_10096069
372 Ga0075367_10078988
373 Ga0097621_100276337
374 Ga0075428_100002397
375 Ga0075428_100004241
376 Ga0075428_100333130
377 Ga0075430_100000820
378 Ga0075430_100003080
379 Ga0075430_100043677
380 Ga0075430_100194631
381 Ga0075431_100018806
382 Ga0075431_100029475
383 Ga0075433_10003978
384 Ga0075433_10008532
385 Ga0075433_10131632
386 Ga0075429_100015251
387 Ga0075429_100132420
388 Ga0068865_100045510
389 Ga0097620_100084549
390 Ga0075435_100002073
391 Ga0075435_100055808
392 Ga0075435_100061996
393 Ga0111539_10002799
394 Ga0111539_10119487
395 Ga0111539_10141335
396 Ga0111539_10281409
397 Ga0111539_10499442
398 Ga0105247_10279739
399 Ga0114129_10003440
400 Ga0114129_10006116
401 Ga0114129_10012984
402 Ga0114129_10023521
403 Ga0114129_10223130
404 Ga0105242_10005588
405 Ga0105248_10203608
406 Ga0105249_10001631
407 Ga0105249_10171907
408 Ga0105249_10214686
409 Ga0105239_10058216
410 Ga0157378_10105909
411 Ga0157378_10212495
412 Ga0163162_10312551
413 Ga0163163_10094617
414 Ga0163163_10126584
415 Ga0157380_10164744
416 Ga0157379_10159117
417 Ga0207697_10000903
418 Ga0207645_10005532
419 Ga0207643_10050441
420 Ga0207684_10278444
421 Ga0207707_10309584
422 Ga0207707_10436879
423 Ga0207663_10182761
424 Ga0207657_10090833
425 Ga0207681_10033905
426 Ga0207650_10012581
427 Ga0207650_10014894
428 Ga0207650_10057984
429 Ga0207650_10285026
430 Ga0207659_10144830
431 Ga0207659_10200653
432 Ga0207687_10391491
433 Ga0207700_10070980
434 Ga0207644_10023383
435 Ga0207690_10133048
436 Ga0207706_10020799
437 Ga0207706_10051219
438 Ga0207706_10109722
439 Ga0207669_10077612
440 Ga0207704_10056194
441 Ga0207704_10205293
442 Ga0207691_10001855
443 Ga0207691_10098126
444 Ga0207691_10139894
445 Ga0207691_10225253
446 Ga0207711_10020787
447 Ga0207689_10037405
448 Ga0207661_10001184
449 Ga0207661_10024745
450 Ga0207679_10058541
451 Ga0207651_10001825
452 Ga0207651_10049389
453 Ga0207703_10078232
454 Ga0207678_10062864
455 Ga0207708_10001705
456 Ga0207708_10102744
457 Ga0207708_10124938
458 Ga0207648_10009413
459 Ga0207676_10195428
460 Ga0207674_10029219
461 Ga0207675_100021642
462 Ga0207683_10076284
463 Ga0207683_10220275
464 Ga0207428_10000518
465 Ga0207428_10055876
466 Ga0207428_10113034
467 Ga0268265_10085363
468 Ga0268265_10386491
469 Ga0268265_10451020
470 Ga0307408_100008260
471 Ga0307408_100030739
472 Ga0307408_100033046
473 Ga0307408_100057311
474 Ga0307408_100063044
475 Ga0307408_100067261
476 Ga0307408_100174392
477 Ga0307405_10083995
478 Ga0307413_10008706
479 Ga0307410_10012396
480 Ga0307410_10163683
481 Ga0307412_10061277
482 Ga0307412_10330163
483 Ga0307409_100037781
484 Ga0307409_100095927
485 Ga0307409_100283811
486 Ga0307409_100406863
487 Ga0307416_100004530
488 Ga0307416_100094663
489 Ga0307416_100136876
490 Ga0307416_100198598
491 Ga0307416_100673099
492 Ga0307414_10046259
493 Ga0307411_10009206
494 Ga0307415_100011952
495 Ga0307415_100060689
