F397050

General Info

Members Datasets Scaffolds Average Seq Length
303 215 302 172

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10400823|Ga0207647_104008231
Length 192
Sequence MRSIPRTVIRPLGQPGDLGWVVMAHGEIYASEFGWDADFEALVARIVADYAEGHDPRRERAWIAEVDGRRAGCVFCIAADQDGTAQLRILLVDPTARGHSLGKRLVEECVRFARSAGYRRMVLWTNDPLVAAGRVYRAVGFRLTAEEPHHSFGVDLVGQTYELDLTINQSRTTEGLRTGKSPADVTGPSPSR

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 7.59
Rhizosphere 83.83
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11189904 3300005327 Bacteria 663
2 Ga0070683_100014311 3300005329 Bacteria 6937
3 Ga0070683_100417052 3300005329 Bacteria 1280
4 Ga0068869_100701291 3300005334 Bacteria 863
5 Ga0070666_11177998 3300005335 Bacteria 570
6 Ga0070680_100216118 3300005336 Bacteria 1618
7 Ga0070682_100059556 3300005337 Bacteria 2412
8 Ga0068868_100001664 3300005338 Bacteria 15178
9 Ga0070689_100063651 3300005340 Bacteria 2870
10 Ga0070689_100382050 3300005340 Unclassified 1187
11 Ga0070687_100043055 3300005343 Unclassified 2292
12 Ga0070692_10052543 3300005345 Unclassified 2123
13 Ga0070671_100020542 3300005355 Bacteria 5386
14 Ga0070673_100401420 3300005364 Unclassified 1226
15 Ga0070659_100043664 3300005366 Bacteria 3506
16 Ga0070667_100180059 3300005367 Bacteria 1869
17 Ga0070667_100255477 3300005367 Bacteria 1568
18 Ga0070709_10060903 3300005434 Bacteria 2401
19 Ga0070714_100379935 3300005435 Bacteria 1332
20 Ga0070713_100203493 3300005436 Bacteria 1789
21 Ga0070713_100585589 3300005436 Bacteria 1059
22 Ga0070710_10016512 3300005437 Bacteria 3759
23 Ga0070701_10254920 3300005438 Bacteria 1061
24 Ga0070711_100723851 3300005439 Bacteria 839
25 Ga0070705_100045707 3300005440 Bacteria 2520
26 Ga0070694_100059326 3300005444 Unclassified 2606
27 Ga0070708_100136531 3300005445 Bacteria 2272
28 Ga0070663_100061176 3300005455 Bacteria 2711
29 Ga0070678_100058883 3300005456 Bacteria 2821
30 Ga0070706_101462057 3300005467 Bacteria 625
31 Ga0070679_100158632 3300005530 Bacteria 2237
32 Ga0068853_100015934 3300005539 Bacteria 6178
33 Ga0070672_100144506 3300005543 Bacteria 1965
34 Ga0070686_100292178 3300005544 Bacteria 1206
35 Ga0070695_100331949 3300005545 Bacteria 1134
36 Ga0070696_100255480 3300005546 Bacteria 1327
37 Ga0070665_100002791 3300005548 Bacteria 18933
38 Ga0070665_100149044 3300005548 Bacteria 2342
39 Ga0068855_100017723 3300005563 Bacteria 8562
40 Ga0068855_100023384 3300005563 Bacteria 7401
41 Ga0068857_100160473 3300005577 Bacteria 2040
42 Ga0068857_100348079 3300005577 Bacteria 1372
43 Ga0068856_100125258 3300005614 Bacteria 2572
44 Ga0068856_100803195 3300005614 Bacteria 960
45 Ga0070702_100019177 3300005615 Bacteria 3561
46 Ga0068852_100091060 3300005616 Bacteria 2729
47 Ga0068852_100577350 3300005616 Bacteria 1127
48 Ga0068852_100639928 3300005616 Bacteria 1070
49 Ga0068859_100659950 3300005617 Bacteria 1138
50 Ga0068864_100073888 3300005618 Bacteria 2973
51 Ga0068864_100942947 3300005618 Bacteria 854
52 Ga0068866_10389507 3300005718 Bacteria 896
53 Ga0068861_100040196 3300005719 Bacteria 3496
54 Ga0068851_10377541 3300005834 Bacteria 830
55 Ga0068863_100116664 3300005841 Bacteria 2544
56 Ga0068863_100529036 3300005841 Bacteria 1163
57 Ga0068860_100005671 3300005843 Bacteria 12608
58 Ga0068860_100254221 3300005843 Bacteria 1712
59 Ga0081540_1000420 3300005983 Bacteria 41918
60 Ga0070717_10126018 3300006028 Bacteria 2199
61 Ga0075365_10267729 3300006038 Bacteria 1202
62 Ga0075365_10293200 3300006038 Bacteria 1145
63 Ga0075432_10018971 3300006058 Unclassified 2348
64 Ga0070716_100004198 3300006173 Bacteria 6854
65 Ga0070712_100065325 3300006175 Bacteria 2582
66 Ga0097621_100294470 3300006237 Bacteria 1432
67 Ga0075428_100031042 3300006844 Bacteria 5908
68 Ga0075428_101503180 3300006844 Bacteria 705
69 Ga0075430_100003599 3300006846 Bacteria 12989
70 Ga0075430_100075146 3300006846 Bacteria 2833
71 Ga0075431_100032228 3300006847 Bacteria 5400
72 Ga0075431_100360508 3300006847 Bacteria 1460
73 Ga0075433_10189880 3300006852 Unclassified 1828
74 Ga0075434_100007731 3300006871 Bacteria 9954
75 Ga0075429_100190782 3300006880 Bacteria 1795
76 Ga0075429_100246950 3300006880 Bacteria 1563
77 Ga0068865_100854344 3300006881 Bacteria 789
78 Ga0097620_100660007 3300006931 Bacteria 1138
79 Ga0075435_100004961 3300007076 Bacteria 9230
80 Ga0105251_10125516 3300009011 Bacteria 1165
81 Ga0105240_10185387 3300009093 Bacteria 2451
