F397288

General Info

Members Datasets Scaffolds Average Seq Length
303 165 606 250

Family's Representative Sequence

Representative Sequence 3300049674|Ga0501242_000389|Ga0501242_000389_264_1103
Length 279
Sequence VKFQLLPSTFDDTGCSSQRQHLTSFVIDDSVAIDAGSLAFAASDLQRRQVRDIILTHAHLDHVAGLPLFVDDLFSELREPICIHASEHVIEVLERDIFNWSVYPRFSELSNSFGRVLEYRPLVANVESRIRHLTVRPIEVNHKVPSTGFVISHEGSTVVLTGDTAEMDTFWNEVNSIDNLSTLLVECAFPDELEELALSSFHMTPRRLSRELEKFRASECPVYAINIKPRFRERTIEQLSEIGYERLECCAGSSKVRKHPGGAHRGNHKVRRAHLGGHS

Samples

Sample ID Description Type Environment
1 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
140 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
143 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
149 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
155 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
160 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
161 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
162 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 1.32
Rhizosphere 97.03
Stem 0
Stem Tuber 0
Unclassified 23.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501242_000389 3300049674 Bacteria 3727
2 Ga0065712_10261495 3300005290 Unclassified 936
3 Ga0065715_10003117 3300005293 Bacteria 4836
4 Ga0065715_10121529 3300005293 Bacteria 2213
5 Ga0065715_10180276 3300005293 Unclassified 1476
6 Ga0070658_10000547 3300005327 Bacteria 32575
7 Ga0070676_10031519 3300005328 Bacteria 3030
8 Ga0070676_10411061 3300005328 Bacteria 944
9 Ga0070683_100283033 3300005329 Unclassified 1577
10 Ga0070683_100686593 3300005329 Unclassified 980
11 Ga0070690_100529658 3300005330 Unclassified 885
12 Ga0070670_100037184 3300005331 Bacteria 4188
13 Ga0070677_10004615 3300005333 Bacteria 4506
14 Ga0068869_100370778 3300005334 Unclassified 1171
15 Ga0070680_100153218 3300005336 Bacteria 1936
16 Ga0070680_100238929 3300005336 Unclassified 1535
17 Ga0070689_100009168 3300005340 Bacteria 7007
18 Ga0070689_100058333 3300005340 Unclassified 2998
19 Ga0070661_100133946 3300005344 Unclassified 1863
20 Ga0070675_100046331 3300005354 Bacteria 3560
21 Ga0070675_100068965 3300005354 Bacteria 2929
22 Ga0070671_100061021 3300005355 Bacteria 3140
23 Ga0070671_100135814 3300005355 Bacteria 2073
24 Ga0070671_100184047 3300005355 Bacteria 1769
25 Ga0070674_100041140 3300005356 Bacteria 3130
26 Ga0070674_100611771 3300005356 Bacteria 922
27 Ga0070673_100116242 3300005364 Bacteria 2225
28 Ga0070673_100176556 3300005364 Bacteria 1826
29 Ga0070673_100746187 3300005364 Bacteria 901
30 Ga0070688_100009988 3300005365 Bacteria 5215
31 Ga0070659_100013611 3300005366 Bacteria 6060
32 Ga0070667_100432347 3300005367 Bacteria 1201
33 Ga0070705_100022500 3300005440 Bacteria 3370
34 Ga0070694_100177052 3300005444 Bacteria 1575
35 Ga0070662_100525547 3300005457 Bacteria 989
36 Ga0070681_10007162 3300005458 Bacteria 10863
37 Ga0070681_10007163 3300005458 Bacteria 10863
38 Ga0070685_10020224 3300005466 Bacteria 3602
39 Ga0070679_100075241 3300005530 Bacteria 3366
40 Ga0070684_100575675 3300005535 Unclassified 1046
41 Ga0068853_100085188 3300005539 Bacteria 2770
42 Ga0068853_100182499 3300005539 Bacteria 1903
43 Ga0068853_100294545 3300005539 Unclassified 1498
44 Ga0070672_100051864 3300005543 Bacteria 3201
45 Ga0070672_100321728 3300005543 Bacteria 1315
