F397134

General Info

Members Datasets Scaffolds Average Seq Length
303 207 606 244

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0096963|Ga0373931_0096963_554_1414
Length 286
Sequence MFMEAHYNTRPDFQASERPPGNPRPALARLTASAAAAIIEPMSGHSHWATIKHKKGAADARRGKLWSKLCRAIQIAAKEGGGNPDMNLKLQNAILDARAESVPNDNITRSIKRGTGELEGVSYEQVTYEGYGPGGTAFMIDALTDNKNRSAAEMRKMFENSGGNLGGAGSVRFMFQAKGLILIAKSAAGEDQMMNDVLEAGAENMETAGDNYEITTAVPDFETVKKALAKKYKFVSSELGQMPKDPVKVDEETGRKILNLMEALDDSEDVQKIYTNFELPESLIGK

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
135 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
144 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
145 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
146 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
149 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
207 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.63
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0096963 3300035691 Bacteria 1653
2 JGI24746J21847_1013895 3300001977 Bacteria 1166
3 JGI24749J21850_1007808 3300002076 Bacteria 1490
4 Ga0065707_10185313 3300005295 Bacteria 1392
5 Ga0065707_10248071 3300005295 Bacteria 1134
6 Ga0070690_100000377 3300005330 Bacteria 22770
7 Ga0070670_100093479 3300005331 Bacteria 2586
8 Ga0070677_10088751 3300005333 Bacteria 1340
9 Ga0068869_100042796 3300005334 Bacteria 3249
10 Ga0070666_10004308 3300005335 Bacteria 8660
11 Ga0070689_100002547 3300005340 Bacteria 11947
12 Ga0070692_10286711 3300005345 Bacteria 1000
13 Ga0070668_100024793 3300005347 Bacteria 4545
14 Ga0070675_100115786 3300005354 Unclassified 2273
15 Ga0070671_100005616 3300005355 Bacteria 9989
16 Ga0070674_100071704 3300005356 Bacteria 2451
17 Ga0070673_100038670 3300005364 Bacteria 3645
18 Ga0070673_100101556 3300005364 Bacteria 2370
19 Ga0070673_100199076 3300005364 Bacteria 1725
20 Ga0070688_100041638 3300005365 Bacteria 2821
21 Ga0070667_100002410 3300005367 Bacteria 16345
22 Ga0070709_10044545 3300005434 Bacteria 2748
23 Ga0070714_100176593 3300005435 Bacteria 1941
24 Ga0070713_100415739 3300005436 Bacteria 1258
25 Ga0070701_10068796 3300005438 Bacteria 1887
26 Ga0070711_100000299 3300005439 Bacteria 25709
27 Ga0070705_100001453 3300005440 Bacteria 12523
28 Ga0070705_100189862 3300005440 Bacteria 1399
29 Ga0070694_100067959 3300005444 Bacteria 2448
30 Ga0070708_100042430 3300005445 Bacteria 3993
31 Ga0070708_100302253 3300005445 Bacteria 1507
32 Ga0070663_100002132 3300005455 Bacteria 11073
33 Ga0070678_100015534 3300005456 Bacteria 4842
34 Ga0070678_100159773 3300005456 Bacteria 1824
35 Ga0070662_100201112 3300005457 Bacteria 1581
36 Ga0068867_100040328 3300005459 Bacteria 3407
37 Ga0068867_100120680 3300005459 Bacteria 2026
38 Ga0070707_100050595 3300005468 Bacteria 3983
39 Ga0070698_100061329 3300005471 Bacteria 3794
40 Ga0070684_100045957 3300005535 Bacteria 3783
41 Ga0070697_100000942 3300005536 Bacteria 21869
42 Ga0070697_100029140 3300005536 Bacteria 4424
43 Ga0070672_100003063 3300005543 Bacteria 10775