82 Ga0111539_10073290 3300009094 Bacteria 4037
83 Ga0111539_10288630 3300009094 Bacteria 1909
84 Ga0105247_10118098 3300009101 Bacteria 1715
85 Ga0114129_10300493 3300009147 Bacteria 2139
86 Ga0105243_11151567 3300009148 Bacteria 786
87 Ga0105241_10113786 3300009174 Bacteria 2169
88 Ga0105241_10759005 3300009174 Bacteria 890
89 Ga0105242_10084176 3300009176 Unclassified 2665
90 Ga0105237_10167406 3300009545 Bacteria 2197
91 Ga0105238_10531611 3300009551 Bacteria 1179
92 Ga0105249_10000772 3300009553 Bacteria 28654
93 Ga0105239_10044809 3300010375 Bacteria 4848
94 Ga0105239_11107167 3300010375 Bacteria 912
95 Ga0105246_10023334 3300011119 Bacteria 4002
96 Ga0157373_10342596 3300013100 Bacteria 1065
97 Ga0157371_10170883 3300013102 Bacteria 1553
98 Ga0157370_10021378 3300013104 Bacteria 6448
99 Ga0157369_10092511 3300013105 Bacteria 3227
100 Ga0157369_10279354 3300013105 Bacteria 1739
101 Ga0157369_10694126 3300013105 Bacteria 1048
102 Ga0157374_10091613 3300013296 Bacteria 2899
103 Ga0157374_10936319 3300013296 Bacteria 884
104 Ga0157378_10081302 3300013297 Bacteria 2928
105 Ga0163162_10024569 3300013306 Bacteria 5950
106 Ga0157372_10063663 3300013307 Bacteria 4136
107 Ga0157372_10545025 3300013307 Bacteria 1352
108 Ga0157372_10557652 3300013307 Bacteria 1335
109 Ga0157372_13252626 3300013307 Unclassified 518
110 Ga0157375_10158992 3300013308 Bacteria 2400
111 Ga0157375_10621880 3300013308 Bacteria 1238
112 Ga0157375_11392128 3300013308 Bacteria 826
113 Ga0163163_10094473 3300014325 Bacteria 3008
114 Ga0163163_10353331 3300014325 Bacteria 1526
115 Ga0157380_10016588 3300014326 Bacteria 5436
116 Ga0157380_10205240 3300014326 Bacteria 1752
117 Ga0157377_10102548 3300014745 Bacteria 1707
118 Ga0157377_10486678 3300014745 Bacteria 859
119 Ga0157379_10024209 3300014968 Bacteria 5389
120 Ga0206353_11534490 3300020082 Bacteria 1839
121 Ga0213876_10079310 3300021384 Bacteria 1735
122 Ga0213875_10000433 3300021388 Bacteria 36593
123 Ga0207692_10341993 3300025898 Bacteria 920
124 Ga0207642_10149583 3300025899 Bacteria 1241
125 Ga0207688_10002469 3300025901 Bacteria 9948
126 Ga0207688_10006435 3300025901 Bacteria 6398
127 Ga0207647_10095917 3300025904 Bacteria 1766
128 Ga0207647_10400823 3300025904 Bacteria 773
129 Ga0207685_10208078 3300025905 Bacteria 923
130 Ga0207699_10194993 3300025906 Bacteria 1369
131 Ga0207705_10231238 3300025909 Bacteria 1406
132 Ga0207654_10119638 3300025911 Bacteria 1652
133 Ga0207695_10437761 3300025913 Bacteria 1191
134 Ga0207671_10493887 3300025914 Bacteria 976
135 Ga0207693_10002190 3300025915 Bacteria 17036
136 Ga0207663_10149396 3300025916 Bacteria 1637
137 Ga0207660_10083033 3300025917 Bacteria 2358
138 Ga0207657_10011850 3300025919 Bacteria 8631
139 Ga0207657_10351365 3300025919 Bacteria 1163
140 Ga0207681_10490476 3300025923 Bacteria 1005
141 Ga0207694_10183575 3300025924 Bacteria 1697
142 Ga0207694_10256866 3300025924 Bacteria 1431
143 Ga0207694_10467100 3300025924 Bacteria 1054
144 Ga0207687_10025886 3300025927 Bacteria 3927
145 Ga0207687_10162892 3300025927 Bacteria 1713
146 Ga0207687_10293152 3300025927 Unclassified 1308
147 Ga0207700_10209236 3300025928 Bacteria 1648
148 Ga0207664_10087680 3300025929 Bacteria 2544
149 Ga0207644_10028958 3300025931 Bacteria 3839
150 Ga0207690_10103109 3300025932 Bacteria 2041
151 Ga0207690_10770091 3300025932 Bacteria 794
152 Ga0207670_10378278 3300025936 Unclassified 1127
153 Ga0207669_10858818 3300025937 Bacteria 756
154 Ga0207704_11249196 3300025938 Bacteria 634
155 Ga0207665_10001124 3300025939 Bacteria 17986
156 Ga0207711_10379477 3300025941 Bacteria 1311
157 Ga0207661_10285893 3300025944 Bacteria 1475
158 Ga0207679_10072159 3300025945 Bacteria 2607
159 Ga0207667_10026351 3300025949 Bacteria 6354
160 Ga0207667_10033499 3300025949 Bacteria 5522
161 Ga0207667_10289569 3300025949 Bacteria 1673
162 Ga0207651_10240656 3300025960 Bacteria 1475
163 Ga0207640_10162326 3300025981 Bacteria 1655
164 Ga0207677_10780493 3300026023 Bacteria 854
165 Ga0207677_10825974 3300026023 Bacteria 831
166 Ga0207703_10306842 3300026035 Bacteria 1449
167 Ga0207678_10006539 3300026067 Bacteria 10334
168 Ga0207678_10246760 3300026067 Bacteria 1529
169 Ga0207702_10033076 3300026078 Bacteria 4317
170 Ga0207702_10260625 3300026078 Bacteria 1632
171 Ga0207641_10077305 3300026088 Bacteria 2880
172 Ga0207641_10339055 3300026088 Bacteria 1430