46 Ga0070672_100505257 3300005543 Unclassified 1046
47 Ga0070696_100086456 3300005546 Bacteria 2226
48 Ga0070693_100019277 3300005547 Bacteria 3573
49 Ga0070665_100097779 3300005548 Bacteria 2940
50 Ga0070704_100016942 3300005549 Bacteria 4620
51 Ga0068855_100019948 3300005563 Bacteria 8051
52 Ga0070664_100012951 3300005564 Bacteria 6786
53 Ga0070664_100169883 3300005564 Bacteria 1934
54 Ga0070664_100419348 3300005564 Bacteria 1226
55 Ga0068857_100015321 3300005577 Bacteria 6693
56 Ga0068857_100057124 3300005577 Unclassified 3464
57 Ga0068854_100075083 3300005578 Bacteria 2481
58 Ga0068854_100075468 3300005578 Bacteria 2476
59 Ga0068854_100106888 3300005578 Bacteria 2106
60 Ga0068852_100163970 3300005616 Bacteria 2077
61 Ga0068852_100393786 3300005616 Bacteria 1361
62 Ga0068859_100196109 3300005617 Bacteria 2104
63 Ga0068859_100456762 3300005617 Bacteria 1373
64 Ga0068864_100015776 3300005618 Bacteria 6285
65 Ga0068864_100022496 3300005618 Bacteria 5286
66 Ga0068864_100064904 3300005618 Bacteria 3167
67 Ga0068861_100036014 3300005719 Bacteria 3670
68 Ga0068861_100126216 3300005719 Unclassified 2070
69 Ga0068870_10011880 3300005840 Bacteria 4053
70 Ga0068863_100019652 3300005841 Bacteria 6461
71 Ga0068863_100024967 3300005841 Bacteria 5700
72 Ga0068863_100081653 3300005841 Bacteria 3062
73 Ga0068863_100681935 3300005841 Bacteria 1020
74 Ga0068860_100017632 3300005843 Bacteria 6956
75 Ga0068860_100445794 3300005843 Bacteria 1286
76 Ga0068862_100027640 3300005844 Bacteria 4776
77 Ga0068862_100034316 3300005844 Bacteria 4291
78 Ga0081539_10005979 3300005985 Bacteria 11984
79 Ga0097620_100196113 3300006931 Bacteria 2104
80 Ga0097620_100456740 3300006931 Bacteria 1373
81 Ga0105240_10065559 3300009093 Bacteria 4508
82 Ga0105240_10300061 3300009093 Bacteria 1838
83 Ga0111539_10088341 3300009094 Bacteria 3642
84 Ga0105245_10248843 3300009098 Bacteria 1726
85 Ga0105247_10024338 3300009101 Bacteria 3648
86 Ga0114129_10757095 3300009147 Bacteria 1243
87 Ga0114129_11002917 3300009147 Unclassified 1051
88 Ga0105243_10000578 3300009148 Bacteria 36889
89 Ga0105241_10225700 3300009174 Unclassified 1577
90 Ga0105241_10593764 3300009174 Bacteria 999
91 Ga0105242_10003479 3300009176 Bacteria 12241
92 Ga0105242_10061987 3300009176 Bacteria 3077
93 Ga0105248_10011821 3300009177 Bacteria 9630
94 Ga0105248_10042645 3300009177 Bacteria 5089
95 Ga0105237_10139824 3300009545 Unclassified 2415
96 Ga0105238_10019264 3300009551 Bacteria 6952
97 Ga0105249_10010411 3300009553 Bacteria 8172
98 Ga0105249_10022909 3300009553 Bacteria 5599
99 Ga0105249_10027287 3300009553 Bacteria 5152
100 Ga0105249_10104681 3300009553 Bacteria 2667
101 Ga0105239_10034364 3300010375 Bacteria 5567
102 Ga0157373_10043200 3300013100 Bacteria 3220
103 Ga0157371_10111253 3300013102 Bacteria 1944
104 Ga0157370_10060885 3300013104 Bacteria 3583
105 Ga0157370_10075700 3300013104 Bacteria 3172
106 Ga0157370_10079513 3300013104 Bacteria 3087
107 Ga0157369_10017659 3300013105 Bacteria 8016
108 Ga0157369_10312319 3300013105 Bacteria 1634
109 Ga0157374_10029299 3300013296 Bacteria 4983
110 Ga0157374_10166716 3300013296 Bacteria 2147
111 Ga0157378_10000001 3300013297 Bacteria 352632
112 Ga0157378_10020138 3300013297 Bacteria 5867
113 Ga0157378_10048960 3300013297 Bacteria 3759