44 Ga0070695_100001934 3300005545 Bacteria 11737
45 Ga0070695_100275701 3300005545 Bacteria 1234
46 Ga0070693_100116440 3300005547 Bacteria 1652
47 Ga0070665_100117494 3300005548 Bacteria 2662
48 Ga0070665_100237017 3300005548 Bacteria 1825
49 Ga0070704_100030373 3300005549 Bacteria 3620
50 Ga0068855_100034175 3300005563 Bacteria 6065
51 Ga0068854_100077919 3300005578 Bacteria 2440
52 Ga0068856_100010501 3300005614 Bacteria 8988
53 Ga0070702_100044374 3300005615 Bacteria 2510
54 Ga0068859_100005567 3300005617 Bacteria 12833
55 Ga0068859_100122920 3300005617 Bacteria 2663
56 Ga0068864_100054037 3300005618 Bacteria 3466
57 Ga0068864_100200624 3300005618 Bacteria 1832
58 Ga0068861_100163183 3300005719 Bacteria 1840
59 Ga0068863_100109035 3300005841 Bacteria 2635
60 Ga0068863_100292026 3300005841 Bacteria 1580
61 Ga0068858_100001030 3300005842 Bacteria 28781
62 Ga0068858_100339484 3300005842 Bacteria 1438
63 Ga0068860_100008304 3300005843 Bacteria 10333
64 Ga0081455_10142583 3300005937 Bacteria 1859
65 Ga0070717_10067138 3300006028 Bacteria 2983
66 Ga0097621_100430939 3300006237 Bacteria 1185
67 Ga0068871_100146311 3300006358 Bacteria 2012
68 Ga0075428_100419412 3300006844 Bacteria 1434
69 Ga0075430_100034650 3300006846 Bacteria 4285
70 Ga0075430_100524989 3300006846 Bacteria 977
71 Ga0075431_100090688 3300006847 Bacteria 3155
72 Ga0075433_10001996 3300006852 Bacteria 15368
73 Ga0075433_10008716 3300006852 Bacteria 8094
74 Ga0075433_10052060 3300006852 Bacteria 3567
75 Ga0075433_10054247 3300006852 Bacteria 3497
76 Ga0075434_100001002 3300006871 Bacteria 22931
77 Ga0075434_100197506 3300006871 Bacteria 2031
78 Ga0075429_100002921 3300006880 Bacteria 14496
79 Ga0075429_100019580 3300006880 Bacteria 5866
80 Ga0075429_100677403 3300006880 Bacteria 904
81 Ga0068865_100027655 3300006881 Bacteria 3748
82 Ga0075436_100001178 3300006914 Bacteria 17753
83 Ga0075436_100017257 3300006914 Bacteria 4941
84 Ga0097620_100005567 3300006931 Bacteria 12833
85 Ga0097620_100122926 3300006931 Bacteria 2663
86 Ga0111539_10051348 3300009094 Bacteria 4912
87 Ga0111539_10129711 3300009094 Bacteria 2953
88 Ga0105247_10020514 3300009101 Bacteria 3973
89 Ga0114129_10791879 3300009147 Bacteria 1210
90 Ga0105243_10052671 3300009148 Bacteria 3225
91 Ga0105241_10147974 3300009174 Bacteria 1918
92 Ga0105248_10000735 3300009177 Bacteria 36877
93 Ga0105237_10066970 3300009545 Bacteria 3585
94 Ga0105238_10007046 3300009551 Bacteria 11241
95 Ga0157378_10042610 3300013297 Bacteria 4029
96 Ga0163162_10112338 3300013306 Bacteria 2823
97 Ga0157372_10222255 3300013307 Unclassified 2189
98 Ga0157375_10010207 3300013308 Bacteria 8264
99 Ga0163163_10273316 3300014325 Bacteria 1741
100 Ga0157380_10164020 3300014326 Bacteria 1934
101 Ga0157379_10001979 3300014968 Bacteria 16947
102 Ga0157379_10268940 3300014968 Bacteria 1550
103 Ga0157376_10007971 3300014969 Bacteria 7600
104 Ga0157376_10072166 3300014969 Bacteria 2936
105 Ga0207680_10044509 3300025903 Bacteria 2611