173 Ga0207648_10095384 3300026089 Bacteria 2602
174 Ga0207674_10011866 3300026116 Bacteria 9767
175 Ga0207674_10107726 3300026116 Bacteria 2763
176 Ga0207674_10789724 3300026116 Bacteria 916
177 Ga0207675_100014455 3300026118 Bacteria 7360
178 Ga0207683_10020963 3300026121 Bacteria 5594
179 Ga0207698_10300668 3300026142 Bacteria 1494
180 Ga0207698_11842965 3300026142 Bacteria 620
181 Ga0207428_10096737 3300027907 Unclassified 2286
182 Ga0268266_10013713 3300028379 Bacteria 6979
183 Ga0268266_10031659 3300028379 Bacteria 4493
184 Ga0268266_10107016 3300028379 Bacteria 2473
185 Ga0268265_10086550 3300028380 Bacteria 2491
186 Ga0268264_10009753 3300028381 Bacteria 7950
187 Ga0268264_10096157 3300028381 Bacteria 2564
188 Ga0307515_10000095 3300028794 Bacteria 208513
189 Ga0307515_10003919 3300028794 Bacteria 31059
190 Ga0307511_10000374 3300030521 Bacteria 47666
191 Ga0307513_10565193 3300031456 Bacteria 849
192 Ga0307509_10039901 3300031507 Bacteria 5110
193 Ga0307508_10165170 3300031616 Bacteria 1817
194 Ga0326468_10018863 3300031889 Bacteria 802
195 Ga0307406_10691551 3300031901 Bacteria 851
196 Ga0307409_100323965 3300031995 Bacteria 1443
197 Ga0307409_100979460 3300031995 Bacteria 863
198 Ga0307416_100102560 3300032002 Bacteria 2495
199 Ga0307416_101456111 3300032002 Bacteria 791
200 Ga0307411_11160014 3300032005 Bacteria 699
201 Ga0307510_10033534 3300033180 Bacteria 5765
202 Ga0373930_0125061 3300034816 Bacteria 629
203 Ga0373958_0056336 3300034819 Bacteria 841
204 Ga0373938_0141240 3300034957 Bacteria 635
205 Ga0373940_0002423 3300035088 Bacteria 3626
206 Ga0373940_0159229 3300035088 Unclassified 724
207 Ga0373941_0097367 3300035115 Bacteria 1019
208 Ga0373960_0128962 3300035121 Bacteria 846
209 Ga0373942_0003984 3300035207 Bacteria 3446
210 Ga0373962_0034988 3300035242 Bacteria 1393
211 Ga0373931_0107327 3300035691 Bacteria 1579
212 Ga0373931_0148918 3300035691 Bacteria 1362
213 Ga0373927_0221493 3300035695 Unclassified 1243
214 Ga0395899_0665997 3300037312 Bacteria 656
215 Ga0395900_0007503 3300037418 Bacteria 11268
216 Ga0395900_0037646 3300037418 Bacteria 4987
217 Ga0395898_0001314 3300037466 Bacteria 36175
218 Ga0395898_0360751 3300037466 Bacteria 1386
219 Ga0436364_0022880 3300037853 Bacteria 3371
220 Ga0436364_1040466 3300037853 Bacteria 95595
221 Ga0436365_0764540 3300039437 Bacteria 1864
222 Ga0451802_0159044 3300041460 Bacteria 659
223 Ga0451843_1220755 3300041509 Bacteria 691
224 Ga0466969_0019738 3300044656 Bacteria 3498
225 Ga0466969_0200727 3300044656 Bacteria 910
226 Ga0466972_0068714 3300044658 Bacteria 1692
227 Ga0466966_0134935 3300044684 Bacteria 1509
228 Ga0466966_0329835 3300044684 Bacteria 917
229 Ga0466961_0043526 3300044693 Bacteria 2875
230 Ga0466963_0275258 3300044694 Bacteria 1183
231 Ga0466971_0093332 3300044719 Bacteria 1379
232 Ga0466971_0251198 3300044719 Bacteria 843
233 Ga0466970_0138600 3300044765 Bacteria 1339
234 Ga0466960_0106122 3300044901 Bacteria 1453
235 Ga0466960_0301091 3300044901 Bacteria 903
236 Ga0466960_0329749 3300044901 Bacteria 866
237 Ga0466959_0026105 3300045049 Bacteria 4332
238 Ga0466959_0470275 3300045049 Bacteria 851
239 Ga0466958_0167521 3300045836 Bacteria 1390
240 Ga0466958_0908724 3300045836 Bacteria 574
241 Ga0466967_0041622 3300045976 Bacteria 3963
242 Ga0466967_0210163 3300045976 Bacteria 1845
243 Ga0466967_0280127 3300045976 Bacteria 1600
244 Ga0466967_0553229 3300045976 Bacteria 1133
245 Ga0466967_0642507 3300045976 Bacteria 1049
246 Ga0466967_0897020 3300045976 Bacteria 881
247 Ga0466967_0966700 3300045976 Bacteria 848
248 Ga0495628_0158644 3300046516 Unclassified 1720
249 Ga0496100_0407920 3300048903 Bacteria 1036
250 Ga0496101_0446844 3300048904 Bacteria 1020
251 Ga0496102_0137018 3300048905 Unclassified 2294
252 Ga0496102_0223647 3300048905 Bacteria 1775
253 Ga0496102_0898184 3300048905 Bacteria 808
254 Ga0496103_0060409 3300048906 Bacteria 2356
255 Ga0496104_0100756 3300048907 Bacteria 2765
256 Ga0496104_0232587 3300048907 Bacteria 1755
257 Ga0496104_0911855 3300048907 Bacteria 784
258 Ga0496105_0009854 3300048908 Bacteria 7489
259 Ga0496105_0275928 3300048908 Bacteria 1357
260 Ga0496106_0041642 3300048909 Bacteria 3442
261 Ga0496108_0068702 3300048911 Bacteria 2989
262 Ga0496109_0254256 3300048912 Bacteria 1655
263 Ga0496110_0054038 3300048913 Bacteria 3532
264 Ga0496110_0236955 3300048913 Bacteria 1660