114 Ga0157378_10346506 3300013297 Unclassified 1450
115 Ga0163162_10020652 3300013306 Bacteria 6473
116 Ga0163162_10166705 3300013306 Unclassified 2327
117 Ga0163162_10325992 3300013306 Bacteria 1668
118 Ga0163162_10440417 3300013306 Bacteria 1435
119 Ga0163162_10624555 3300013306 Bacteria 1202
120 Ga0157372_10014396 3300013307 Bacteria 8460
121 Ga0157372_10052000 3300013307 Unclassified 4560
122 Ga0157372_10052413 3300013307 Bacteria 4543
123 Ga0157372_10318439 3300013307 Bacteria 1811
124 Ga0157372_10550165 3300013307 Bacteria 1345
125 Ga0157372_10912346 3300013307 Bacteria 1019
126 Ga0157375_10012106 3300013308 Bacteria 7645
127 Ga0157375_10012385 3300013308 Bacteria 7565
128 Ga0157375_10026952 3300013308 Bacteria 5364
129 Ga0157375_10191006 3300013308 Unclassified 2203
130 Ga0157375_10361456 3300013308 Bacteria 1618
131 Ga0157375_10434762 3300013308 Bacteria 1478
132 Ga0163163_10039707 3300014325 Bacteria 4595
133 Ga0163163_10150068 3300014325 Bacteria 2375
134 Ga0163163_10326598 3300014325 Bacteria 1588
135 Ga0163163_10576349 3300014325 Bacteria 1188
136 Ga0157380_10004374 3300014326 Bacteria 9791
137 Ga0157380_10005843 3300014326 Bacteria 8613
138 Ga0157380_10017960 3300014326 Bacteria 5244
139 Ga0157380_10037237 3300014326 Bacteria 3768
140 Ga0157380_10729067 3300014326 Unclassified 1000
141 Ga0157379_10017650 3300014968 Bacteria 6285
142 Ga0157376_10025363 3300014969 Bacteria 4668
143 Ga0157376_10272604 3300014969 Bacteria 1590
144 Ga0163161_10012857 3300017792 Bacteria 5816
145 Ga0163161_10017202 3300017792 Bacteria 5056
146 Ga0163161_10100226 3300017792 Bacteria 2155
147 Ga0163161_10219356 3300017792 Unclassified 1472
148 Ga0213876_10000046 3300021384 Bacteria 150327
149 Ga0207682_10106172 3300025893 Bacteria 1232
150 Ga0207710_10009379 3300025900 Bacteria 4121
151 Ga0207680_10005973 3300025903 Bacteria 5849
152 Ga0207645_10093624 3300025907 Bacteria 1933
153 Ga0207643_10023864 3300025908 Bacteria 3375
154 Ga0207705_10007362 3300025909 Bacteria 8091
155 Ga0207654_10152303 3300025911 Unclassified 1485
156 Ga0207707_10012905 3300025912 Bacteria 7272
157 Ga0207707_10049837 3300025912 Unclassified 3648
158 Ga0207649_10090336 3300025920 Bacteria 2004
159 Ga0207652_10070010 3300025921 Bacteria 3046
160 Ga0207650_10037108 3300025925 Bacteria 3550
161 Ga0207659_10095936 3300025926 Bacteria 2225
162 Ga0207659_10310154 3300025926 Bacteria 1299
163 Ga0207644_10013828 3300025931 Bacteria 5391
164 Ga0207644_10051920 3300025931 Bacteria 2945
165 Ga0207690_10122397 3300025932 Unclassified 1892
166 Ga0207706_10014932 3300025933 Bacteria 7033
167 Ga0207670_10032626 3300025936 Bacteria 3350
168 Ga0207670_10045421 3300025936 Unclassified 2912
169 Ga0207670_10089240 3300025936 Bacteria 2175
170 Ga0207669_10016226 3300025937 Bacteria 3779
171 Ga0207704_10284519 3300025938 Bacteria 1259
172 Ga0207691_10045911 3300025940 Bacteria 4016
173 Ga0207691_10056235 3300025940 Bacteria 3584
174 Ga0207691_10065546 3300025940 Bacteria 3287
175 Ga0207711_10064288 3300025941 Bacteria 3169
176 Ga0207661_10405888 3300025944 Unclassified 1236
177 Ga0207679_10029792 3300025945 Unclassified 3804
178 Ga0207679_10095783 3300025945 Bacteria 2308
179 Ga0207679_10258824 3300025945 Unclassified 1483
180 Ga0207667_10094588 3300025949 Bacteria 3085
