F397050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 215 | 302 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300025904|Ga0207647_10400823|Ga0207647_104008231 |
| Length | 192 |
| Sequence | MRSIPRTVIRPLGQPGDLGWVVMAHGEIYASEFGWDADFEALVARIVADYAEGHDPRRERAWIAEVDGRRAGCVFCIAADQDGTAQLRILLVDPTARGHSLGKRLVEECVRFARSAGYRRMVLWTNDPLVAAGRVYRAVGFRLTAEEPHHSFGVDLVGQTYELDLTINQSRTTEGLRTGKSPADVTGPSPSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 139 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 140 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 141 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 142 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 148 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 150 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 168 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 214 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 215 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.33 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.98 |
| Nodule | 0 |
| Rhizoplane | 7.59 |
| Rhizosphere | 83.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_11189904 | 3300005327 | Bacteria | 663 |
| 2 | Ga0070683_100014311 | 3300005329 | Bacteria | 6937 |
| 3 | Ga0070683_100417052 | 3300005329 | Bacteria | 1280 |
| 4 | Ga0068869_100701291 | 3300005334 | Bacteria | 863 |
| 5 | Ga0070666_11177998 | 3300005335 | Bacteria | 570 |
| 6 | Ga0070680_100216118 | 3300005336 | Bacteria | 1618 |
| 7 | Ga0070682_100059556 | 3300005337 | Bacteria | 2412 |
| 8 | Ga0068868_100001664 | 3300005338 | Bacteria | 15178 |
| 9 | Ga0070689_100063651 | 3300005340 | Bacteria | 2870 |
| 10 | Ga0070689_100382050 | 3300005340 | Unclassified | 1187 |
| 11 | Ga0070687_100043055 | 3300005343 | Unclassified | 2292 |
| 12 | Ga0070692_10052543 | 3300005345 | Unclassified | 2123 |
| 13 | Ga0070671_100020542 | 3300005355 | Bacteria | 5386 |
| 14 | Ga0070673_100401420 | 3300005364 | Unclassified | 1226 |
| 15 | Ga0070659_100043664 | 3300005366 | Bacteria | 3506 |
| 16 | Ga0070667_100180059 | 3300005367 | Bacteria | 1869 |
| 17 | Ga0070667_100255477 | 3300005367 | Bacteria | 1568 |
| 18 | Ga0070709_10060903 | 3300005434 | Bacteria | 2401 |
| 19 | Ga0070714_100379935 | 3300005435 | Bacteria | 1332 |
| 20 | Ga0070713_100203493 | 3300005436 | Bacteria | 1789 |
| 21 | Ga0070713_100585589 | 3300005436 | Bacteria | 1059 |
| 22 | Ga0070710_10016512 | 3300005437 | Bacteria | 3759 |
| 23 | Ga0070701_10254920 | 3300005438 | Bacteria | 1061 |
| 24 | Ga0070711_100723851 | 3300005439 | Bacteria | 839 |
| 25 | Ga0070705_100045707 | 3300005440 | Bacteria | 2520 |
| 26 | Ga0070694_100059326 | 3300005444 | Unclassified | 2606 |
| 27 | Ga0070708_100136531 | 3300005445 | Bacteria | 2272 |
| 28 | Ga0070663_100061176 | 3300005455 | Bacteria | 2711 |
| 29 | Ga0070678_100058883 | 3300005456 | Bacteria | 2821 |
| 30 | Ga0070706_101462057 | 3300005467 | Bacteria | 625 |
| 31 | Ga0070679_100158632 | 3300005530 | Bacteria | 2237 |
| 32 | Ga0068853_100015934 | 3300005539 | Bacteria | 6178 |
| 33 | Ga0070672_100144506 | 3300005543 | Bacteria | 1965 |
| 34 | Ga0070686_100292178 | 3300005544 | Bacteria | 1206 |
| 35 | Ga0070695_100331949 | 3300005545 | Bacteria | 1134 |
| 36 | Ga0070696_100255480 | 3300005546 | Bacteria | 1327 |
| 37 | Ga0070665_100002791 | 3300005548 | Bacteria | 18933 |
| 38 | Ga0070665_100149044 | 3300005548 | Bacteria | 2342 |
| 39 | Ga0068855_100017723 | 3300005563 | Bacteria | 8562 |
| 40 | Ga0068855_100023384 | 3300005563 | Bacteria | 7401 |
| 41 | Ga0068857_100160473 | 3300005577 | Bacteria | 2040 |
| 42 | Ga0068857_100348079 | 3300005577 | Bacteria | 1372 |
| 43 | Ga0068856_100125258 | 3300005614 | Bacteria | 2572 |
| 44 | Ga0068856_100803195 | 3300005614 | Bacteria | 960 |
| 45 | Ga0070702_100019177 | 3300005615 | Bacteria | 3561 |
| 46 | Ga0068852_100091060 | 3300005616 | Bacteria | 2729 |
| 47 | Ga0068852_100577350 | 3300005616 | Bacteria | 1127 |
| 48 | Ga0068852_100639928 | 3300005616 | Bacteria | 1070 |
| 49 | Ga0068859_100659950 | 3300005617 | Bacteria | 1138 |
| 50 | Ga0068864_100073888 | 3300005618 | Bacteria | 2973 |
| 51 | Ga0068864_100942947 | 3300005618 | Bacteria | 854 |
| 52 | Ga0068866_10389507 | 3300005718 | Bacteria | 896 |
| 53 | Ga0068861_100040196 | 3300005719 | Bacteria | 3496 |
| 54 | Ga0068851_10377541 | 3300005834 | Bacteria | 830 |
| 55 | Ga0068863_100116664 | 3300005841 | Bacteria | 2544 |
| 56 | Ga0068863_100529036 | 3300005841 | Bacteria | 1163 |
| 57 | Ga0068860_100005671 | 3300005843 | Bacteria | 12608 |
| 58 | Ga0068860_100254221 | 3300005843 | Bacteria | 1712 |
| 59 | Ga0081540_1000420 | 3300005983 | Bacteria | 41918 |
| 60 | Ga0070717_10126018 | 3300006028 | Bacteria | 2199 |
| 61 | Ga0075365_10267729 | 3300006038 | Bacteria | 1202 |
| 62 | Ga0075365_10293200 | 3300006038 | Bacteria | 1145 |
| 63 | Ga0075432_10018971 | 3300006058 | Unclassified | 2348 |
| 64 | Ga0070716_100004198 | 3300006173 | Bacteria | 6854 |
| 65 | Ga0070712_100065325 | 3300006175 | Bacteria | 2582 |
| 66 | Ga0097621_100294470 | 3300006237 | Bacteria | 1432 |
| 67 | Ga0075428_100031042 | 3300006844 | Bacteria | 5908 |
| 68 | Ga0075428_101503180 | 3300006844 | Bacteria | 705 |
| 69 | Ga0075430_100003599 | 3300006846 | Bacteria | 12989 |
| 70 | Ga0075430_100075146 | 3300006846 | Bacteria | 2833 |
| 71 | Ga0075431_100032228 | 3300006847 | Bacteria | 5400 |