106 Ga0207699_10074019 3300025906 Bacteria 2091
107 Ga0207654_10061902 3300025911 Bacteria 2191
108 Ga0207707_10411702 3300025912 Bacteria 1160
109 Ga0207695_10116800 3300025913 Bacteria 2642
110 Ga0207671_10000014 3300025914 Bacteria 461481
111 Ga0207663_10000053 3300025916 Bacteria 62261
112 Ga0207663_10182351 3300025916 Bacteria 1500
113 Ga0207662_10298893 3300025918 Bacteria 1069
114 Ga0207649_10376350 3300025920 Bacteria 1057
115 Ga0207646_10186664 3300025922 Bacteria 1873
116 Ga0207694_10004224 3300025924 Bacteria 11244
117 Ga0207659_10107498 3300025926 Unclassified 2115
118 Ga0207700_10178709 3300025928 Bacteria 1775
119 Ga0207664_10459575 3300025929 Bacteria 1137
120 Ga0207644_10009526 3300025931 Bacteria 6380
121 Ga0207706_10276133 3300025933 Bacteria 1466
122 Ga0207709_10071534 3300025935 Bacteria 2203
123 Ga0207670_10066817 3300025936 Bacteria 2471
124 Ga0207669_10115047 3300025937 Bacteria 1812
125 Ga0207704_10017866 3300025938 Bacteria 3688
126 Ga0207665_10017139 3300025939 Bacteria 4758
127 Ga0207691_10004425 3300025940 Bacteria 13613
128 Ga0207691_10056638 3300025940 Bacteria 3570
129 Ga0207691_10095875 3300025940 Bacteria 2653
130 Ga0207711_10001095 3300025941 Bacteria 25848
131 Ga0207711_10078342 3300025941 Bacteria 2883
132 Ga0207689_10173638 3300025942 Bacteria 1777
133 Ga0207679_10057120 3300025945 Bacteria 2885
134 Ga0207679_10063962 3300025945 Bacteria 2748
135 Ga0207667_10018455 3300025949 Bacteria 7822
136 Ga0207651_10030278 3300025960 Bacteria 3444
137 Ga0207651_10068227 3300025960 Bacteria 2506
138 Ga0207651_10117385 3300025960 Bacteria 2010
139 Ga0207640_10054610 3300025981 Bacteria 2613
140 Ga0207658_10002304 3300025986 Bacteria 14089
141 Ga0207703_10061858 3300026035 Bacteria 3066
142 Ga0207703_10277783 3300026035 Bacteria 1520
143 Ga0207678_10072119 3300026067 Bacteria 2960
144 Ga0207708_10402117 3300026075 Bacteria 1133
145 Ga0207702_10008096 3300026078 Bacteria 8893
146 Ga0207641_10130932 3300026088 Bacteria 2253
147 Ga0207648_10056423 3300026089 Bacteria 3428
148 Ga0207648_10139184 3300026089 Bacteria 2139
149 Ga0207676_10161576 3300026095 Bacteria 1941
150 Ga0207675_100196327 3300026118 Bacteria 1937
151 Ga0207675_100432331 3300026118 Bacteria 1302
152 Ga0207428_10081544 3300027907 Bacteria 2525
153 Ga0268266_10014438 3300028379 Bacteria 6791
154 Ga0268265_10849913 3300028380 Bacteria 893
155 Ga0268264_10001881 3300028381 Bacteria 19065
156 Ga0265332_10010365 3300031238 Bacteria 4150
157 Ga0265329_10024197 3300031242 Bacteria 2017
158 Ga0265339_10000406 3300031249 Bacteria 33894
159 Ga0265313_10106173 3300031595 Bacteria 1240
160 Ga0316575_10004443 3300031665 Bacteria 4936
161 Ga0316575_10047931 3300031665 Bacteria 1698
162 Ga0316579_10002367 3300031691 Bacteria 7109
163 Ga0265314_10000449 3300031711 Bacteria 55159
164 Ga0265342_10013262 3300031712 Bacteria 5541
165 Ga0316576_10004683 3300031727 Bacteria 8249
166 Ga0316576_10005947 3300031727 Bacteria 7535