181 Ga0207651_10139727 3300025960 Bacteria 1869
182 Ga0207651_10492101 3300025960 Bacteria 1059
183 Ga0207712_10006170 3300025961 Bacteria 7554
184 Ga0207712_10169025 3300025961 Bacteria 1707
185 Ga0207668_10383893 3300025972 Bacteria 1183
186 Ga0207640_10075830 3300025981 Bacteria 2280
187 Ga0207640_10295822 3300025981 Unclassified 1278
188 Ga0207639_10001470 3300026041 Bacteria 15853
189 Ga0207641_10004547 3300026088 Bacteria 11990
190 Ga0207641_10060914 3300026088 Bacteria 3218
191 Ga0207641_10690680 3300026088 Bacteria 1004
192 Ga0207676_10004449 3300026095 Bacteria 9911
193 Ga0207676_10008771 3300026095 Bacteria 7196
194 Ga0207676_10081634 3300026095 Bacteria 2627
195 Ga0207676_10570334 3300026095 Unclassified 1084
196 Ga0207674_10015291 3300026116 Bacteria 8437
197 Ga0207674_10021216 3300026116 Bacteria 7002
198 Ga0207674_10106472 3300026116 Bacteria 2782
199 Ga0207675_100090541 3300026118 Bacteria 2876
200 Ga0207675_100319154 3300026118 Bacteria 1516
201 Ga0207683_10012929 3300026121 Bacteria 7127
202 Ga0207683_10334271 3300026121 Bacteria 1389
203 Ga0207683_10409318 3300026121 Unclassified 1248
204 Ga0207698_10094435 3300026142 Bacteria 2459
205 Ga0207698_10131935 3300026142 Bacteria 2136
206 Ga0207698_10218613 3300026142 Bacteria 1720
207 Ga0207698_10368916 3300026142 Bacteria 1362
208 Ga0209974_10042861 3300027876 Unclassified 1507
209 Ga0268265_10083039 3300028380 Bacteria 2535
210 Ga0268265_10117122 3300028380 Unclassified 2187
211 Ga0307513_10003212 3300031456 Bacteria 22296
212 Ga0307408_100010771 3300031548 Bacteria 6033
213 Ga0307408_100020967 3300031548 Unclassified 4418
214 Ga0307408_100282405 3300031548 Bacteria 1383
215 Ga0307405_10004421 3300031731 Bacteria 6645
216 Ga0307405_10010122 3300031731 Unclassified 4867
217 Ga0307405_10080789 3300031731 Bacteria 2123
218 Ga0307405_10141734 3300031731 Bacteria 1677
219 Ga0307413_10002026 3300031824 Bacteria 8060
220 Ga0307413_10017461 3300031824 Bacteria 3737
221 Ga0307413_10259634 3300031824 Bacteria 1294
222 Ga0307413_10299503 3300031824 Unclassified 1219
223 Ga0307410_10001887 3300031852 Bacteria 9791
224 Ga0307410_10016269 3300031852 Unclassified 4431
225 Ga0307410_10058739 3300031852 Bacteria 2623
226 Ga0307410_10130451 3300031852 Bacteria 1846
227 Ga0307410_10147095 3300031852 Bacteria 1749
228 Ga0307406_10008126 3300031901 Bacteria 5845
229 Ga0307406_10032756 3300031901 Bacteria 3175
230 Ga0307407_10013723 3300031903 Unclassified 3942
231 Ga0307407_10122441 3300031903 Bacteria 1651
232 Ga0307407_10258032 3300031903 Unclassified 1197
233 Ga0307407_10260433 3300031903 Unclassified 1193
234 Ga0307412_10035050 3300031911 Unclassified 3203
235 Ga0307412_10040703 3300031911 Bacteria 3008
236 Ga0307412_10136695 3300031911 Bacteria 1789
237 Ga0307409_100161814 3300031995 Unclassified 1958
238 Ga0307409_100307538 3300031995 Bacteria 1478
239 Ga0307409_100395157 3300031995 Bacteria 1319
240 Ga0307416_100013774 3300032002 Bacteria 5510
241 Ga0307416_100015027 3300032002 Bacteria 5330
242 Ga0307416_100022279 3300032002 Unclassified 4569
243 Ga0307416_100284213 3300032002 Unclassified 1633
244 Ga0307414_10004663 3300032004 Bacteria 7470
245 Ga0307414_10034832 3300032004 Unclassified 3343
246 Ga0307414_10065141 3300032004 Unclassified 2598