| 72 | Ga0075431_100360508 | 3300006847 | Bacteria | 1460 |
| 73 | Ga0075433_10189880 | 3300006852 | Unclassified | 1828 |
| 74 | Ga0075434_100007731 | 3300006871 | Bacteria | 9954 |
| 75 | Ga0075429_100190782 | 3300006880 | Bacteria | 1795 |
| 76 | Ga0075429_100246950 | 3300006880 | Bacteria | 1563 |
| 77 | Ga0068865_100854344 | 3300006881 | Bacteria | 789 |
| 78 | Ga0097620_100660007 | 3300006931 | Bacteria | 1138 |
| 79 | Ga0075435_100004961 | 3300007076 | Bacteria | 9230 |
| 80 | Ga0105251_10125516 | 3300009011 | Bacteria | 1165 |
| 81 | Ga0105240_10185387 | 3300009093 | Bacteria | 2451 |
| 82 | Ga0111539_10073290 | 3300009094 | Bacteria | 4037 |
| 83 | Ga0111539_10288630 | 3300009094 | Bacteria | 1909 |
| 84 | Ga0105247_10118098 | 3300009101 | Bacteria | 1715 |
| 85 | Ga0114129_10300493 | 3300009147 | Bacteria | 2139 |
| 86 | Ga0105243_11151567 | 3300009148 | Bacteria | 786 |
| 87 | Ga0105241_10113786 | 3300009174 | Bacteria | 2169 |
| 88 | Ga0105241_10759005 | 3300009174 | Bacteria | 890 |
| 89 | Ga0105242_10084176 | 3300009176 | Unclassified | 2665 |
| 90 | Ga0105237_10167406 | 3300009545 | Bacteria | 2197 |
| 91 | Ga0105238_10531611 | 3300009551 | Bacteria | 1179 |
| 92 | Ga0105249_10000772 | 3300009553 | Bacteria | 28654 |
| 93 | Ga0105239_10044809 | 3300010375 | Bacteria | 4848 |
| 94 | Ga0105239_11107167 | 3300010375 | Bacteria | 912 |
| 95 | Ga0105246_10023334 | 3300011119 | Bacteria | 4002 |
| 96 | Ga0157373_10342596 | 3300013100 | Bacteria | 1065 |
| 97 | Ga0157371_10170883 | 3300013102 | Bacteria | 1553 |
| 98 | Ga0157370_10021378 | 3300013104 | Bacteria | 6448 |
| 99 | Ga0157369_10092511 | 3300013105 | Bacteria | 3227 |
| 100 | Ga0157369_10279354 | 3300013105 | Bacteria | 1739 |
| 101 | Ga0157369_10694126 | 3300013105 | Bacteria | 1048 |
| 102 | Ga0157374_10091613 | 3300013296 | Bacteria | 2899 |
| 103 | Ga0157374_10936319 | 3300013296 | Bacteria | 884 |
| 104 | Ga0157378_10081302 | 3300013297 | Bacteria | 2928 |
| 105 | Ga0163162_10024569 | 3300013306 | Bacteria | 5950 |
| 106 | Ga0157372_10063663 | 3300013307 | Bacteria | 4136 |
| 107 | Ga0157372_10545025 | 3300013307 | Bacteria | 1352 |
| 108 | Ga0157372_10557652 | 3300013307 | Bacteria | 1335 |
| 109 | Ga0157372_13252626 | 3300013307 | Unclassified | 518 |
| 110 | Ga0157375_10158992 | 3300013308 | Bacteria | 2400 |
| 111 | Ga0157375_10621880 | 3300013308 | Bacteria | 1238 |
| 112 | Ga0157375_11392128 | 3300013308 | Bacteria | 826 |
| 113 | Ga0163163_10094473 | 3300014325 | Bacteria | 3008 |
| 114 | Ga0163163_10353331 | 3300014325 | Bacteria | 1526 |
| 115 | Ga0157380_10016588 | 3300014326 | Bacteria | 5436 |
| 116 | Ga0157380_10205240 | 3300014326 | Bacteria | 1752 |
| 117 | Ga0157377_10102548 | 3300014745 | Bacteria | 1707 |
| 118 | Ga0157377_10486678 | 3300014745 | Bacteria | 859 |
| 119 | Ga0157379_10024209 | 3300014968 | Bacteria | 5389 |
| 120 | Ga0206353_11534490 | 3300020082 | Bacteria | 1839 |
| 121 | Ga0213876_10079310 | 3300021384 | Bacteria | 1735 |
| 122 | Ga0213875_10000433 | 3300021388 | Bacteria | 36593 |
| 123 | Ga0207692_10341993 | 3300025898 | Bacteria | 920 |
| 124 | Ga0207642_10149583 | 3300025899 | Bacteria | 1241 |
| 125 | Ga0207688_10002469 | 3300025901 | Bacteria | 9948 |
| 126 | Ga0207688_10006435 | 3300025901 | Bacteria | 6398 |
| 127 | Ga0207647_10095917 | 3300025904 | Bacteria | 1766 |
| 128 | Ga0207647_10400823 | 3300025904 | Bacteria | 773 |
| 129 | Ga0207685_10208078 | 3300025905 | Bacteria | 923 |
| 130 | Ga0207699_10194993 | 3300025906 | Bacteria | 1369 |
| 131 | Ga0207705_10231238 | 3300025909 | Bacteria | 1406 |
| 132 | Ga0207654_10119638 | 3300025911 | Bacteria | 1652 |
| 133 | Ga0207695_10437761 | 3300025913 | Bacteria | 1191 |
| 134 | Ga0207671_10493887 | 3300025914 | Bacteria | 976 |
| 135 | Ga0207693_10002190 | 3300025915 | Bacteria | 17036 |
| 136 | Ga0207663_10149396 | 3300025916 | Bacteria | 1637 |
| 137 | Ga0207660_10083033 | 3300025917 | Bacteria | 2358 |
| 138 | Ga0207657_10011850 | 3300025919 | Bacteria | 8631 |
| 139 | Ga0207657_10351365 | 3300025919 | Bacteria | 1163 |
| 140 | Ga0207681_10490476 | 3300025923 | Bacteria | 1005 |
| 141 | Ga0207694_10183575 | 3300025924 | Bacteria | 1697 |
| 142 | Ga0207694_10256866 | 3300025924 | Bacteria | 1431 |
| 143 | Ga0207694_10467100 | 3300025924 | Bacteria | 1054 |
| 144 | Ga0207687_10025886 | 3300025927 | Bacteria | 3927 |
| 145 | Ga0207687_10162892 | 3300025927 | Bacteria | 1713 |
| 146 | Ga0207687_10293152 | 3300025927 | Unclassified | 1308 |
| 147 | Ga0207700_10209236 | 3300025928 | Bacteria | 1648 |
| 148 | Ga0207664_10087680 | 3300025929 | Bacteria | 2544 |
| 149 | Ga0207644_10028958 | 3300025931 | Bacteria | 3839 |
| 150 | Ga0207690_10103109 | 3300025932 | Bacteria | 2041 |
| 151 | Ga0207690_10770091 | 3300025932 | Bacteria | 794 |
| 152 | Ga0207670_10378278 | 3300025936 | Unclassified | 1127 |
| 153 | Ga0207669_10858818 | 3300025937 | Bacteria | 756 |
| 154 | Ga0207704_11249196 | 3300025938 | Bacteria | 634 |
| 155 | Ga0207665_10001124 | 3300025939 | Bacteria | 17986 |
| 156 | Ga0207711_10379477 | 3300025941 | Bacteria | 1311 |
| 157 | Ga0207661_10285893 | 3300025944 | Bacteria | 1475 |
| 158 | Ga0207679_10072159 | 3300025945 | Bacteria | 2607 |
| 159 | Ga0207667_10026351 | 3300025949 | Bacteria | 6354 |
| 160 | Ga0207667_10033499 | 3300025949 | Bacteria | 5522 |