167 Ga0316576_10009138 3300031727 Bacteria 6385
168 Ga0316576_10034704 3300031727 Bacteria 3597
169 Ga0316576_10039579 3300031727 Bacteria 3385
170 Ga0316576_10039919 3300031727 Bacteria 3371
171 Ga0316576_10459714 3300031727 Bacteria 939
172 Ga0316578_10010624 3300031728 Bacteria 4785
173 Ga0316577_10000966 3300031733 Bacteria 12819
174 Ga0316577_10009023 3300031733 Bacteria 5352
175 Ga0316577_10094822 3300031733 Bacteria 1671
176 Ga0316577_10250313 3300031733 Bacteria 1002
177 Ga0316577_10376553 3300031733 Bacteria 806
178 Ga0307410_10026539 3300031852 Bacteria 3648
179 Ga0307411_10091935 3300032005 Bacteria 2121
180 Ga0316583_10011604 3300032133 Bacteria 3177
181 Ga0316583_10032626 3300032133 Bacteria 1851
182 Ga0316585_10000364 3300032137 Bacteria 10407
183 Ga0316585_10017031 3300032137 Bacteria 2194
184 Ga0316580_10006952 3300032139 Bacteria 3353
185 Ga0316580_10072583 3300032139 Bacteria 1054
186 Ga0316574_0000113 3300035398 Bacteria 24326
187 Ga0316574_0013624 3300035398 Bacteria 4679
188 Ga0316574_0094793 3300035398 Bacteria 1906
189 Ga0373937_0064489 3300036401 Bacteria 3370
190 Ga0316582_0000549 3300036647 Bacteria 14355
191 Ga0316582_0070953 3300036647 Bacteria 2255
192 Ga0316582_0120631 3300036647 Bacteria 1754
193 Ga0316582_0187779 3300036647 Bacteria 1407
194 Ga0316582_0300550 3300036647 Bacteria 1103
195 Ga0316584_0002219 3300036712 Bacteria 12174
196 Ga0316584_0011040 3300036712 Bacteria 6330
197 Ga0316584_0017265 3300036712 Bacteria 5185
198 Ga0316584_0075600 3300036712 Bacteria 2524
199 Ga0316584_0099286 3300036712 Bacteria 2180
200 Ga0316584_0111760 3300036712 Bacteria 2044
201 Ga0316584_0484947 3300036712 Bacteria 870
202 Ga0373925_0428931 3300037068 Bacteria 1081
203 Ga0395898_0875225 3300037466 Bacteria 837
204 Ga0395901_0186792 3300038443 Bacteria 2174
205 Ga0400490_36548 3300038726 Bacteria 1081
206 Ga0400490_43117 3300038726 Bacteria 7104
207 Ga0400490_57738 3300038726 Bacteria 3243
208 Ga0400488_04917 3300038741 Bacteria 7546
209 Ga0400488_32659 3300038741 Bacteria 5168
210 Ga0400486_03454 3300038742 Bacteria 4430
211 Ga0242420_010212 3300038996 Bacteria 1555
212 Ga0400483_137949 3300039062 Bacteria 72420
213 Ga0400489_28601 3300039093 Bacteria 26697
214 Ga0400487_30098 3300039110 Bacteria 2994
215 Ga0400487_35568 3300039110 Bacteria 4572
216 Ga0436365_0614206 3300039437 Bacteria 10706
217 Ga0451855_0933665 3300041511 Bacteria 919
218 Ga0451577_0000018 3300042876 Bacteria 516495
219 Ga0451577_0728879 3300042876 Bacteria 897
220 Ga0453683_0005719 3300044673 Bacteria 8630
221 Ga0453683_0150001 3300044673 Bacteria 1473
222 Ga0453683_0243856 3300044673 Bacteria 1145
223 Ga0466963_0020621 3300044694 Bacteria 4145
224 Ga0453684_0000103 3300044712 Bacteria 366458
225 Ga0453684_0010305 3300044712 Bacteria 16007
226 Ga0453684_0488259 3300044712 Bacteria 1366
227 Ga0466957_0089121 3300044842 Bacteria 1931
228 Ga0451576_0043656 3300045051 Bacteria 4729
229 Ga0451576_0059532 3300045051 Bacteria 3986