247 Ga0307411_10000844 3300032005 Bacteria 11506
248 Ga0307411_10012419 3300032005 Bacteria 4647
249 Ga0307411_10023542 3300032005 Unclassified 3651
250 Ga0307411_10180860 3300032005 Unclassified 1600
251 Ga0307415_100003581 3300032126 Bacteria 7934
252 Ga0307415_100005096 3300032126 Bacteria 6921
253 Ga0307415_100006270 3300032126 Bacteria 6391
254 Ga0307415_100006776 3300032126 Bacteria 6213
255 Ga0307415_100055823 3300032126 Bacteria 2705
256 Ga0307415_100269136 3300032126 Bacteria 1395
257 Ga0395899_0367981 3300037312 Unclassified 958
258 Ga0395898_0101418 3300037466 Unclassified 2764
259 Ga0395901_0146678 3300038443 Unclassified 2480
260 Ga0395901_0604105 3300038443 Bacteria 1106
261 Ga0436365_1608639 3300039437 Bacteria 2368
262 Ga0439466_0073517 3300041411 Unclassified 1086
263 Ga0451843_0543167 3300041509 Bacteria 2114
264 Ga0439432_094662 3300042006 Bacteria 897
265 Ga0439449_0074741 3300042007 Unclassified 1249
266 Ga0451576_0753668 3300045051 Unclassified 1023
267 Ga0495668_0044181 3300046616 Bacteria 2476
268 Ga0496104_0449290 3300048907 Bacteria 1201
269 Ga0496106_0009231 3300048909 Bacteria 7287
270 Ga0496109_0164600 3300048912 Bacteria 2079
271 Ga0496110_0322497 3300048913 Bacteria 1407
272 Ga0501292_023513 3300049515 Bacteria 1007
273 Ga0501303_002673 3300049526 Bacteria 1390
274 Ga0501072_0015003 3300049588 Bacteria 5940
275 Ga0501198_000148 3300049649 Bacteria 9701
276 Ga0501199_004096 3300049650 Bacteria 1426
277 Ga0501202_002215 3300049652 Unclassified 3243
278 Ga0501209_070578 3300049656 Unclassified 992
279 Ga0501217_002792 3300049661 Unclassified 3476
280 Ga0501223_000930 3300049663 Bacteria 6919
281 Ga0501227_000312 3300049665 Bacteria 10116
282 Ga0501233_001030 3300049668 Unclassified 4725
283 Ga0501235_000311 3300049669 Bacteria 9200
284 Ga0501243_045678 3300049675 Unclassified 779
285 Ga0501249_002036 3300049679 Bacteria 4114
286 Ga0501249_014759 3300049679 Unclassified 1666
287 Ga0501257_004383 3300049686 Unclassified 3080
288 Ga0501259_007140 3300049688 Unclassified 1785
289 Ga0501259_027529 3300049688 Bacteria 1053
290 Ga0501259_043451 3300049688 Unclassified 891
291 Ga0501260_006157 3300049689 Bacteria 1147
292 Ga0501221_002981 3300049704 Bacteria 2790
293 Ga0501221_011835 3300049704 Unclassified 1578
294 Ga0501225_0003904 3300049705 Unclassified 4463
295 Ga0501234_004420 3300049707 Unclassified 2212
296 Ga0501263_011092 3300049760 Bacteria 1114
297 Ga0501268_000269 3300049765 Bacteria 5274
298 Ga0501268_017783 3300049765 Unclassified 1188
299 Ga0501270_022939 3300049767 Unclassified 968
300 Ga0501283_009441 3300049779 Bacteria 1422
301 nmdc:mga05p37_768879_c1 3300050507 Bacteria 1059
302 nmdc:mga09592_663514_c1 3300050508 Bacteria 890
303 Ga0500616_0001812 3300053153 Bacteria 19422
304 Ga0501242_000389
305 Ga0065712_10261495
306 Ga0065715_10003117
307 Ga0065715_10121529
308 Ga0065715_10180276
309 Ga0070658_10000547
310 Ga0070676_10031519
311 Ga0070676_10411061
312 Ga0070683_100283033
313 Ga0070683_100686593
314 Ga0070690_100529658
315 Ga0070670_100037184
316 Ga0070677_10004615
317 Ga0068869_100370778
318 Ga0070680_100153218
319 Ga0070680_100238929
320 Ga0070689_100009168
321 Ga0070689_100058333
322 Ga0070661_100133946
323 Ga0070675_100046331
324 Ga0070675_100068965