| 161 | Ga0207667_10289569 | 3300025949 | Bacteria | 1673 |
| 162 | Ga0207651_10240656 | 3300025960 | Bacteria | 1475 |
| 163 | Ga0207640_10162326 | 3300025981 | Bacteria | 1655 |
| 164 | Ga0207677_10780493 | 3300026023 | Bacteria | 854 |
| 165 | Ga0207677_10825974 | 3300026023 | Bacteria | 831 |
| 166 | Ga0207703_10306842 | 3300026035 | Bacteria | 1449 |
| 167 | Ga0207678_10006539 | 3300026067 | Bacteria | 10334 |
| 168 | Ga0207678_10246760 | 3300026067 | Bacteria | 1529 |
| 169 | Ga0207702_10033076 | 3300026078 | Bacteria | 4317 |
| 170 | Ga0207702_10260625 | 3300026078 | Bacteria | 1632 |
| 171 | Ga0207641_10077305 | 3300026088 | Bacteria | 2880 |
| 172 | Ga0207641_10339055 | 3300026088 | Bacteria | 1430 |
| 173 | Ga0207648_10095384 | 3300026089 | Bacteria | 2602 |
| 174 | Ga0207674_10011866 | 3300026116 | Bacteria | 9767 |
| 175 | Ga0207674_10107726 | 3300026116 | Bacteria | 2763 |
| 176 | Ga0207674_10789724 | 3300026116 | Bacteria | 916 |
| 177 | Ga0207675_100014455 | 3300026118 | Bacteria | 7360 |
| 178 | Ga0207683_10020963 | 3300026121 | Bacteria | 5594 |
| 179 | Ga0207698_10300668 | 3300026142 | Bacteria | 1494 |
| 180 | Ga0207698_11842965 | 3300026142 | Bacteria | 620 |
| 181 | Ga0207428_10096737 | 3300027907 | Unclassified | 2286 |
| 182 | Ga0268266_10013713 | 3300028379 | Bacteria | 6979 |
| 183 | Ga0268266_10031659 | 3300028379 | Bacteria | 4493 |
| 184 | Ga0268266_10107016 | 3300028379 | Bacteria | 2473 |
| 185 | Ga0268265_10086550 | 3300028380 | Bacteria | 2491 |
| 186 | Ga0268264_10009753 | 3300028381 | Bacteria | 7950 |
| 187 | Ga0268264_10096157 | 3300028381 | Bacteria | 2564 |
| 188 | Ga0307515_10000095 | 3300028794 | Bacteria | 208513 |
| 189 | Ga0307515_10003919 | 3300028794 | Bacteria | 31059 |
| 190 | Ga0307511_10000374 | 3300030521 | Bacteria | 47666 |
| 191 | Ga0307513_10565193 | 3300031456 | Bacteria | 849 |
| 192 | Ga0307509_10039901 | 3300031507 | Bacteria | 5110 |
| 193 | Ga0307508_10165170 | 3300031616 | Bacteria | 1817 |
| 194 | Ga0326468_10018863 | 3300031889 | Bacteria | 802 |
| 195 | Ga0307406_10691551 | 3300031901 | Bacteria | 851 |
| 196 | Ga0307409_100323965 | 3300031995 | Bacteria | 1443 |
| 197 | Ga0307409_100979460 | 3300031995 | Bacteria | 863 |
| 198 | Ga0307416_100102560 | 3300032002 | Bacteria | 2495 |
| 199 | Ga0307416_101456111 | 3300032002 | Bacteria | 791 |
| 200 | Ga0307411_11160014 | 3300032005 | Bacteria | 699 |
| 201 | Ga0307510_10033534 | 3300033180 | Bacteria | 5765 |
| 202 | Ga0373930_0125061 | 3300034816 | Bacteria | 629 |
| 203 | Ga0373958_0056336 | 3300034819 | Bacteria | 841 |
| 204 | Ga0373938_0141240 | 3300034957 | Bacteria | 635 |
| 205 | Ga0373940_0002423 | 3300035088 | Bacteria | 3626 |
| 206 | Ga0373940_0159229 | 3300035088 | Unclassified | 724 |
| 207 | Ga0373941_0097367 | 3300035115 | Bacteria | 1019 |
| 208 | Ga0373960_0128962 | 3300035121 | Bacteria | 846 |
| 209 | Ga0373942_0003984 | 3300035207 | Bacteria | 3446 |
| 210 | Ga0373962_0034988 | 3300035242 | Bacteria | 1393 |
| 211 | Ga0373931_0107327 | 3300035691 | Bacteria | 1579 |
| 212 | Ga0373931_0148918 | 3300035691 | Bacteria | 1362 |
| 213 | Ga0373927_0221493 | 3300035695 | Unclassified | 1243 |
| 214 | Ga0395899_0665997 | 3300037312 | Bacteria | 656 |
| 215 | Ga0395900_0007503 | 3300037418 | Bacteria | 11268 |
| 216 | Ga0395900_0037646 | 3300037418 | Bacteria | 4987 |
| 217 | Ga0395898_0001314 | 3300037466 | Bacteria | 36175 |
| 218 | Ga0395898_0360751 | 3300037466 | Bacteria | 1386 |
| 219 | Ga0436364_0022880 | 3300037853 | Bacteria | 3371 |
| 220 | Ga0436364_1040466 | 3300037853 | Bacteria | 95595 |
| 221 | Ga0436365_0764540 | 3300039437 | Bacteria | 1864 |
| 222 | Ga0451802_0159044 | 3300041460 | Bacteria | 659 |
| 223 | Ga0451843_1220755 | 3300041509 | Bacteria | 691 |
| 224 | Ga0466969_0019738 | 3300044656 | Bacteria | 3498 |
| 225 | Ga0466969_0200727 | 3300044656 | Bacteria | 910 |
| 226 | Ga0466972_0068714 | 3300044658 | Bacteria | 1692 |
| 227 | Ga0466966_0134935 | 3300044684 | Bacteria | 1509 |
| 228 | Ga0466966_0329835 | 3300044684 | Bacteria | 917 |
| 229 | Ga0466961_0043526 | 3300044693 | Bacteria | 2875 |
| 230 | Ga0466963_0275258 | 3300044694 | Bacteria | 1183 |
| 231 | Ga0466971_0093332 | 3300044719 | Bacteria | 1379 |
| 232 | Ga0466971_0251198 | 3300044719 | Bacteria | 843 |
| 233 | Ga0466970_0138600 | 3300044765 | Bacteria | 1339 |
| 234 | Ga0466960_0106122 | 3300044901 | Bacteria | 1453 |
| 235 | Ga0466960_0301091 | 3300044901 | Bacteria | 903 |
| 236 | Ga0466960_0329749 | 3300044901 | Bacteria | 866 |
| 237 | Ga0466959_0026105 | 3300045049 | Bacteria | 4332 |
| 238 | Ga0466959_0470275 | 3300045049 | Bacteria | 851 |
| 239 | Ga0466958_0167521 | 3300045836 | Bacteria | 1390 |
| 240 | Ga0466958_0908724 | 3300045836 | Bacteria | 574 |
| 241 | Ga0466967_0041622 | 3300045976 | Bacteria | 3963 |
| 242 | Ga0466967_0210163 | 3300045976 | Bacteria | 1845 |
| 243 | Ga0466967_0280127 | 3300045976 | Bacteria | 1600 |
| 244 | Ga0466967_0553229 | 3300045976 | Bacteria | 1133 |
| 245 | Ga0466967_0642507 | 3300045976 | Bacteria | 1049 |
| 246 | Ga0466967_0897020 | 3300045976 | Bacteria | 881 |
| 247 | Ga0466967_0966700 | 3300045976 | Bacteria | 848 |
| 248 | Ga0495628_0158644 | 3300046516 | Unclassified | 1720 |
| 249 | Ga0496100_0407920 | 3300048903 | Bacteria | 1036 |
| 250 | Ga0496101_0446844 | 3300048904 | Bacteria | 1020 |