230 Ga0451576_0331092 3300045051 Bacteria 1594
231 Ga0495603_0000107 3300046455 Bacteria 39283
232 Ga0495629_0127479 3300046459 Bacteria 1773
233 Ga0495580_0000256 3300046472 Bacteria 42387
234 Ga0495582_0118286 3300046473 Bacteria 1492
235 Ga0495662_0092279 3300046476 Bacteria 1477
236 Ga0495664_0133990 3300046477 Bacteria 1501
237 Ga0495620_0084730 3300046515 Bacteria 1278
238 Ga0495628_0028128 3300046516 Bacteria 4571
239 Ga0495628_0140989 3300046516 Bacteria 1840
240 Ga0495628_0272297 3300046516 Unclassified 1259
241 Ga0495630_0010638 3300046517 Bacteria 6642
242 Ga0495630_0574250 3300046517 Bacteria 864
243 Ga0495666_0077829 3300046526 Bacteria 1571
244 Ga0495652_0031927 3300046529 Bacteria 4609
245 Ga0495640_0058393 3300046533 Bacteria 2631
246 Ga0495621_0094312 3300046539 Bacteria 1132
247 Ga0495645_0006168 3300046543 Bacteria 8300
248 Ga0495645_0254624 3300046543 Bacteria 1165
249 Ga0495667_0079649 3300046559 Bacteria 2130
250 Ga0495634_0002567 3300046642 Bacteria 14991
251 Ga0495634_0004632 3300046642 Bacteria 10731
252 Ga0495635_0010132 3300046663 Bacteria 6592
253 Ga0495613_0063414 3300046689 Bacteria 2704
254 Ga0495613_0114822 3300046689 Bacteria 1938
255 Ga0495624_0107124 3300046690 Bacteria 1719
256 Ga0495674_0019695 3300047319 Bacteria 6258
257 Ga0495674_0066357 3300047319 Bacteria 3131
258 Ga0495674_0486224 3300047319 Bacteria 989
259 Ga0495680_0206557 3300047322 Bacteria 1407
260 Ga0495680_0245694 3300047322 Bacteria 1270
261 Ga0495684_0144274 3300047471 Bacteria 1784
262 Ga0495684_0309373 3300047471 Bacteria 1133
263 Ga0495602_0112814 3300048088 Bacteria 2205
264 Ga0496101_0080159 3300048904 Bacteria 2411
265 Ga0496102_0006454 3300048905 Bacteria 10002
266 Ga0496106_0078216 3300048909 Bacteria 2537
267 Ga0496107_0002784 3300048910 Bacteria 11533
268 Ga0496108_0159752 3300048911 Bacteria 1947
269 Ga0496110_0035405 3300048913 Bacteria 4331
270 Ga0496110_0070168 3300048913 Bacteria 3104
271 Ga0496111_0019827 3300048914 Bacteria 4676
272 Ga0496112_0593853 3300048915 Bacteria 1039
273 Ga0496113_0058962 3300048916 Bacteria 2890
274 Ga0496115_0104040 3300048918 Bacteria 2330
275 Ga0501040_0603054 3300049576 Bacteria 793
276 Ga0501076_0233007 3300049592 Bacteria 1505
277 Ga0501081_0060849 3300049743 Bacteria 2617
278 nmdc:mga05p37_157585_c1 3300050507 Bacteria 2774
279 nmdc:mga05p37_67585_c1 3300050507 Bacteria 4397
280 nmdc:mga05p37_746882_c1 3300050507 Bacteria 1079
281 nmdc:mga09592_13723_c1 3300050508 Bacteria 6620
282 nmdc:mga09592_16180_c1 3300050508 Bacteria 6097
283 nmdc:mga09592_590398_c1 3300050508 Bacteria 952
284 nmdc:mga09592_633147_c1 3300050508 Bacteria 914
285 nmdc:mga0qj67_33695_c1 3300050509 Bacteria 3997
286 nmdc:mga0qj67_715957_c1 3300050509 Bacteria 796
287 nmdc:mga06r32_138126_c1 3300050510 Bacteria 2412
288 nmdc:mga06r32_80448_c1 3300050510 Bacteria 3171
289 nmdc:mga08y16_233698_c1 3300050511 Bacteria 1901
290 nmdc:mga08y16_41294_c1 3300050511 Bacteria 4833
291 nmdc:mga0n895_1490_c1 3300050512 Bacteria 17559