325 Ga0070671_100061021
326 Ga0070671_100135814
327 Ga0070671_100184047
328 Ga0070674_100041140
329 Ga0070674_100611771
330 Ga0070673_100116242
331 Ga0070673_100176556
332 Ga0070673_100746187
333 Ga0070688_100009988
334 Ga0070659_100013611
335 Ga0070667_100432347
336 Ga0070705_100022500
337 Ga0070694_100177052
338 Ga0070662_100525547
339 Ga0070681_10007162
340 Ga0070681_10007163
341 Ga0070685_10020224
342 Ga0070679_100075241
343 Ga0070684_100575675
344 Ga0068853_100085188
345 Ga0068853_100182499
346 Ga0068853_100294545
347 Ga0070672_100051864
348 Ga0070672_100321728
349 Ga0070672_100505257
350 Ga0070696_100086456
351 Ga0070693_100019277
352 Ga0070665_100097779
353 Ga0070704_100016942
354 Ga0068855_100019948
355 Ga0070664_100012951
356 Ga0070664_100169883
357 Ga0070664_100419348
358 Ga0068857_100015321
359 Ga0068857_100057124
360 Ga0068854_100075083
361 Ga0068854_100075468
362 Ga0068854_100106888
363 Ga0068852_100163970
364 Ga0068852_100393786
365 Ga0068859_100196109
366 Ga0068859_100456762
367 Ga0068864_100015776
368 Ga0068864_100022496
369 Ga0068864_100064904
370 Ga0068861_100036014
371 Ga0068861_100126216
372 Ga0068870_10011880
373 Ga0068863_100019652
374 Ga0068863_100024967
375 Ga0068863_100081653
376 Ga0068863_100681935
377 Ga0068860_100017632
378 Ga0068860_100445794
379 Ga0068862_100027640
380 Ga0068862_100034316
381 Ga0081539_10005979
382 Ga0097620_100196113
383 Ga0097620_100456740
384 Ga0105240_10065559
385 Ga0105240_10300061
386 Ga0111539_10088341
387 Ga0105245_10248843
388 Ga0105247_10024338
389 Ga0114129_10757095
390 Ga0114129_11002917
391 Ga0105243_10000578
392 Ga0105241_10225700
393 Ga0105241_10593764
394 Ga0105242_10003479
395 Ga0105242_10061987
396 Ga0105248_10011821
397 Ga0105248_10042645
398 Ga0105237_10139824
399 Ga0105238_10019264
400 Ga0105249_10010411
401 Ga0105249_10022909
402 Ga0105249_10027287
403 Ga0105249_10104681
404 Ga0105239_10034364
405 Ga0157373_10043200
406 Ga0157371_10111253
407 Ga0157370_10060885
408 Ga0157370_10075700
409 Ga0157370_10079513
410 Ga0157369_10017659
411 Ga0157369_10312319
412 Ga0157374_10029299
413 Ga0157374_10166716
414 Ga0157378_10000001
415 Ga0157378_10020138
416 Ga0157378_10048960
417 Ga0157378_10346506
418 Ga0163162_10020652
419 Ga0163162_10166705
420 Ga0163162_10325992
421 Ga0163162_10440417
422 Ga0163162_10624555
423 Ga0157372_10014396
424 Ga0157372_10052000
425 Ga0157372_10052413
426 Ga0157372_10318439
427 Ga0157372_10550165
428 Ga0157372_10912346
429 Ga0157375_10012106
430 Ga0157375_10012385
431 Ga0157375_10026952
432 Ga0157375_10191006
433 Ga0157375_10361456
434 Ga0157375_10434762
435 Ga0163163_10039707
436 Ga0163163_10150068
437 Ga0163163_10326598
438 Ga0163163_10576349
439 Ga0157380_10004374
440 Ga0157380_10005843
441 Ga0157380_10017960
442 Ga0157380_10037237
443 Ga0157380_10729067
444 Ga0157379_10017650
445 Ga0157376_10025363
446 Ga0157376_10272604
447 Ga0163161_10012857
448 Ga0163161_10017202
449 Ga0163161_10100226
450 Ga0163161_10219356
451 Ga0213876_10000046
452 Ga0207682_10106172
453 Ga0207710_10009379
454 Ga0207680_10005973
455 Ga0207645_10093624
456 Ga0207643_10023864
457 Ga0207705_10007362
458 Ga0207654_10152303
459 Ga0207707_10012905
460 Ga0207707_10049837
461 Ga0207649_10090336
462 Ga0207652_10070010
463 Ga0207650_10037108
464 Ga0207659_10095936