| 251 | Ga0496102_0137018 | 3300048905 | Unclassified | 2294 |
| 252 | Ga0496102_0223647 | 3300048905 | Bacteria | 1775 |
| 253 | Ga0496102_0898184 | 3300048905 | Bacteria | 808 |
| 254 | Ga0496103_0060409 | 3300048906 | Bacteria | 2356 |
| 255 | Ga0496104_0100756 | 3300048907 | Bacteria | 2765 |
| 256 | Ga0496104_0232587 | 3300048907 | Bacteria | 1755 |
| 257 | Ga0496104_0911855 | 3300048907 | Bacteria | 784 |
| 258 | Ga0496105_0009854 | 3300048908 | Bacteria | 7489 |
| 259 | Ga0496105_0275928 | 3300048908 | Bacteria | 1357 |
| 260 | Ga0496106_0041642 | 3300048909 | Bacteria | 3442 |
| 261 | Ga0496108_0068702 | 3300048911 | Bacteria | 2989 |
| 262 | Ga0496109_0254256 | 3300048912 | Bacteria | 1655 |
| 263 | Ga0496110_0054038 | 3300048913 | Bacteria | 3532 |
| 264 | Ga0496110_0236955 | 3300048913 | Bacteria | 1660 |
| 265 | Ga0496112_0132671 | 3300048915 | Bacteria | 2462 |
| 266 | Ga0496112_0241704 | 3300048915 | Bacteria | 1758 |
| 267 | Ga0496113_0055563 | 3300048916 | Bacteria | 2968 |
| 268 | Ga0496114_0014646 | 3300048917 | Bacteria | 6301 |
| 269 | Ga0496114_0018068 | 3300048917 | Bacteria | 5698 |
| 270 | Ga0496115_0017454 | 3300048918 | Bacteria | 5489 |
| 271 | Ga0496118_0052276 | 3300048921 | Bacteria | 3118 |
| 272 | Ga0496118_0336284 | 3300048921 | Unclassified | 812 |
| 273 | Ga0496119_0000470 | 3300048922 | Bacteria | 54985 |
| 274 | Ga0496120_0002981 | 3300048923 | Bacteria | 16112 |
| 275 | Ga0496125_0016817 | 3300048928 | Bacteria | 7012 |
| 276 | Ga0496126_0270650 | 3300048929 | Bacteria | 1410 |
| 277 | Ga0496126_0507620 | 3300048929 | Bacteria | 963 |
| 278 | Ga0501031_0476306 | 3300049568 | Bacteria | 806 |
| 279 | Ga0501033_0002196 | 3300049570 | Bacteria | 16842 |
| 280 | Ga0501034_0437043 | 3300049571 | Bacteria | 1228 |
| 281 | Ga0501042_0096553 | 3300049578 | Bacteria | 2123 |
| 282 | Ga0501047_0474254 | 3300049581 | Bacteria | 1079 |
| 283 | Ga0501069_0274306 | 3300049585 | Bacteria | 986 |
| 284 | Ga0501044_0005985 | 3300049823 | Bacteria | 13450 |
| 285 | Ga0501044_0228108 | 3300049823 | Bacteria | 1811 |
| 286 | nmdc:mga0yw44_458165_c1 | 3300050492 | Bacteria | 864 |
| 287 | nmdc:mga0yw44_956694_c1 | 3300050492 | Bacteria | 580 |
| 288 | nmdc:mga05p37_84171_c1 | 3300050507 | Bacteria | 3919 |
| 289 | nmdc:mga09592_479792_c1 | 3300050508 | Bacteria | 1071 |
| 290 | nmdc:mga09592_824438_c1 | 3300050508 | Bacteria | 784 |
| 291 | nmdc:mga0qj67_31518_c1 | 3300050509 | Bacteria | 4130 |
| 292 | nmdc:mga06r32_166762_c1 | 3300050510 | Bacteria | 2186 |
| 293 | nmdc:mga06r32_605151_c1 | 3300050510 | Bacteria | 1067 |
| 294 | nmdc:mga08y16_220320_c1 | 3300050511 | Bacteria | 1964 |
| 295 | nmdc:mga08y16_95751_c1 | 3300050511 | Bacteria | 3092 |
| 296 | nmdc:mga0n895_9365_c1 | 3300050512 | Bacteria | 8564 |
| 297 | nmdc:mga0rr50_168106_c1 | 3300050513 | Bacteria | 1785 |
| 298 | nmdc:mga08x19_69435_c1 | 3300050514 | Bacteria | 2295 |
| 299 | Ga0495601_0039189 | 3300053077 | Unclassified | 2967 |
| 300 | Ga0500616_0010602 | 3300053153 | Bacteria | 5504 |
| 301 | Ga0500637_0016168 | 3300053178 | Unclassified | 3972 |
| 302 | Ga0466962_0547560 | 3300061719 | Bacteria | 588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10936319 | Ga0157374_109363192 | 141 |
| 2 | 3300014745 | Ga0157377_10102548 | Ga0157377_101025482 | 141 |
| 3 | 3300009147 | Ga0114129_10300493 | Ga0114129_103004933 | 143 |
| 4 | 3300045836 | Ga0466958_0908724 | Ga0466958_0908724_14_451 | 143 |
| 5 | 3300050507 | nmdc:mga05p37_84171_c1 | nmdc:mga05p37_84171_c1_423_854 | 143 |
| 6 | 3300050508 | nmdc:mga09592_824438_c1 | nmdc:mga09592_824438_c1_182_613 | 143 |
| 7 | 3300050509 | nmdc:mga0qj67_31518_c1 | nmdc:mga0qj67_31518_c1_296_727 | 143 |
| 8 | 3300050510 | nmdc:mga06r32_166762_c1 | nmdc:mga06r32_166762_c1_1220_1651 | 143 |
| 9 | 3300009093 | Ga0105240_10185387 | Ga0105240_101853872 | 144 |
| 10 | 3300009174 | Ga0105241_10759005 | Ga0105241_107590051 | 144 |
| 11 | 3300013307 | Ga0157372_13252626 | Ga0157372_132526261 | 144 |
| 12 | 3300014325 | Ga0163163_10094473 | Ga0163163_100944732 | 144 |
| 13 | 3300048908 | Ga0496105_0275928 | Ga0496105_0275928_694_1206 | 144 |
| 14 | 3300048917 | Ga0496114_0018068 | Ga0496114_0018068_3992_4504 | 144 |
| 15 | 3300048929 | Ga0496126_0270650 | Ga0496126_0270650_715_1227 | 144 |
| 16 | 3300049578 | Ga0501042_0096553 | Ga0501042_0096553_75_542 | 144 |
| 17 | 3300050492 | nmdc:mga0yw44_956694_c1 | nmdc:mga0yw44_956694_c1_48_527 | 144 |
| 18 | 3300045976 | Ga0466967_0280127 | Ga0466967_0280127_282_743 | 153 |
| 19 | 3300031456 | Ga0307513_10565193 | Ga0307513_105651932 | 155 |
| 20 | 3300031507 | Ga0307509_10039901 | Ga0307509_100399014 | 156 |
| 21 | 3300005366 | Ga0070659_100043664 | Ga0070659_1000436644 | 157 |
| 22 | 3300005543 | Ga0070672_100144506 | Ga0070672_1001445062 | 157 |
| 23 | 3300005843 | Ga0068860_100254221 | Ga0068860_1002542213 | 157 |
| 24 | 3300006844 | Ga0075428_101503180 | Ga0075428_1015031802 | 157 |
| 25 | 3300009094 | Ga0111539_10073290 | Ga0111539_100732904 | 157 |
| 26 | 3300013105 | Ga0157369_10694126 | Ga0157369_106941262 | 157 |
| 27 | 3300014326 | Ga0157380_10205240 | Ga0157380_102052403 | 157 |
| 28 | 3300025901 | Ga0207688_10006435 | Ga0207688_100064356 | 157 |
| 29 | 3300025924 | Ga0207694_10256866 | Ga0207694_102568662 | 157 |
| 30 | 3300025927 | Ga0207687_10293152 | Ga0207687_102931522 | 157 |