265 Ga0496112_0132671 3300048915 Bacteria 2462
266 Ga0496112_0241704 3300048915 Bacteria 1758
267 Ga0496113_0055563 3300048916 Bacteria 2968
268 Ga0496114_0014646 3300048917 Bacteria 6301
269 Ga0496114_0018068 3300048917 Bacteria 5698
270 Ga0496115_0017454 3300048918 Bacteria 5489
271 Ga0496118_0052276 3300048921 Bacteria 3118
272 Ga0496118_0336284 3300048921 Unclassified 812
273 Ga0496119_0000470 3300048922 Bacteria 54985
274 Ga0496120_0002981 3300048923 Bacteria 16112
275 Ga0496125_0016817 3300048928 Bacteria 7012
276 Ga0496126_0270650 3300048929 Bacteria 1410
277 Ga0496126_0507620 3300048929 Bacteria 963
278 Ga0501031_0476306 3300049568 Bacteria 806
279 Ga0501033_0002196 3300049570 Bacteria 16842
280 Ga0501034_0437043 3300049571 Bacteria 1228
281 Ga0501042_0096553 3300049578 Bacteria 2123
282 Ga0501047_0474254 3300049581 Bacteria 1079
283 Ga0501069_0274306 3300049585 Bacteria 986
284 Ga0501044_0005985 3300049823 Bacteria 13450
285 Ga0501044_0228108 3300049823 Bacteria 1811
286 nmdc:mga0yw44_458165_c1 3300050492 Bacteria 864
287 nmdc:mga0yw44_956694_c1 3300050492 Bacteria 580
288 nmdc:mga05p37_84171_c1 3300050507 Bacteria 3919
289 nmdc:mga09592_479792_c1 3300050508 Bacteria 1071
290 nmdc:mga09592_824438_c1 3300050508 Bacteria 784
291 nmdc:mga0qj67_31518_c1 3300050509 Bacteria 4130
292 nmdc:mga06r32_166762_c1 3300050510 Bacteria 2186
293 nmdc:mga06r32_605151_c1 3300050510 Bacteria 1067
294 nmdc:mga08y16_220320_c1 3300050511 Bacteria 1964
295 nmdc:mga08y16_95751_c1 3300050511 Bacteria 3092
296 nmdc:mga0n895_9365_c1 3300050512 Bacteria 8564
297 nmdc:mga0rr50_168106_c1 3300050513 Bacteria 1785
298 nmdc:mga08x19_69435_c1 3300050514 Bacteria 2295
299 Ga0495601_0039189 3300053077 Unclassified 2967
300 Ga0500616_0010602 3300053153 Bacteria 5504
301 Ga0500637_0016168 3300053178 Unclassified 3972
302 Ga0466962_0547560 3300061719 Bacteria 588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10936319 Ga0157374_109363192 141
2 3300014745 Ga0157377_10102548 Ga0157377_101025482 141
3 3300009147 Ga0114129_10300493 Ga0114129_103004933 143
4 3300045836 Ga0466958_0908724 Ga0466958_0908724_14_451 143
5 3300050507 nmdc:mga05p37_84171_c1 nmdc:mga05p37_84171_c1_423_854 143
6 3300050508 nmdc:mga09592_824438_c1 nmdc:mga09592_824438_c1_182_613 143
7 3300050509 nmdc:mga0qj67_31518_c1 nmdc:mga0qj67_31518_c1_296_727 143
8 3300050510 nmdc:mga06r32_166762_c1 nmdc:mga06r32_166762_c1_1220_1651 143
9 3300009093 Ga0105240_10185387 Ga0105240_101853872 144
10 3300009174 Ga0105241_10759005 Ga0105241_107590051 144
11 3300013307 Ga0157372_13252626 Ga0157372_132526261 144
12 3300014325 Ga0163163_10094473 Ga0163163_100944732 144
13 3300048908 Ga0496105_0275928 Ga0496105_0275928_694_1206 144
14 3300048917 Ga0496114_0018068 Ga0496114_0018068_3992_4504 144
15 3300048929 Ga0496126_0270650 Ga0496126_0270650_715_1227 144
16 3300049578 Ga0501042_0096553 Ga0501042_0096553_75_542 144
17 3300050492 nmdc:mga0yw44_956694_c1 nmdc:mga0yw44_956694_c1_48_527 144
18 3300045976 Ga0466967_0280127 Ga0466967_0280127_282_743 153
19 3300031456 Ga0307513_10565193 Ga0307513_105651932 155
20 3300031507 Ga0307509_10039901 Ga0307509_100399014 156
21 3300005366 Ga0070659_100043664 Ga0070659_1000436644 157
22 3300005543 Ga0070672_100144506 Ga0070672_1001445062 157
23 3300005843 Ga0068860_100254221 Ga0068860_1002542213 157
24 3300006844 Ga0075428_101503180 Ga0075428_1015031802 157
25 3300009094 Ga0111539_10073290 Ga0111539_100732904 157
26 3300013105 Ga0157369_10694126 Ga0157369_106941262 157
27 3300014326 Ga0157380_10205240 Ga0157380_102052403 157
28 3300025901 Ga0207688_10006435 Ga0207688_100064356 157
29 3300025924 Ga0207694_10256866 Ga0207694_102568662 157
30 3300025927 Ga0207687_10293152 Ga0207687_102931522 157
31 3300025932 Ga0207690_10103109 Ga0207690_101031092 157
32 3300025960 Ga0207651_10240656 Ga0207651_102406563 157
33 3300026089 Ga0207648_10095384 Ga0207648_100953843 157
34 3300048905 Ga0496102_0898184 Ga0496102_0898184_38_511 157
35 3300050511 nmdc:mga08y16_95751_c1 nmdc:mga08y16_95751_c1_667_1140 157
36 3300005329 Ga0070683_100014311 Ga0070683_1000143113 158
37 3300006038 Ga0075365_10267729 Ga0075365_102677292 158
38 3300025944 Ga0207661_10285893 Ga0207661_102858932 158
39 3300049570 Ga0501033_0002196 Ga0501033_0002196_7796_8275 158
40 3300049581 Ga0501047_0474254 Ga0501047_0474254_366_845 158
41 3300049585 Ga0501069_0274306 Ga0501069_0274306_335_814 158