292 nmdc:mga08x19_30268_c1 3300050514 Bacteria 3400
293 nmdc:mga08x19_9213_c1 3300050514 Bacteria 5897
294 nmdc:mga0a205_26_c1 3300050515 Bacteria 15405
295 nmdc:mga0a205_27386_c1 3300050515 Bacteria 5444
296 nmdc:mga0a205_6318_c1 3300050515 Bacteria 10697
297 Ga0495601_0066393 3300053077 Bacteria 2296
298 Ga0495601_0145162 3300053077 Bacteria 1549
299 Ga0495612_0030571 3300053078 Bacteria 2169
300 Ga0495619_0005581 3300053085 Bacteria 7983
301 Ga0501084_0770701 3300054114 Bacteria 810
302 2526061065 2524614857 Bacteria 4146328
303 2740062529 2739367875 Bacteria 4157290
304 Ga0373931_0096963
305 JGI24746J21847_1013895
306 JGI24749J21850_1007808
307 Ga0065707_10185313
308 Ga0065707_10248071
309 Ga0070690_100000377
310 Ga0070670_100093479
311 Ga0070677_10088751
312 Ga0068869_100042796
313 Ga0070666_10004308
314 Ga0070689_100002547
315 Ga0070692_10286711
316 Ga0070668_100024793
317 Ga0070675_100115786
318 Ga0070671_100005616
319 Ga0070674_100071704
320 Ga0070673_100038670
321 Ga0070673_100101556
322 Ga0070673_100199076
323 Ga0070688_100041638
324 Ga0070667_100002410
325 Ga0070709_10044545
326 Ga0070714_100176593
327 Ga0070713_100415739
328 Ga0070701_10068796
329 Ga0070711_100000299
330 Ga0070705_100001453
331 Ga0070705_100189862
332 Ga0070694_100067959
333 Ga0070708_100042430
334 Ga0070708_100302253
335 Ga0070663_100002132
336 Ga0070678_100015534
337 Ga0070678_100159773
338 Ga0070662_100201112
339 Ga0068867_100040328
340 Ga0068867_100120680
341 Ga0070707_100050595
342 Ga0070698_100061329
343 Ga0070684_100045957
344 Ga0070697_100000942
345 Ga0070697_100029140
346 Ga0070672_100003063
347 Ga0070695_100001934
348 Ga0070695_100275701
349 Ga0070693_100116440
350 Ga0070665_100117494
351 Ga0070665_100237017
352 Ga0070704_100030373
353 Ga0068855_100034175
354 Ga0068854_100077919
355 Ga0068856_100010501
356 Ga0070702_100044374
357 Ga0068859_100005567
358 Ga0068859_100122920
359 Ga0068864_100054037
360 Ga0068864_100200624
361 Ga0068861_100163183
362 Ga0068863_100109035
363 Ga0068863_100292026
364 Ga0068858_100001030
365 Ga0068858_100339484
366 Ga0068860_100008304
367 Ga0081455_10142583
368 Ga0070717_10067138
369 Ga0097621_100430939
370 Ga0068871_100146311
371 Ga0075428_100419412
372 Ga0075430_100034650
373 Ga0075430_100524989
374 Ga0075431_100090688
375 Ga0075433_10001996
376 Ga0075433_10008716
377 Ga0075433_10052060
378 Ga0075433_10054247
379 Ga0075434_100001002
380 Ga0075434_100197506
381 Ga0075429_100002921
382 Ga0075429_100019580
383 Ga0075429_100677403
384 Ga0068865_100027655
385 Ga0075436_100001178
386 Ga0075436_100017257
387 Ga0097620_100005567
388 Ga0097620_100122926
389 Ga0111539_10051348
390 Ga0111539_10129711
391 Ga0105247_10020514
392 Ga0114129_10791879
393 Ga0105243_10052671
394 Ga0105241_10147974
395 Ga0105248_10000735
396 Ga0105237_10066970
397 Ga0105238_10007046
398 Ga0157378_10042610
399 Ga0163162_10112338
400 Ga0157372_10222255
401 Ga0157375_10010207
402 Ga0163163_10273316
403 Ga0157380_10164020