| 31 | 3300025932 | Ga0207690_10103109 | Ga0207690_101031092 | 157 |
| 32 | 3300025960 | Ga0207651_10240656 | Ga0207651_102406563 | 157 |
| 33 | 3300026089 | Ga0207648_10095384 | Ga0207648_100953843 | 157 |
| 34 | 3300048905 | Ga0496102_0898184 | Ga0496102_0898184_38_511 | 157 |
| 35 | 3300050511 | nmdc:mga08y16_95751_c1 | nmdc:mga08y16_95751_c1_667_1140 | 157 |
| 36 | 3300005329 | Ga0070683_100014311 | Ga0070683_1000143113 | 158 |
| 37 | 3300006038 | Ga0075365_10267729 | Ga0075365_102677292 | 158 |
| 38 | 3300025944 | Ga0207661_10285893 | Ga0207661_102858932 | 158 |
| 39 | 3300049570 | Ga0501033_0002196 | Ga0501033_0002196_7796_8275 | 158 |
| 40 | 3300049581 | Ga0501047_0474254 | Ga0501047_0474254_366_845 | 158 |
| 41 | 3300049585 | Ga0501069_0274306 | Ga0501069_0274306_335_814 | 158 |
| 42 | 3300049823 | Ga0501044_0005985 | Ga0501044_0005985_6111_6590 | 158 |
| 43 | 3300050492 | nmdc:mga0yw44_458165_c1 | nmdc:mga0yw44_458165_c1_367_846 | 158 |
| 44 | iso_pu_bacteria | 2622736626 | 2623591538 | 158 |
| 45 | 3300005340 | Ga0070689_100063651 | Ga0070689_1000636512 | 159 |
| 46 | 3300005436 | Ga0070713_100203493 | Ga0070713_1002034932 | 159 |
| 47 | 3300005618 | Ga0068864_100942947 | Ga0068864_1009429471 | 159 |
| 48 | 3300013308 | Ga0157375_10621880 | Ga0157375_106218802 | 159 |
| 49 | 3300014325 | Ga0163163_10353331 | Ga0163163_103533312 | 159 |
| 50 | 3300025928 | Ga0207700_10209236 | Ga0207700_102092363 | 159 |
| 51 | 3300044658 | Ga0466972_0068714 | Ga0466972_0068714_57_536 | 159 |
| 52 | 3300044901 | Ga0466960_0329749 | Ga0466960_0329749_246_725 | 159 |
| 53 | 3300045976 | Ga0466967_0041622 | Ga0466967_0041622_445_924 | 159 |
| 54 | 3300048907 | Ga0496104_0232587 | Ga0496104_0232587_127_660 | 159 |
| 55 | 3300048928 | Ga0496125_0016817 | Ga0496125_0016817_5209_5700 | 159 |
| 56 | 3300048929 | Ga0496126_0507620 | Ga0496126_0507620_262_753 | 159 |
| 57 | 3300005355 | Ga0070671_100020542 | Ga0070671_1000205423 | 160 |
| 58 | 3300005367 | Ga0070667_100180059 | Ga0070667_1001800592 | 160 |
| 59 | 3300005445 | Ga0070708_100136531 | Ga0070708_1001365312 | 160 |
| 60 | 3300005548 | Ga0070665_100002791 | Ga0070665_10000279113 | 160 |
| 61 | 3300005563 | Ga0068855_100017723 | Ga0068855_1000177232 | 160 |
| 62 | 3300005577 | Ga0068857_100160473 | Ga0068857_1001604732 | 160 |
| 63 | 3300005614 | Ga0068856_100803195 | Ga0068856_1008031952 | 160 |
| 64 | 3300005616 | Ga0068852_100577350 | Ga0068852_1005773501 | 160 |
| 65 | 3300005841 | Ga0068863_100116664 | Ga0068863_1001166643 | 160 |
| 66 | 3300005843 | Ga0068860_100005671 | Ga0068860_1000056713 | 160 |
| 67 | 3300006028 | Ga0070717_10126018 | Ga0070717_101260183 | 160 |
| 68 | 3300009174 | Ga0105241_10113786 | Ga0105241_101137864 | 160 |
| 69 | 3300009545 | Ga0105237_10167406 | Ga0105237_101674064 | 160 |
| 70 | 3300010375 | Ga0105239_11107167 | Ga0105239_111071671 | 160 |
| 71 | 3300025913 | Ga0207695_10437761 | Ga0207695_104377612 | 160 |
| 72 | 3300025924 | Ga0207694_10183575 | Ga0207694_101835753 | 160 |
| 73 | 3300025931 | Ga0207644_10028958 | Ga0207644_100289583 | 160 |
| 74 | 3300025949 | Ga0207667_10026351 | Ga0207667_100263513 | 160 |
| 75 | 3300025949 | Ga0207667_10033499 | Ga0207667_100334994 | 160 |
| 76 | 3300026078 | Ga0207702_10260625 | Ga0207702_102606253 | 160 |
| 77 | 3300026088 | Ga0207641_10077305 | Ga0207641_100773053 | 160 |
| 78 | 3300026116 | Ga0207674_10011866 | Ga0207674_100118668 | 160 |
| 79 | 3300026116 | Ga0207674_10789724 | Ga0207674_107897242 | 160 |
| 80 | 3300026142 | Ga0207698_11842965 | Ga0207698_118429651 | 160 |
| 81 | 3300028379 | Ga0268266_10013713 | Ga0268266_100137135 | 160 |
| 82 | 3300028379 | Ga0268266_10031659 | Ga0268266_100316595 | 160 |
| 83 | 3300028381 | Ga0268264_10009753 | Ga0268264_100097535 | 160 |
| 84 | 3300033180 | Ga0307510_10033534 | Ga0307510_100335345 | 160 |
| 85 | 3300034819 | Ga0373958_0056336 | Ga0373958_0056336_73_639 | 160 |
| 86 | 3300034957 | Ga0373938_0141240 | Ga0373938_0141240_15_581 | 160 |
| 87 | 3300035088 | Ga0373940_0002423 | Ga0373940_0002423_2176_2730 | 160 |
| 88 | 3300035207 | Ga0373942_0003984 | Ga0373942_0003984_2109_2663 | 160 |
| 89 | 3300037853 | Ga0436364_0022880 | Ga0436364_0022880_277_795 | 160 |
| 90 | 3300044656 | Ga0466969_0200727 | Ga0466969_0200727_258_740 | 160 |
| 91 | 3300044684 | Ga0466966_0329835 | Ga0466966_0329835_291_773 | 160 |
| 92 | 3300044693 | Ga0466961_0043526 | Ga0466961_0043526_230_712 | 160 |
| 93 | 3300044694 | Ga0466963_0275258 | Ga0466963_0275258_568_1050 | 160 |
| 94 | 3300044719 | Ga0466971_0093332 | Ga0466971_0093332_627_1109 | 160 |
| 95 | 3300044719 | Ga0466971_0251198 | Ga0466971_0251198_197_679 | 160 |
| 96 | 3300045049 | Ga0466959_0470275 | Ga0466959_0470275_100_582 | 160 |
| 97 | 3300045836 | Ga0466958_0167521 | Ga0466958_0167521_660_1142 | 160 |
| 98 | 3300045976 | Ga0466967_0897020 | Ga0466967_0897020_246_728 | 160 |
| 99 | 3300061719 | Ga0466962_0547560 | Ga0466962_0547560_64_546 | 160 |
| 100 | 3300006844 | Ga0075428_100031042 | Ga0075428_1000310423 | 161 |
| 101 | 3300006846 | Ga0075430_100003599 | Ga0075430_1000035995 | 161 |
| 102 | 3300006847 | Ga0075431_100032228 | Ga0075431_1000322284 | 161 |
| 103 | 3300006880 | Ga0075429_100190782 | Ga0075429_1001907823 | 161 |
| 104 | 3300028794 | Ga0307515_10000095 | Ga0307515_10000095123 | 161 |
| 105 | 3300031889 | Ga0326468_10018863 | Ga0326468_100188632 | 161 |