42 3300049823 Ga0501044_0005985 Ga0501044_0005985_6111_6590 158
43 3300050492 nmdc:mga0yw44_458165_c1 nmdc:mga0yw44_458165_c1_367_846 158
44 iso_pu_bacteria 2622736626 2623591538 158
45 3300005340 Ga0070689_100063651 Ga0070689_1000636512 159
46 3300005436 Ga0070713_100203493 Ga0070713_1002034932 159
47 3300005618 Ga0068864_100942947 Ga0068864_1009429471 159
48 3300013308 Ga0157375_10621880 Ga0157375_106218802 159
49 3300014325 Ga0163163_10353331 Ga0163163_103533312 159
50 3300025928 Ga0207700_10209236 Ga0207700_102092363 159
51 3300044658 Ga0466972_0068714 Ga0466972_0068714_57_536 159
52 3300044901 Ga0466960_0329749 Ga0466960_0329749_246_725 159
53 3300045976 Ga0466967_0041622 Ga0466967_0041622_445_924 159
54 3300048907 Ga0496104_0232587 Ga0496104_0232587_127_660 159
55 3300048928 Ga0496125_0016817 Ga0496125_0016817_5209_5700 159
56 3300048929 Ga0496126_0507620 Ga0496126_0507620_262_753 159
57 3300005355 Ga0070671_100020542 Ga0070671_1000205423 160
58 3300005367 Ga0070667_100180059 Ga0070667_1001800592 160
59 3300005445 Ga0070708_100136531 Ga0070708_1001365312 160
60 3300005548 Ga0070665_100002791 Ga0070665_10000279113 160
61 3300005563 Ga0068855_100017723 Ga0068855_1000177232 160
62 3300005577 Ga0068857_100160473 Ga0068857_1001604732 160
63 3300005614 Ga0068856_100803195 Ga0068856_1008031952 160
64 3300005616 Ga0068852_100577350 Ga0068852_1005773501 160
65 3300005841 Ga0068863_100116664 Ga0068863_1001166643 160
66 3300005843 Ga0068860_100005671 Ga0068860_1000056713 160
67 3300006028 Ga0070717_10126018 Ga0070717_101260183 160
68 3300009174 Ga0105241_10113786 Ga0105241_101137864 160
69 3300009545 Ga0105237_10167406 Ga0105237_101674064 160
70 3300010375 Ga0105239_11107167 Ga0105239_111071671 160
71 3300025913 Ga0207695_10437761 Ga0207695_104377612 160
72 3300025924 Ga0207694_10183575 Ga0207694_101835753 160
73 3300025931 Ga0207644_10028958 Ga0207644_100289583 160
74 3300025949 Ga0207667_10026351 Ga0207667_100263513 160
75 3300025949 Ga0207667_10033499 Ga0207667_100334994 160
76 3300026078 Ga0207702_10260625 Ga0207702_102606253 160
77 3300026088 Ga0207641_10077305 Ga0207641_100773053 160
78 3300026116 Ga0207674_10011866 Ga0207674_100118668 160
79 3300026116 Ga0207674_10789724 Ga0207674_107897242 160
80 3300026142 Ga0207698_11842965 Ga0207698_118429651 160
81 3300028379 Ga0268266_10013713 Ga0268266_100137135 160
82 3300028379 Ga0268266_10031659 Ga0268266_100316595 160
83 3300028381 Ga0268264_10009753 Ga0268264_100097535 160
84 3300033180 Ga0307510_10033534 Ga0307510_100335345 160
85 3300034819 Ga0373958_0056336 Ga0373958_0056336_73_639 160
86 3300034957 Ga0373938_0141240 Ga0373938_0141240_15_581 160
87 3300035088 Ga0373940_0002423 Ga0373940_0002423_2176_2730 160
88 3300035207 Ga0373942_0003984 Ga0373942_0003984_2109_2663 160
89 3300037853 Ga0436364_0022880 Ga0436364_0022880_277_795 160
90 3300044656 Ga0466969_0200727 Ga0466969_0200727_258_740 160
91 3300044684 Ga0466966_0329835 Ga0466966_0329835_291_773 160
92 3300044693 Ga0466961_0043526 Ga0466961_0043526_230_712 160
93 3300044694 Ga0466963_0275258 Ga0466963_0275258_568_1050 160
94 3300044719 Ga0466971_0093332 Ga0466971_0093332_627_1109 160
95 3300044719 Ga0466971_0251198 Ga0466971_0251198_197_679 160
96 3300045049 Ga0466959_0470275 Ga0466959_0470275_100_582 160
97 3300045836 Ga0466958_0167521 Ga0466958_0167521_660_1142 160
98 3300045976 Ga0466967_0897020 Ga0466967_0897020_246_728 160
99 3300061719 Ga0466962_0547560 Ga0466962_0547560_64_546 160
100 3300006844 Ga0075428_100031042 Ga0075428_1000310423 161
101 3300006846 Ga0075430_100003599 Ga0075430_1000035995 161
102 3300006847 Ga0075431_100032228 Ga0075431_1000322284 161
103 3300006880 Ga0075429_100190782 Ga0075429_1001907823 161
104 3300028794 Ga0307515_10000095 Ga0307515_10000095123 161
105 3300031889 Ga0326468_10018863 Ga0326468_100188632 161
106 3300031901 Ga0307406_10691551 Ga0307406_106915511 161
107 3300031995 Ga0307409_100323965 Ga0307409_1003239652 161
108 3300031995 Ga0307409_100979460 Ga0307409_1009794601 161
109 3300032002 Ga0307416_100102560 Ga0307416_1001025605 161
110 3300032002 Ga0307416_101456111 Ga0307416_1014561112 161
111 3300032005 Ga0307411_11160014 Ga0307411_111600142 161
112 3300041460 Ga0451802_0159044 Ga0451802_0159044_37_522 161
113 3300048905 Ga0496102_0223647 Ga0496102_0223647_601_1110 161
114 3300048906 Ga0496103_0060409 Ga0496103_0060409_782_1291 161