404 Ga0157379_10001979
405 Ga0157379_10268940
406 Ga0157376_10007971
407 Ga0157376_10072166
408 Ga0207680_10044509
409 Ga0207699_10074019
410 Ga0207654_10061902
411 Ga0207707_10411702
412 Ga0207695_10116800
413 Ga0207671_10000014
414 Ga0207663_10000053
415 Ga0207663_10182351
416 Ga0207662_10298893
417 Ga0207649_10376350
418 Ga0207646_10186664
419 Ga0207694_10004224
420 Ga0207659_10107498
421 Ga0207700_10178709
422 Ga0207664_10459575
423 Ga0207644_10009526
424 Ga0207706_10276133
425 Ga0207709_10071534
426 Ga0207670_10066817
427 Ga0207669_10115047
428 Ga0207704_10017866
429 Ga0207665_10017139
430 Ga0207691_10004425
431 Ga0207691_10056638
432 Ga0207691_10095875
433 Ga0207711_10001095
434 Ga0207711_10078342
435 Ga0207689_10173638
436 Ga0207679_10057120
437 Ga0207679_10063962
438 Ga0207667_10018455
439 Ga0207651_10030278
440 Ga0207651_10068227
441 Ga0207651_10117385
442 Ga0207640_10054610
443 Ga0207658_10002304
444 Ga0207703_10061858
445 Ga0207703_10277783
446 Ga0207678_10072119
447 Ga0207708_10402117
448 Ga0207702_10008096
449 Ga0207641_10130932
450 Ga0207648_10056423
451 Ga0207648_10139184
452 Ga0207676_10161576
453 Ga0207675_100196327
454 Ga0207675_100432331
455 Ga0207428_10081544
456 Ga0268266_10014438
457 Ga0268265_10849913
458 Ga0268264_10001881
459 Ga0265332_10010365
460 Ga0265329_10024197
461 Ga0265339_10000406
462 Ga0265313_10106173
463 Ga0316575_10004443
464 Ga0316575_10047931
465 Ga0316579_10002367
466 Ga0265314_10000449
467 Ga0265342_10013262
468 Ga0316576_10004683
469 Ga0316576_10005947
470 Ga0316576_10009138
471 Ga0316576_10034704
472 Ga0316576_10039579
473 Ga0316576_10039919
474 Ga0316576_10459714
475 Ga0316578_10010624
476 Ga0316577_10000966
477 Ga0316577_10009023
478 Ga0316577_10094822
479 Ga0316577_10250313
480 Ga0316577_10376553
481 Ga0307410_10026539
482 Ga0307411_10091935
483 Ga0316583_10011604
484 Ga0316583_10032626
485 Ga0316585_10000364
486 Ga0316585_10017031
487 Ga0316580_10006952
488 Ga0316580_10072583
489 Ga0316574_0000113
490 Ga0316574_0013624
491 Ga0316574_0094793
492 Ga0373937_0064489
493 Ga0316582_0000549
494 Ga0316582_0070953
495 Ga0316582_0120631
496 Ga0316582_0187779
497 Ga0316582_0300550
498 Ga0316584_0002219
499 Ga0316584_0011040
500 Ga0316584_0017265
501 Ga0316584_0075600
502 Ga0316584_0099286
503 Ga0316584_0111760
504 Ga0316584_0484947
505 Ga0373925_0428931
506 Ga0395898_0875225
507 Ga0395901_0186792
508 Ga0400490_36548
509 Ga0400490_43117
510 Ga0400490_57738
511 Ga0400488_04917
512 Ga0400488_32659
513 Ga0400486_03454
514 Ga0242420_010212
515 Ga0400483_137949
516 Ga0400489_28601
517 Ga0400487_30098
518 Ga0400487_35568
519 Ga0436365_0614206
520 Ga0451855_0933665
521 Ga0451577_0000018
522 Ga0451577_0728879
523 Ga0453683_0005719
524 Ga0453683_0150001
525 Ga0453683_0243856
526 Ga0466963_0020621
527 Ga0453684_0000103
528 Ga0453684_0010305
529 Ga0453684_0488259
530 Ga0466957_0089121
531 Ga0451576_0043656
532 Ga0451576_0059532
533 Ga0451576_0331092
534 Ga0495603_0000107
535 Ga0495629_0127479