496 Ga0307415_100372217
497 Ga0373943_0055596
498 Ga0373925_0006140
499 Ga0439431_0005275
500 Ga0439433_0013820
501 Ga0439441_004761
502 Ga0439445_0041152
503 Ga0439450_041427
504 Ga0439446_0023429
505 Ga0439435_0014837
506 Ga0439464_0002388
507 Ga0439460_0025216
508 Ga0451577_0017416
509 Ga0453684_0421175
510 Ga0466967_0102799
511 Ga0495603_0037596
512 Ga0496100_0294353
513 Ga0496102_0270419
514 Ga0496104_0018597
515 Ga0496106_0061684
516 Ga0496106_0121173
517 Ga0496108_0171579
518 Ga0496109_0001663
519 Ga0496110_0038212
520 Ga0496110_0201859
521 Ga0496111_0019769
522 Ga0496111_0135377
523 Ga0496112_0038353
524 Ga0496112_0178693
525 Ga0496112_0265529
526 Ga0496112_0299256
527 Ga0496113_0089300
528 Ga0496114_0149105
529 Ga0501036_0011290
530 Ga0501036_0037738
531 Ga0501036_0093194
532 Ga0501039_0109319
533 Ga0501039_0229264
534 Ga0501041_0124560
535 Ga0501043_0280186
536 Ga0501046_0240416
537 Ga0501048_0017885
538 Ga0501068_0214419
539 Ga0501070_0241973
540 Ga0501071_0055010
541 Ga0501071_0072687
542 Ga0501071_0077265
543 Ga0501071_0163035
544 Ga0501072_0030777
545 Ga0501072_0269975
546 Ga0501072_0314585
547 Ga0501073_0162165
548 Ga0501074_0221882
549 Ga0501075_0008784
550 Ga0501076_0018833
551 Ga0501076_0177818
552 Ga0501076_0419905
553 Ga0501077_0063377
554 Ga0501077_0110082
555 Ga0501079_0035289
556 Ga0501079_0059057
557 Ga0501080_0111486
558 Ga0501081_0033872
559 Ga0501081_0051466
560 Ga0501081_0097106
561 Ga0501083_0074453
562 Ga0501045_0033131
563 Ga0501045_0218994
564 Ga0501045_0230617
565 nmdc:mga00v17_6197_c1
566 nmdc:mga00v17_71378_c1
567 nmdc:mga00v17_9076_c1
568 nmdc:mga0yw44_1915_c1
569 nmdc:mga07m45_30038_c1
570 nmdc:mga05p37_114338_c1
571 nmdc:mga05p37_163122_c1
572 nmdc:mga05p37_3545_c1
573 nmdc:mga05p37_36705_c1
574 nmdc:mga09592_21879_c1
575 nmdc:mga09592_48333_c1
576 nmdc:mga0qj67_152975_c1
577 nmdc:mga0qj67_169457_c1
578 nmdc:mga0qj67_3125_c1
579 nmdc:mga0qj67_76601_c1
580 nmdc:mga06r32_117234_c1
581 nmdc:mga06r32_120580_c1
582 nmdc:mga06r32_68453_c1
583 nmdc:mga08y16_199627_c1
584 nmdc:mga08y16_28024_c1
585 nmdc:mga08y16_29705_c1
586 nmdc:mga08y16_407716_c1
587 nmdc:mga08y16_91480_c1
588 nmdc:mga0n895_5649_c1
589 nmdc:mga0rr50_57068_c1
590 nmdc:mga08x19_86374_c1
591 nmdc:mga08x19_9975_c1
592 nmdc:mga0a205_236388_c1
593 nmdc:mga0a205_264086_c1
594 nmdc:mga0a205_39297_c1
595 nmdc:mga0a205_5842_c1
596 nmdc:mga0a205_92386_c1
597 Ga0501084_0009049
598 Ga0501084_0161484
599 Ga0501084_0202906
600 Ga0590071_003447
601 Ga0590071_008759
602 Ga0590074_008324
603 Ga0590074_013946
604 Ga0590075_000106
605 Ga0590075_007659
606 Ga0590077_001138
607 Ga0501082_0114004
608 Ga0501082_0215563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

112

190

0.94

PF13473

Cupredoxin_1

Cupredoxin-like domain

82

188

0.88

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

207

297

0.78

PF00034

Cytochrom_C

Cytochrome c

209

301

0.76

Map