115 3300048921 Ga0496118_0052276 Ga0496118_0052276_2414_2923 161
116 3300048922 Ga0496119_0000470 Ga0496119_0000470_23888_24397 161
117 3300048923 Ga0496120_0002981 Ga0496120_0002981_7664_8173 161
118 3300053153 Ga0500616_0010602 Ga0500616_0010602_2374_2895 161
119 3300005327 Ga0070658_11189904 Ga0070658_111899041 162
120 3300005329 Ga0070683_100417052 Ga0070683_1004170522 162
121 3300005334 Ga0068869_100701291 Ga0068869_1007012912 162
122 3300005335 Ga0070666_11177998 Ga0070666_111779981 162
123 3300005336 Ga0070680_100216118 Ga0070680_1002161182 162
124 3300005337 Ga0070682_100059556 Ga0070682_1000595562 162
125 3300005338 Ga0068868_100001664 Ga0068868_10000166410 162
126 3300005340 Ga0070689_100382050 Ga0070689_1003820501 162
127 3300005343 Ga0070687_100043055 Ga0070687_1000430553 162
128 3300005345 Ga0070692_10052543 Ga0070692_100525432 162
129 3300005364 Ga0070673_100401420 Ga0070673_1004014202 162
130 3300005367 Ga0070667_100255477 Ga0070667_1002554772 162
131 3300005434 Ga0070709_10060903 Ga0070709_100609032 162
132 3300005435 Ga0070714_100379935 Ga0070714_1003799352 162
133 3300005436 Ga0070713_100585589 Ga0070713_1005855891 162
134 3300005437 Ga0070710_10016512 Ga0070710_100165124 162
135 3300005438 Ga0070701_10254920 Ga0070701_102549202 162
136 3300005439 Ga0070711_100723851 Ga0070711_1007238511 162
137 3300005440 Ga0070705_100045707 Ga0070705_1000457072 162
138 3300005444 Ga0070694_100059326 Ga0070694_1000593264 162
139 3300005455 Ga0070663_100061176 Ga0070663_1000611761 162
140 3300005456 Ga0070678_100058883 Ga0070678_1000588833 162
141 3300005467 Ga0070706_101462057 Ga0070706_1014620571 162
142 3300005530 Ga0070679_100158632 Ga0070679_1001586323 162
143 3300005539 Ga0068853_100015934 Ga0068853_1000159345 162
144 3300005544 Ga0070686_100292178 Ga0070686_1002921782 162
145 3300005545 Ga0070695_100331949 Ga0070695_1003319492 162
146 3300005546 Ga0070696_100255480 Ga0070696_1002554802 162
147 3300005548 Ga0070665_100149044 Ga0070665_1001490442 162
148 3300005563 Ga0068855_100023384 Ga0068855_1000233846 162
149 3300005577 Ga0068857_100348079 Ga0068857_1003480792 162
150 3300005614 Ga0068856_100125258 Ga0068856_1001252582 162
151 3300005615 Ga0070702_100019177 Ga0070702_1000191773 162
152 3300005616 Ga0068852_100091060 Ga0068852_1000910603 162
153 3300005616 Ga0068852_100639928 Ga0068852_1006399282 162
154 3300005617 Ga0068859_100659950 Ga0068859_1006599502 162
155 3300005618 Ga0068864_100073888 Ga0068864_1000738882 162
156 3300005718 Ga0068866_10389507 Ga0068866_103895072 162
157 3300005719 Ga0068861_100040196 Ga0068861_1000401963 162
158 3300005834 Ga0068851_10377541 Ga0068851_103775411 162
159 3300005841 Ga0068863_100529036 Ga0068863_1005290362 162
160 3300005983 Ga0081540_1000420 Ga0081540_10004206 162
161 3300006038 Ga0075365_10293200 Ga0075365_102932002 162
162 3300006058 Ga0075432_10018971 Ga0075432_100189714 162
163 3300006173 Ga0070716_100004198 Ga0070716_1000041985 162
164 3300006175 Ga0070712_100065325 Ga0070712_1000653252 162
165 3300006237 Ga0097621_100294470 Ga0097621_1002944702 162
166 3300006846 Ga0075430_100075146 Ga0075430_1000751464 162
167 3300006847 Ga0075431_100360508 Ga0075431_1003605083 162
168 3300006852 Ga0075433_10189880 Ga0075433_101898802 162
169 3300006871 Ga0075434_100007731 Ga0075434_1000077313 162
170 3300006880 Ga0075429_100246950 Ga0075429_1002469502 162
171 3300006881 Ga0068865_100854344 Ga0068865_1008543442 162
172 3300006931 Ga0097620_100660007 Ga0097620_1006600072 162
173 3300007076 Ga0075435_100004961 Ga0075435_1000049617 162
174 3300009011 Ga0105251_10125516 Ga0105251_101255162 162
175 3300009094 Ga0111539_10288630 Ga0111539_102886302 162
176 3300009101 Ga0105247_10118098 Ga0105247_101180981 162
177 3300009148 Ga0105243_11151567 Ga0105243_111515672 162
178 3300009176 Ga0105242_10084176 Ga0105242_100841761 162
179 3300009551 Ga0105238_10531611 Ga0105238_105316112 162
180 3300009553 Ga0105249_10000772 Ga0105249_1000077214 162
181 3300010375 Ga0105239_10044809 Ga0105239_100448092 162
182 3300011119 Ga0105246_10023334 Ga0105246_100233342 162
183 3300013100 Ga0157373_10342596 Ga0157373_103425961 162
184 3300013102 Ga0157371_10170883 Ga0157371_101708831 162
185 3300013104 Ga0157370_10021378 Ga0157370_100213784 162
186 3300013105 Ga0157369_10092511 Ga0157369_100925112 162
187 3300013105 Ga0157369_10279354 Ga0157369_102793542 162
188 3300013296 Ga0157374_10091613 Ga0157374_100916133 162