465 Ga0207659_10310154
466 Ga0207644_10013828
467 Ga0207644_10051920
468 Ga0207690_10122397
469 Ga0207706_10014932
470 Ga0207670_10032626
471 Ga0207670_10045421
472 Ga0207670_10089240
473 Ga0207669_10016226
474 Ga0207704_10284519
475 Ga0207691_10045911
476 Ga0207691_10056235
477 Ga0207691_10065546
478 Ga0207711_10064288
479 Ga0207661_10405888
480 Ga0207679_10029792
481 Ga0207679_10095783
482 Ga0207679_10258824
483 Ga0207667_10094588
484 Ga0207651_10139727
485 Ga0207651_10492101
486 Ga0207712_10006170
487 Ga0207712_10169025
488 Ga0207668_10383893
489 Ga0207640_10075830
490 Ga0207640_10295822
491 Ga0207639_10001470
492 Ga0207641_10004547
493 Ga0207641_10060914
494 Ga0207641_10690680
495 Ga0207676_10004449
496 Ga0207676_10008771
497 Ga0207676_10081634
498 Ga0207676_10570334
499 Ga0207674_10015291
500 Ga0207674_10021216
501 Ga0207674_10106472
502 Ga0207675_100090541
503 Ga0207675_100319154
504 Ga0207683_10012929
505 Ga0207683_10334271
506 Ga0207683_10409318
507 Ga0207698_10094435
508 Ga0207698_10131935
509 Ga0207698_10218613
510 Ga0207698_10368916
511 Ga0209974_10042861
512 Ga0268265_10083039
513 Ga0268265_10117122
514 Ga0307513_10003212
515 Ga0307408_100010771
516 Ga0307408_100020967
517 Ga0307408_100282405
518 Ga0307405_10004421
519 Ga0307405_10010122
520 Ga0307405_10080789
521 Ga0307405_10141734
522 Ga0307413_10002026
523 Ga0307413_10017461
524 Ga0307413_10259634
525 Ga0307413_10299503
526 Ga0307410_10001887
527 Ga0307410_10016269
528 Ga0307410_10058739
529 Ga0307410_10130451
530 Ga0307410_10147095
531 Ga0307406_10008126
532 Ga0307406_10032756
533 Ga0307407_10013723
534 Ga0307407_10122441
535 Ga0307407_10258032
536 Ga0307407_10260433
537 Ga0307412_10035050
538 Ga0307412_10040703
539 Ga0307412_10136695
540 Ga0307409_100161814
541 Ga0307409_100307538
542 Ga0307409_100395157
543 Ga0307416_100013774
544 Ga0307416_100015027
545 Ga0307416_100022279
546 Ga0307416_100284213
547 Ga0307414_10004663
548 Ga0307414_10034832
549 Ga0307414_10065141
550 Ga0307411_10000844
551 Ga0307411_10012419
552 Ga0307411_10023542
553 Ga0307411_10180860
554 Ga0307415_100003581
555 Ga0307415_100005096
556 Ga0307415_100006270
557 Ga0307415_100006776
558 Ga0307415_100055823
559 Ga0307415_100269136
560 Ga0395899_0367981
561 Ga0395898_0101418
562 Ga0395901_0146678
563 Ga0395901_0604105
564 Ga0436365_1608639
565 Ga0439466_0073517
566 Ga0451843_0543167
567 Ga0439432_094662
568 Ga0439449_0074741
569 Ga0451576_0753668
570 Ga0495668_0044181
571 Ga0496104_0449290
572 Ga0496106_0009231
573 Ga0496109_0164600
574 Ga0496110_0322497
575 Ga0501292_023513
576 Ga0501303_002673
577 Ga0501072_0015003
578 Ga0501198_000148
579 Ga0501199_004096
580 Ga0501202_002215
581 Ga0501209_070578
582 Ga0501217_002792
583 Ga0501223_000930
584 Ga0501227_000312
585 Ga0501233_001030
586 Ga0501235_000311
587 Ga0501243_045678
588 Ga0501249_002036
589 Ga0501249_014759
590 Ga0501257_004383
591 Ga0501259_007140
592 Ga0501259_027529
593 Ga0501259_043451
594 Ga0501260_006157
595 Ga0501221_002981
596 Ga0501221_011835
597 Ga0501225_0003904
598 Ga0501234_004420
599 Ga0501263_011092
600 Ga0501268_000269
601 Ga0501268_017783
602 Ga0501270_022939
603 Ga0501283_009441
604 nmdc:mga05p37_768879_c1
605 nmdc:mga09592_663514_c1
606 Ga0500616_0001812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