| 106 | 3300031901 | Ga0307406_10691551 | Ga0307406_106915511 | 161 |
| 107 | 3300031995 | Ga0307409_100323965 | Ga0307409_1003239652 | 161 |
| 108 | 3300031995 | Ga0307409_100979460 | Ga0307409_1009794601 | 161 |
| 109 | 3300032002 | Ga0307416_100102560 | Ga0307416_1001025605 | 161 |
| 110 | 3300032002 | Ga0307416_101456111 | Ga0307416_1014561112 | 161 |
| 111 | 3300032005 | Ga0307411_11160014 | Ga0307411_111600142 | 161 |
| 112 | 3300041460 | Ga0451802_0159044 | Ga0451802_0159044_37_522 | 161 |
| 113 | 3300048905 | Ga0496102_0223647 | Ga0496102_0223647_601_1110 | 161 |
| 114 | 3300048906 | Ga0496103_0060409 | Ga0496103_0060409_782_1291 | 161 |
| 115 | 3300048921 | Ga0496118_0052276 | Ga0496118_0052276_2414_2923 | 161 |
| 116 | 3300048922 | Ga0496119_0000470 | Ga0496119_0000470_23888_24397 | 161 |
| 117 | 3300048923 | Ga0496120_0002981 | Ga0496120_0002981_7664_8173 | 161 |
| 118 | 3300053153 | Ga0500616_0010602 | Ga0500616_0010602_2374_2895 | 161 |
| 119 | 3300005327 | Ga0070658_11189904 | Ga0070658_111899041 | 162 |
| 120 | 3300005329 | Ga0070683_100417052 | Ga0070683_1004170522 | 162 |
| 121 | 3300005334 | Ga0068869_100701291 | Ga0068869_1007012912 | 162 |
| 122 | 3300005335 | Ga0070666_11177998 | Ga0070666_111779981 | 162 |
| 123 | 3300005336 | Ga0070680_100216118 | Ga0070680_1002161182 | 162 |
| 124 | 3300005337 | Ga0070682_100059556 | Ga0070682_1000595562 | 162 |
| 125 | 3300005338 | Ga0068868_100001664 | Ga0068868_10000166410 | 162 |
| 126 | 3300005340 | Ga0070689_100382050 | Ga0070689_1003820501 | 162 |
| 127 | 3300005343 | Ga0070687_100043055 | Ga0070687_1000430553 | 162 |
| 128 | 3300005345 | Ga0070692_10052543 | Ga0070692_100525432 | 162 |
| 129 | 3300005364 | Ga0070673_100401420 | Ga0070673_1004014202 | 162 |
| 130 | 3300005367 | Ga0070667_100255477 | Ga0070667_1002554772 | 162 |
| 131 | 3300005434 | Ga0070709_10060903 | Ga0070709_100609032 | 162 |
| 132 | 3300005435 | Ga0070714_100379935 | Ga0070714_1003799352 | 162 |
| 133 | 3300005436 | Ga0070713_100585589 | Ga0070713_1005855891 | 162 |
| 134 | 3300005437 | Ga0070710_10016512 | Ga0070710_100165124 | 162 |
| 135 | 3300005438 | Ga0070701_10254920 | Ga0070701_102549202 | 162 |
| 136 | 3300005439 | Ga0070711_100723851 | Ga0070711_1007238511 | 162 |
| 137 | 3300005440 | Ga0070705_100045707 | Ga0070705_1000457072 | 162 |
| 138 | 3300005444 | Ga0070694_100059326 | Ga0070694_1000593264 | 162 |
| 139 | 3300005455 | Ga0070663_100061176 | Ga0070663_1000611761 | 162 |
| 140 | 3300005456 | Ga0070678_100058883 | Ga0070678_1000588833 | 162 |
| 141 | 3300005467 | Ga0070706_101462057 | Ga0070706_1014620571 | 162 |
| 142 | 3300005530 | Ga0070679_100158632 | Ga0070679_1001586323 | 162 |
| 143 | 3300005539 | Ga0068853_100015934 | Ga0068853_1000159345 | 162 |
| 144 | 3300005544 | Ga0070686_100292178 | Ga0070686_1002921782 | 162 |
| 145 | 3300005545 | Ga0070695_100331949 | Ga0070695_1003319492 | 162 |
| 146 | 3300005546 | Ga0070696_100255480 | Ga0070696_1002554802 | 162 |
| 147 | 3300005548 | Ga0070665_100149044 | Ga0070665_1001490442 | 162 |
| 148 | 3300005563 | Ga0068855_100023384 | Ga0068855_1000233846 | 162 |
| 149 | 3300005577 | Ga0068857_100348079 | Ga0068857_1003480792 | 162 |
| 150 | 3300005614 | Ga0068856_100125258 | Ga0068856_1001252582 | 162 |
| 151 | 3300005615 | Ga0070702_100019177 | Ga0070702_1000191773 | 162 |
| 152 | 3300005616 | Ga0068852_100091060 | Ga0068852_1000910603 | 162 |
| 153 | 3300005616 | Ga0068852_100639928 | Ga0068852_1006399282 | 162 |
| 154 | 3300005617 | Ga0068859_100659950 | Ga0068859_1006599502 | 162 |
| 155 | 3300005618 | Ga0068864_100073888 | Ga0068864_1000738882 | 162 |
| 156 | 3300005718 | Ga0068866_10389507 | Ga0068866_103895072 | 162 |
| 157 | 3300005719 | Ga0068861_100040196 | Ga0068861_1000401963 | 162 |
| 158 | 3300005834 | Ga0068851_10377541 | Ga0068851_103775411 | 162 |
| 159 | 3300005841 | Ga0068863_100529036 | Ga0068863_1005290362 | 162 |
| 160 | 3300005983 | Ga0081540_1000420 | Ga0081540_10004206 | 162 |
| 161 | 3300006038 | Ga0075365_10293200 | Ga0075365_102932002 | 162 |
| 162 | 3300006058 | Ga0075432_10018971 | Ga0075432_100189714 | 162 |
| 163 | 3300006173 | Ga0070716_100004198 | Ga0070716_1000041985 | 162 |
| 164 | 3300006175 | Ga0070712_100065325 | Ga0070712_1000653252 | 162 |
| 165 | 3300006237 | Ga0097621_100294470 | Ga0097621_1002944702 | 162 |
| 166 | 3300006846 | Ga0075430_100075146 | Ga0075430_1000751464 | 162 |
| 167 | 3300006847 | Ga0075431_100360508 | Ga0075431_1003605083 | 162 |
| 168 | 3300006852 | Ga0075433_10189880 | Ga0075433_101898802 | 162 |
| 169 | 3300006871 | Ga0075434_100007731 | Ga0075434_1000077313 | 162 |
| 170 | 3300006880 | Ga0075429_100246950 | Ga0075429_1002469502 | 162 |
| 171 | 3300006881 | Ga0068865_100854344 | Ga0068865_1008543442 | 162 |
| 172 | 3300006931 | Ga0097620_100660007 | Ga0097620_1006600072 | 162 |
| 173 | 3300007076 | Ga0075435_100004961 | Ga0075435_1000049617 | 162 |
| 174 | 3300009011 | Ga0105251_10125516 | Ga0105251_101255162 | 162 |
| 175 | 3300009094 | Ga0111539_10288630 | Ga0111539_102886302 | 162 |
| 176 | 3300009101 | Ga0105247_10118098 | Ga0105247_101180981 | 162 |
| 177 | 3300009148 | Ga0105243_11151567 | Ga0105243_111515672 | 162 |
| 178 | 3300009176 | Ga0105242_10084176 | Ga0105242_100841761 | 162 |
| 179 | 3300009551 | Ga0105238_10531611 | Ga0105238_105316112 | 162 |