189 3300013297 Ga0157378_10081302 Ga0157378_100813023 162
190 3300013306 Ga0163162_10024569 Ga0163162_100245697 162
191 3300013307 Ga0157372_10063663 Ga0157372_100636634 162
192 3300013307 Ga0157372_10545025 Ga0157372_105450251 162
193 3300013307 Ga0157372_10557652 Ga0157372_105576522 162
194 3300013308 Ga0157375_10158992 Ga0157375_101589922 162
195 3300013308 Ga0157375_11392128 Ga0157375_113921281 162
196 3300014326 Ga0157380_10016588 Ga0157380_100165887 162
197 3300014745 Ga0157377_10486678 Ga0157377_104866781 162
198 3300014968 Ga0157379_10024209 Ga0157379_100242093 162
199 3300020082 Ga0206353_11534490 Ga0206353_115344902 162
200 3300021384 Ga0213876_10079310 Ga0213876_100793103 162
201 3300021388 Ga0213875_10000433 Ga0213875_1000043316 162
202 3300025898 Ga0207692_10341993 Ga0207692_103419931 162
203 3300025899 Ga0207642_10149583 Ga0207642_101495831 162
204 3300025901 Ga0207688_10002469 Ga0207688_100024694 162
205 3300025904 Ga0207647_10095917 Ga0207647_100959172 162
206 3300025904 Ga0207647_10400823 Ga0207647_104008231 162
207 3300025905 Ga0207685_10208078 Ga0207685_102080782 162
208 3300025906 Ga0207699_10194993 Ga0207699_101949932 162
209 3300025909 Ga0207705_10231238 Ga0207705_102312381 162
210 3300025911 Ga0207654_10119638 Ga0207654_101196382 162
211 3300025914 Ga0207671_10493887 Ga0207671_104938872 162
212 3300025915 Ga0207693_10002190 Ga0207693_100021909 162
213 3300025916 Ga0207663_10149396 Ga0207663_101493962 162
214 3300025917 Ga0207660_10083033 Ga0207660_100830333 162
215 3300025919 Ga0207657_10011850 Ga0207657_100118503 162
216 3300025919 Ga0207657_10351365 Ga0207657_103513652 162
217 3300025923 Ga0207681_10490476 Ga0207681_104904761 162
218 3300025924 Ga0207694_10467100 Ga0207694_104671001 162
219 3300025927 Ga0207687_10025886 Ga0207687_100258863 162
220 3300025927 Ga0207687_10162892 Ga0207687_101628923 162
221 3300025929 Ga0207664_10087680 Ga0207664_100876804 162
222 3300025932 Ga0207690_10770091 Ga0207690_107700911 162
223 3300025936 Ga0207670_10378278 Ga0207670_103782782 162
224 3300025937 Ga0207669_10858818 Ga0207669_108588181 162
225 3300025938 Ga0207704_11249196 Ga0207704_112491961 162
226 3300025939 Ga0207665_10001124 Ga0207665_1000112410 162
227 3300025941 Ga0207711_10379477 Ga0207711_103794771 162
228 3300025945 Ga0207679_10072159 Ga0207679_100721591 162
229 3300025949 Ga0207667_10289569 Ga0207667_102895692 162
230 3300025981 Ga0207640_10162326 Ga0207640_101623263 162
231 3300026023 Ga0207677_10780493 Ga0207677_107804931 162
232 3300026023 Ga0207677_10825974 Ga0207677_108259742 162
233 3300026035 Ga0207703_10306842 Ga0207703_103068422 162
234 3300026067 Ga0207678_10006539 Ga0207678_100065395 162
235 3300026067 Ga0207678_10246760 Ga0207678_102467602 162
236 3300026078 Ga0207702_10033076 Ga0207702_100330764 162
237 3300026088 Ga0207641_10339055 Ga0207641_103390552 162
238 3300026116 Ga0207674_10107726 Ga0207674_101077263 162
239 3300026118 Ga0207675_100014455 Ga0207675_1000144553 162
240 3300026121 Ga0207683_10020963 Ga0207683_100209635 162
241 3300026142 Ga0207698_10300668 Ga0207698_103006682 162
242 3300027907 Ga0207428_10096737 Ga0207428_100967374 162
243 3300028379 Ga0268266_10107016 Ga0268266_101070162 162
244 3300028380 Ga0268265_10086550 Ga0268265_100865503 162
245 3300028381 Ga0268264_10096157 Ga0268264_100961573 162
246 3300028794 Ga0307515_10003919 Ga0307515_1000391913 162
247 3300030521 Ga0307511_10000374 Ga0307511_100003742 162
248 3300031616 Ga0307508_10165170 Ga0307508_101651703 162
249 3300034816 Ga0373930_0125061 Ga0373930_0125061_40_597 162
250 3300035088 Ga0373940_0159229 Ga0373940_0159229_74_631 162
251 3300035115 Ga0373941_0097367 Ga0373941_0097367_426_983 162
252 3300035121 Ga0373960_0128962 Ga0373960_0128962_181_738 162
253 3300035242 Ga0373962_0034988 Ga0373962_0034988_805_1362 162
254 3300035691 Ga0373931_0107327 Ga0373931_0107327_993_1550 162
255 3300035691 Ga0373931_0148918 Ga0373931_0148918_25_582 162
256 3300035695 Ga0373927_0221493 Ga0373927_0221493_271_792 162
257 3300037312 Ga0395899_0665997 Ga0395899_0665997_48_542 162
258 3300037418 Ga0395900_0007503 Ga0395900_0007503_10071_10571 162
259 3300037418 Ga0395900_0037646 Ga0395900_0037646_4005_4499 162
260 3300037466 Ga0395898_0001314 Ga0395898_0001314_10569_11069 162
261 3300037466 Ga0395898_0360751 Ga0395898_0360751_398_892 162
262 3300037853 Ga0436364_1040466 Ga0436364_1040466_20658_21188 162