23

221

0.83

PF02112

PDEase_II

cAMP phosphodiesterases class-II

39

228

0.81

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

12

182

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8038 2 256
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.7912 2 257
4ojv-assembly1.cif.gz_A crystal structure of unliganded yeast pde1 0.79 2 255
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.786 2 256
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.7796 2 257
ID Description Score Start End Superfamily
af_Q4DTW2_23_113_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8784 120 163 3.60.15.10
af_P22434_89_366_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8594 45 254 3.60.15.10
af_Q5AGE4_9_402_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8344 44 238 3.60.15.10
af_Q9JIC3_715_829_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7756 56 183 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7646 1 258 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2V8SPA1-F1-model_v4 3',5'-cyclic-nucleotide phosphodiesterase 0.9953 2 258 GO:0004115
GO:0006198
GO:0047555
GO:1902660
AF-A0A7W0SKC3-F1-model_v4 MBL fold metallo-hydrolase 0.9913 42 257 GO:0004115
GO:0006198
GO:0047555
GO:1902660
AF-A0A7V9URK5-F1-model_v4 3',5'-cyclic-nucleotide phosphodiesterase 0.9882 1 258 GO:0004115
GO:0006198
AF-A0A136JT17-F1-model_v4 deleted 0.9876 1 258
AF-A0A7W1FBY2-F1-model_v4 3',5'-cyclic-nucleotide phosphodiesterase 0.9875 179 258

Map