| 180 | 3300009553 | Ga0105249_10000772 | Ga0105249_1000077214 | 162 |
| 181 | 3300010375 | Ga0105239_10044809 | Ga0105239_100448092 | 162 |
| 182 | 3300011119 | Ga0105246_10023334 | Ga0105246_100233342 | 162 |
| 183 | 3300013100 | Ga0157373_10342596 | Ga0157373_103425961 | 162 |
| 184 | 3300013102 | Ga0157371_10170883 | Ga0157371_101708831 | 162 |
| 185 | 3300013104 | Ga0157370_10021378 | Ga0157370_100213784 | 162 |
| 186 | 3300013105 | Ga0157369_10092511 | Ga0157369_100925112 | 162 |
| 187 | 3300013105 | Ga0157369_10279354 | Ga0157369_102793542 | 162 |
| 188 | 3300013296 | Ga0157374_10091613 | Ga0157374_100916133 | 162 |
| 189 | 3300013297 | Ga0157378_10081302 | Ga0157378_100813023 | 162 |
| 190 | 3300013306 | Ga0163162_10024569 | Ga0163162_100245697 | 162 |
| 191 | 3300013307 | Ga0157372_10063663 | Ga0157372_100636634 | 162 |
| 192 | 3300013307 | Ga0157372_10545025 | Ga0157372_105450251 | 162 |
| 193 | 3300013307 | Ga0157372_10557652 | Ga0157372_105576522 | 162 |
| 194 | 3300013308 | Ga0157375_10158992 | Ga0157375_101589922 | 162 |
| 195 | 3300013308 | Ga0157375_11392128 | Ga0157375_113921281 | 162 |
| 196 | 3300014326 | Ga0157380_10016588 | Ga0157380_100165887 | 162 |
| 197 | 3300014745 | Ga0157377_10486678 | Ga0157377_104866781 | 162 |
| 198 | 3300014968 | Ga0157379_10024209 | Ga0157379_100242093 | 162 |
| 199 | 3300020082 | Ga0206353_11534490 | Ga0206353_115344902 | 162 |
| 200 | 3300021384 | Ga0213876_10079310 | Ga0213876_100793103 | 162 |
| 201 | 3300021388 | Ga0213875_10000433 | Ga0213875_1000043316 | 162 |
| 202 | 3300025898 | Ga0207692_10341993 | Ga0207692_103419931 | 162 |
| 203 | 3300025899 | Ga0207642_10149583 | Ga0207642_101495831 | 162 |
| 204 | 3300025901 | Ga0207688_10002469 | Ga0207688_100024694 | 162 |
| 205 | 3300025904 | Ga0207647_10095917 | Ga0207647_100959172 | 162 |
| 206 | 3300025904 | Ga0207647_10400823 | Ga0207647_104008231 | 162 |
| 207 | 3300025905 | Ga0207685_10208078 | Ga0207685_102080782 | 162 |
| 208 | 3300025906 | Ga0207699_10194993 | Ga0207699_101949932 | 162 |
| 209 | 3300025909 | Ga0207705_10231238 | Ga0207705_102312381 | 162 |
| 210 | 3300025911 | Ga0207654_10119638 | Ga0207654_101196382 | 162 |
| 211 | 3300025914 | Ga0207671_10493887 | Ga0207671_104938872 | 162 |
| 212 | 3300025915 | Ga0207693_10002190 | Ga0207693_100021909 | 162 |
| 213 | 3300025916 | Ga0207663_10149396 | Ga0207663_101493962 | 162 |
| 214 | 3300025917 | Ga0207660_10083033 | Ga0207660_100830333 | 162 |
| 215 | 3300025919 | Ga0207657_10011850 | Ga0207657_100118503 | 162 |
| 216 | 3300025919 | Ga0207657_10351365 | Ga0207657_103513652 | 162 |
| 217 | 3300025923 | Ga0207681_10490476 | Ga0207681_104904761 | 162 |
| 218 | 3300025924 | Ga0207694_10467100 | Ga0207694_104671001 | 162 |
| 219 | 3300025927 | Ga0207687_10025886 | Ga0207687_100258863 | 162 |
| 220 | 3300025927 | Ga0207687_10162892 | Ga0207687_101628923 | 162 |
| 221 | 3300025929 | Ga0207664_10087680 | Ga0207664_100876804 | 162 |
| 222 | 3300025932 | Ga0207690_10770091 | Ga0207690_107700911 | 162 |
| 223 | 3300025936 | Ga0207670_10378278 | Ga0207670_103782782 | 162 |
| 224 | 3300025937 | Ga0207669_10858818 | Ga0207669_108588181 | 162 |
| 225 | 3300025938 | Ga0207704_11249196 | Ga0207704_112491961 | 162 |
| 226 | 3300025939 | Ga0207665_10001124 | Ga0207665_1000112410 | 162 |
| 227 | 3300025941 | Ga0207711_10379477 | Ga0207711_103794771 | 162 |
| 228 | 3300025945 | Ga0207679_10072159 | Ga0207679_100721591 | 162 |
| 229 | 3300025949 | Ga0207667_10289569 | Ga0207667_102895692 | 162 |
| 230 | 3300025981 | Ga0207640_10162326 | Ga0207640_101623263 | 162 |
| 231 | 3300026023 | Ga0207677_10780493 | Ga0207677_107804931 | 162 |
| 232 | 3300026023 | Ga0207677_10825974 | Ga0207677_108259742 | 162 |
| 233 | 3300026035 | Ga0207703_10306842 | Ga0207703_103068422 | 162 |
| 234 | 3300026067 | Ga0207678_10006539 | Ga0207678_100065395 | 162 |
| 235 | 3300026067 | Ga0207678_10246760 | Ga0207678_102467602 | 162 |
| 236 | 3300026078 | Ga0207702_10033076 | Ga0207702_100330764 | 162 |
| 237 | 3300026088 | Ga0207641_10339055 | Ga0207641_103390552 | 162 |
| 238 | 3300026116 | Ga0207674_10107726 | Ga0207674_101077263 | 162 |
| 239 | 3300026118 | Ga0207675_100014455 | Ga0207675_1000144553 | 162 |
| 240 | 3300026121 | Ga0207683_10020963 | Ga0207683_100209635 | 162 |
| 241 | 3300026142 | Ga0207698_10300668 | Ga0207698_103006682 | 162 |
| 242 | 3300027907 | Ga0207428_10096737 | Ga0207428_100967374 | 162 |
| 243 | 3300028379 | Ga0268266_10107016 | Ga0268266_101070162 | 162 |
| 244 | 3300028380 | Ga0268265_10086550 | Ga0268265_100865503 | 162 |
| 245 | 3300028381 | Ga0268264_10096157 | Ga0268264_100961573 | 162 |
| 246 | 3300028794 | Ga0307515_10003919 | Ga0307515_1000391913 | 162 |
| 247 | 3300030521 | Ga0307511_10000374 | Ga0307511_100003742 | 162 |
| 248 | 3300031616 | Ga0307508_10165170 | Ga0307508_101651703 | 162 |
| 249 | 3300034816 | Ga0373930_0125061 | Ga0373930_0125061_40_597 | 162 |
| 250 | 3300035088 | Ga0373940_0159229 | Ga0373940_0159229_74_631 | 162 |
| 251 | 3300035115 | Ga0373941_0097367 | Ga0373941_0097367_426_983 | 162 |
| 252 | 3300035121 | Ga0373960_0128962 | Ga0373960_0128962_181_738 | 162 |
| 253 | 3300035242 | Ga0373962_0034988 | Ga0373962_0034988_805_1362 | 162 |
| 254 | 3300035691 | Ga0373931_0107327 | Ga0373931_0107327_993_1550 | 162 |
| 255 | 3300035691 | Ga0373931_0148918 | Ga0373931_0148918_25_582 | 162 |