536 Ga0495580_0000256
537 Ga0495582_0118286
538 Ga0495662_0092279
539 Ga0495664_0133990
540 Ga0495620_0084730
541 Ga0495628_0028128
542 Ga0495628_0140989
543 Ga0495628_0272297
544 Ga0495630_0010638
545 Ga0495630_0574250
546 Ga0495666_0077829
547 Ga0495652_0031927
548 Ga0495640_0058393
549 Ga0495621_0094312
550 Ga0495645_0006168
551 Ga0495645_0254624
552 Ga0495667_0079649
553 Ga0495634_0002567
554 Ga0495634_0004632
555 Ga0495635_0010132
556 Ga0495613_0063414
557 Ga0495613_0114822
558 Ga0495624_0107124
559 Ga0495674_0019695
560 Ga0495674_0066357
561 Ga0495674_0486224
562 Ga0495680_0206557
563 Ga0495680_0245694
564 Ga0495684_0144274
565 Ga0495684_0309373
566 Ga0495602_0112814
567 Ga0496101_0080159
568 Ga0496102_0006454
569 Ga0496106_0078216
570 Ga0496107_0002784
571 Ga0496108_0159752
572 Ga0496110_0035405
573 Ga0496110_0070168
574 Ga0496111_0019827
575 Ga0496112_0593853
576 Ga0496113_0058962
577 Ga0496115_0104040
578 Ga0501040_0603054
579 Ga0501076_0233007
580 Ga0501081_0060849
581 nmdc:mga05p37_157585_c1
582 nmdc:mga05p37_67585_c1
583 nmdc:mga05p37_746882_c1
584 nmdc:mga09592_13723_c1
585 nmdc:mga09592_16180_c1
586 nmdc:mga09592_590398_c1
587 nmdc:mga09592_633147_c1
588 nmdc:mga0qj67_33695_c1
589 nmdc:mga0qj67_715957_c1
590 nmdc:mga06r32_138126_c1
591 nmdc:mga06r32_80448_c1
592 nmdc:mga08y16_233698_c1
593 nmdc:mga08y16_41294_c1
594 nmdc:mga0n895_1490_c1
595 nmdc:mga08x19_30268_c1
596 nmdc:mga08x19_9213_c1
597 nmdc:mga0a205_26_c1
598 nmdc:mga0a205_27386_c1
599 nmdc:mga0a205_6318_c1
600 Ga0495601_0066393
601 Ga0495601_0145162
602 Ga0495612_0030571
603 Ga0495619_0005581
604 Ga0501084_0770701
605 2526061065
606 2740062529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

46

117

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

123

277

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8818 18 245
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8524 6 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8392 6 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8293 3 240
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8283 18 245
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9466 83 245 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9343 19 79 1.10.10.200
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9269 24 77 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9266 83 245 3.30.70.980
1lfpA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.918 133 202 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A7C0WV19-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9803 107 240 GO:0003677
GO:0005829
AF-A0A7V3FN36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9777 110 240 GO:0003677
GO:0005829
AF-A0A7X9GI19-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9757 42 240 GO:0003677
GO:0005829
GO:0006355
AF-A0A536RP66-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9735 1 135 GO:0003677
GO:0005829
AF-A0A075CJI2-F1-model_v4 DUF28 protein 0.966 42 135 GO:0005737

Map