263 3300039437 Ga0436365_0764540 Ga0436365_0764540_240_776 162
264 3300041509 Ga0451843_1220755 Ga0451843_1220755_55_579 162
265 3300044656 Ga0466969_0019738 Ga0466969_0019738_1105_1650 162
266 3300044684 Ga0466966_0134935 Ga0466966_0134935_220_765 162
267 3300044765 Ga0466970_0138600 Ga0466970_0138600_530_1075 162
268 3300044901 Ga0466960_0106122 Ga0466960_0106122_157_645 162
269 3300044901 Ga0466960_0301091 Ga0466960_0301091_160_648 162
270 3300045049 Ga0466959_0026105 Ga0466959_0026105_535_1080 162
271 3300045976 Ga0466967_0210163 Ga0466967_0210163_546_1040 162
272 3300045976 Ga0466967_0553229 Ga0466967_0553229_169_657 162
273 3300045976 Ga0466967_0642507 Ga0466967_0642507_451_1008 162
274 3300045976 Ga0466967_0966700 Ga0466967_0966700_233_721 162
275 3300046516 Ga0495628_0158644 Ga0495628_0158644_666_1214 162
276 3300048903 Ga0496100_0407920 Ga0496100_0407920_333_890 162
277 3300048904 Ga0496101_0446844 Ga0496101_0446844_366_923 162
278 3300048905 Ga0496102_0137018 Ga0496102_0137018_1452_2009 162
279 3300048907 Ga0496104_0100756 Ga0496104_0100756_830_1387 162
280 3300048907 Ga0496104_0911855 Ga0496104_0911855_86_574 162
281 3300048908 Ga0496105_0009854 Ga0496105_0009854_2027_2584 162
282 3300048909 Ga0496106_0041642 Ga0496106_0041642_852_1409 162
283 3300048911 Ga0496108_0068702 Ga0496108_0068702_448_1005 162
284 3300048912 Ga0496109_0254256 Ga0496109_0254256_567_1088 162
285 3300048913 Ga0496110_0054038 Ga0496110_0054038_882_1439 162
286 3300048913 Ga0496110_0236955 Ga0496110_0236955_1003_1560 162
287 3300048915 Ga0496112_0132671 Ga0496112_0132671_1006_1494 162
288 3300048915 Ga0496112_0241704 Ga0496112_0241704_563_1120 162
289 3300048916 Ga0496113_0055563 Ga0496113_0055563_1879_2436 162
290 3300048917 Ga0496114_0014646 Ga0496114_0014646_4339_4896 162
291 3300048918 Ga0496115_0017454 Ga0496115_0017454_613_1170 162
292 3300048921 Ga0496118_0336284 Ga0496118_0336284_282_785 162
293 3300049568 Ga0501031_0476306 Ga0501031_0476306_168_662 162
294 3300049571 Ga0501034_0437043 Ga0501034_0437043_123_617 162
295 3300049823 Ga0501044_0228108 Ga0501044_0228108_1247_1741 162
296 3300050508 nmdc:mga09592_479792_c1 nmdc:mga09592_479792_c1_544_1050 162
297 3300050510 nmdc:mga06r32_605151_c1 nmdc:mga06r32_605151_c1_332_838 162
298 3300050511 nmdc:mga08y16_220320_c1 nmdc:mga08y16_220320_c1_1250_1807 162
299 3300050512 nmdc:mga0n895_9365_c1 nmdc:mga0n895_9365_c1_1646_2203 162
300 3300050513 nmdc:mga0rr50_168106_c1 nmdc:mga0rr50_168106_c1_1108_1665 162
301 3300050514 nmdc:mga08x19_69435_c1 nmdc:mga08x19_69435_c1_931_1488 162
302 3300053077 Ga0495601_0039189 Ga0495601_0039189_938_1477 162
303 3300053178 Ga0500637_0016168 Ga0500637_0016168_1098_1601 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

24

141

0.83

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

37

163

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

57

143

0.79

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

7

128

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g0l-assembly1.cif.gz_A semi-synthetic coa-alpha-synuclein constructs trap n-terminal acetyltransferase natb for binding mechanism studies 0.874 57 161
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8688 55 159
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.864 53 159
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8573 52 159
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8547 51 161
ID Description Score Start End Superfamily
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9943 20 158 3.40.630.30
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9734 20 158 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9108 57 162 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9018 98 159 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.893 39 158 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2M9G4M0-F1-model_v4 MarR family transcriptional regulator 0.9926 2 159 GO:0003700
GO:0008080
AF-A0A4R7SGW9-F1-model_v4 deleted 0.9836 2 162
AF-A0A1H6BK29-F1-model_v4 Transcriptional regulator, MarR family with acetyltransferase activity 0.9809 2 159 GO:0003700
GO:0008080
AF-K8PSA1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9746 81 159 GO:0008080
AF-A0A4R7SGW9-F1-model_v4 deleted 0.9716 2 162

Feature Viewer

pLDDT pTM Quality
96.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map