| 256 | 3300035695 | Ga0373927_0221493 | Ga0373927_0221493_271_792 | 162 |
| 257 | 3300037312 | Ga0395899_0665997 | Ga0395899_0665997_48_542 | 162 |
| 258 | 3300037418 | Ga0395900_0007503 | Ga0395900_0007503_10071_10571 | 162 |
| 259 | 3300037418 | Ga0395900_0037646 | Ga0395900_0037646_4005_4499 | 162 |
| 260 | 3300037466 | Ga0395898_0001314 | Ga0395898_0001314_10569_11069 | 162 |
| 261 | 3300037466 | Ga0395898_0360751 | Ga0395898_0360751_398_892 | 162 |
| 262 | 3300037853 | Ga0436364_1040466 | Ga0436364_1040466_20658_21188 | 162 |
| 263 | 3300039437 | Ga0436365_0764540 | Ga0436365_0764540_240_776 | 162 |
| 264 | 3300041509 | Ga0451843_1220755 | Ga0451843_1220755_55_579 | 162 |
| 265 | 3300044656 | Ga0466969_0019738 | Ga0466969_0019738_1105_1650 | 162 |
| 266 | 3300044684 | Ga0466966_0134935 | Ga0466966_0134935_220_765 | 162 |
| 267 | 3300044765 | Ga0466970_0138600 | Ga0466970_0138600_530_1075 | 162 |
| 268 | 3300044901 | Ga0466960_0106122 | Ga0466960_0106122_157_645 | 162 |
| 269 | 3300044901 | Ga0466960_0301091 | Ga0466960_0301091_160_648 | 162 |
| 270 | 3300045049 | Ga0466959_0026105 | Ga0466959_0026105_535_1080 | 162 |
| 271 | 3300045976 | Ga0466967_0210163 | Ga0466967_0210163_546_1040 | 162 |
| 272 | 3300045976 | Ga0466967_0553229 | Ga0466967_0553229_169_657 | 162 |
| 273 | 3300045976 | Ga0466967_0642507 | Ga0466967_0642507_451_1008 | 162 |
| 274 | 3300045976 | Ga0466967_0966700 | Ga0466967_0966700_233_721 | 162 |
| 275 | 3300046516 | Ga0495628_0158644 | Ga0495628_0158644_666_1214 | 162 |
| 276 | 3300048903 | Ga0496100_0407920 | Ga0496100_0407920_333_890 | 162 |
| 277 | 3300048904 | Ga0496101_0446844 | Ga0496101_0446844_366_923 | 162 |
| 278 | 3300048905 | Ga0496102_0137018 | Ga0496102_0137018_1452_2009 | 162 |
| 279 | 3300048907 | Ga0496104_0100756 | Ga0496104_0100756_830_1387 | 162 |
| 280 | 3300048907 | Ga0496104_0911855 | Ga0496104_0911855_86_574 | 162 |
| 281 | 3300048908 | Ga0496105_0009854 | Ga0496105_0009854_2027_2584 | 162 |
| 282 | 3300048909 | Ga0496106_0041642 | Ga0496106_0041642_852_1409 | 162 |
| 283 | 3300048911 | Ga0496108_0068702 | Ga0496108_0068702_448_1005 | 162 |
| 284 | 3300048912 | Ga0496109_0254256 | Ga0496109_0254256_567_1088 | 162 |
| 285 | 3300048913 | Ga0496110_0054038 | Ga0496110_0054038_882_1439 | 162 |
| 286 | 3300048913 | Ga0496110_0236955 | Ga0496110_0236955_1003_1560 | 162 |
| 287 | 3300048915 | Ga0496112_0132671 | Ga0496112_0132671_1006_1494 | 162 |
| 288 | 3300048915 | Ga0496112_0241704 | Ga0496112_0241704_563_1120 | 162 |
| 289 | 3300048916 | Ga0496113_0055563 | Ga0496113_0055563_1879_2436 | 162 |
| 290 | 3300048917 | Ga0496114_0014646 | Ga0496114_0014646_4339_4896 | 162 |
| 291 | 3300048918 | Ga0496115_0017454 | Ga0496115_0017454_613_1170 | 162 |
| 292 | 3300048921 | Ga0496118_0336284 | Ga0496118_0336284_282_785 | 162 |
| 293 | 3300049568 | Ga0501031_0476306 | Ga0501031_0476306_168_662 | 162 |
| 294 | 3300049571 | Ga0501034_0437043 | Ga0501034_0437043_123_617 | 162 |
| 295 | 3300049823 | Ga0501044_0228108 | Ga0501044_0228108_1247_1741 | 162 |
| 296 | 3300050508 | nmdc:mga09592_479792_c1 | nmdc:mga09592_479792_c1_544_1050 | 162 |
| 297 | 3300050510 | nmdc:mga06r32_605151_c1 | nmdc:mga06r32_605151_c1_332_838 | 162 |
| 298 | 3300050511 | nmdc:mga08y16_220320_c1 | nmdc:mga08y16_220320_c1_1250_1807 | 162 |
| 299 | 3300050512 | nmdc:mga0n895_9365_c1 | nmdc:mga0n895_9365_c1_1646_2203 | 162 |
| 300 | 3300050513 | nmdc:mga0rr50_168106_c1 | nmdc:mga0rr50_168106_c1_1108_1665 | 162 |
| 301 | 3300050514 | nmdc:mga08x19_69435_c1 | nmdc:mga08x19_69435_c1_931_1488 | 162 |
| 302 | 3300053077 | Ga0495601_0039189 | Ga0495601_0039189_938_1477 | 162 |
| 303 | 3300053178 | Ga0500637_0016168 | Ga0500637_0016168_1098_1601 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g0l-assembly1.cif.gz_A | semi-synthetic coa-alpha-synuclein constructs trap n-terminal acetyltransferase natb for binding mechanism studies | 0.874 | 57 | 161 |
| 7ypu-assembly4.cif.gz_G | orfe-coa-glycylthricin complex | 0.8688 | 55 | 159 |
| 7ypu-assembly4.cif.gz_H | orfe-coa-glycylthricin complex | 0.864 | 53 | 159 |
| 7ypu-assembly2.cif.gz_D | orfe-coa-glycylthricin complex | 0.8573 | 52 | 159 |
| 5c82-assembly1.cif.gz_A-2 | crystal structure of nourseothricin acetyltransferase | 0.8547 | 51 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54BP5_22_162_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9943 | 20 | 158 | 3.40.630.30 |
| af_Q54BP5_22_162_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9734 | 20 | 158 | 3.40.630.30 |
| af_Q2FWL1_1_136_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9108 | 57 | 162 | 3.40.630.30 |
| af_A0A1D6QIS1_205_278_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9018 | 98 | 159 | 3.40.630.30 |
| af_I1KF23_15_150_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.893 | 39 | 158 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9G4M0-F1-model_v4 | MarR family transcriptional regulator | 0.9926 | 2 | 159 |
GO:0003700
GO:0008080 |
| AF-A0A4R7SGW9-F1-model_v4 | deleted | 0.9836 | 2 | 162 |
|
| AF-A0A1H6BK29-F1-model_v4 | Transcriptional regulator, MarR family with acetyltransferase activity | 0.9809 | 2 | 159 |
GO:0003700
GO:0008080 |
| AF-K8PSA1-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9746 | 81 | 159 |
GO:0008080
|
| AF-A0A4R7SGW9-F1-model_v4 | deleted | 0.9716 | 2 | 162 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar