F396152

General Info

Members Datasets Scaffolds Average Seq Length
301 198 301 89

Family's Representative Sequence

Representative Sequence 3300049531|Ga0501315_044570|Ga0501315_044570_12_326
Length 104
Sequence MAHKKGVGSSKNGRDSNPKYRGIKKYGGEQVIAGNIIVRQVGTVFHPGRNVGLGRDYTIYSLIDGVVKFEHKSKSRQRVSVYPAERPAAVEVESAAAAEQAAVA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
133 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
183 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.74
Metatranscriptomes 23.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 2.66
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000547 3300001991 Bacteria 4473
2 Ga0058863_11654222 3300004799 Bacteria 628
3 Ga0058863_11956870 3300004799 Bacteria 733
4 Ga0058861_12007962 3300004800 Bacteria 562
5 Ga0058860_10017322 3300004801 Bacteria 1858
6 Ga0058862_11228693 3300004803 Bacteria 690
7 Ga0058862_11754219 3300004803 Bacteria 673
8 Ga0058862_12853248 3300004803 Bacteria 664
9 Ga0065714_10076570 3300005288 Bacteria 2778
10 Ga0065704_10338145 3300005289 Bacteria 827
11 Ga0070658_10180969 3300005327 Bacteria 1774
12 Ga0070658_11853855 3300005327 Unclassified 521
13 Ga0070683_100190080 3300005329 Bacteria 1949
14 Ga0070670_101306306 3300005331 Bacteria 664
15 Ga0070677_10485184 3300005333 Bacteria 667
16 Ga0070680_101671427 3300005336 Bacteria 552
17 Ga0068868_100918668 3300005338 Unclassified 796
18 Ga0070687_100258070 3300005343 Bacteria 1086
19 Ga0070668_100218073 3300005347 Bacteria 1572
20 Ga0070668_100266322 3300005347 Bacteria 1427
21 Ga0070668_100823296 3300005347 Bacteria 826
22 Ga0070669_100277787 3300005353 Bacteria 1341
23 Ga0070669_101862978 3300005353 Unclassified 525
24 Ga0070675_100070459 3300005354 Bacteria 2898
25 Ga0070674_100322337 3300005356 Bacteria 1239
26 Ga0070673_100811649 3300005364 Bacteria 864
27 Ga0070667_100157538 3300005367 Bacteria 1998
28 Ga0070711_100648834 3300005439 Bacteria 885
29 Ga0070700_100257036 3300005441 Bacteria 1256
30 Ga0070678_101710444 3300005456 Bacteria 592
31 Ga0070662_100540878 3300005457 Bacteria 975
32 Ga0070662_100620737 3300005457 Bacteria 910
33 Ga0068867_101171244 3300005459 Bacteria 705
34 Ga0070706_101859303 3300005467 Bacteria 547
35 Ga0070707_100000846 3300005468 Bacteria 30361
36 Ga0070679_100509573 3300005530 Unclassified 1147
37 Ga0070704_100783105 3300005549 Unclassified 851
38 Ga0068855_100647374 3300005563 Bacteria 1135
39 Ga0068857_100588466 3300005577 Bacteria 1051
40 Ga0068857_100672193 3300005577 Bacteria 982
41 Ga0068856_100148638 3300005614 Bacteria 2351
42 Ga0068856_100605829 3300005614 Bacteria 1116
43 Ga0068856_101450925 3300005614 Bacteria 700
44 Ga0070702_100238827 3300005615 Bacteria 1225
45 Ga0068852_100395308 3300005616 Bacteria 1359
46 Ga0068852_102327798 3300005616 Bacteria 557
47 Ga0068859_100020653 3300005617 Bacteria 6609
48 Ga0068861_100908129 3300005719 Bacteria 835
49 Ga0068861_102227859 3300005719 Bacteria 549
50 Ga0068858_100530140 3300005842 Bacteria 1139
51 Ga0068862_100046360 3300005844 Bacteria 3709
52 Ga0068862_100727986 3300005844 Bacteria 963
53 Ga0081539_10012213 3300005985 Bacteria 6664
54 Ga0070717_10394399 3300006028 Bacteria 1243
55 Ga0068871_100630718 3300006358 Bacteria 977
56 Ga0068871_101303580 3300006358 Bacteria 683
57 Ga0075429_100915621 3300006880 Bacteria 767
58 Ga0075436_100076736 3300006914 Bacteria 2314
59 Ga0097620_100020652 3300006931 Bacteria 6609
60 Ga0075435_102060502 3300007076 Bacteria 501
61 Ga0105251_10584041 3300009011 Unclassified 529
62 Ga0105240_10018981 3300009093 Bacteria 9207
63 Ga0111539_10135507 3300009094 Unclassified 2884
64 Ga0111539_11823367 3300009094 Bacteria 705
65 Ga0111539_12014824 3300009094 Bacteria 669
66 Ga0105247_10067681 3300009101 Bacteria 2226
67 Ga0114129_10286259 3300009147 Bacteria 2200
68 Ga0105242_12988819 3300009176 Bacteria 523
69 Ga0105248_11249236 3300009177 Bacteria 840
70 Ga0105237_10437619 3300009545 Bacteria 1313
71 Ga0105238_11899325 3300009551 Bacteria 628
72 Ga0099796_10098434 3300010159 Bacteria 1097
73 Ga0105239_10480476 3300010375 Bacteria 1411
74 Ga0157369_10452513 3300013105 Bacteria 1330
75 Ga0163162_10141339 3300013306 Bacteria 2521
76 Ga0163162_11803815 3300013306 Bacteria 699
77 Ga0157372_12051327 3300013307 Bacteria 657
78 Ga0157375_13422600 3300013308 Bacteria 528
79 Ga0163163_10005152 3300014325 Bacteria 11269
80 Ga0163163_12706937 3300014325 Bacteria 553
81 Ga0157380_12198870 3300014326 Bacteria 615
82 Ga0157377_10685333 3300014745 Unclassified 742
83 Ga0157379_10845444 3300014968 Unclassified 866
84 Ga0157376_10860888 3300014969 Bacteria 922
85 Ga0197907_10117606 3300020069 Bacteria 3568
86 Ga0197907_11016605 3300020069 Unclassified 813
87 Ga0206356_10411573 3300020070 Bacteria 1112
88 Ga0206356_10591580 3300020070 Bacteria 1606
89 Ga0206356_11814740 3300020070 Bacteria 747
90 Ga0206349_1016521 3300020075 Unclassified 706
91 Ga0206349_1674872 3300020075 Bacteria 650
92 Ga0206349_1689644 3300020075 Bacteria 1989
93 Ga0206355_1092246 3300020076 Bacteria 3585
94 Ga0206355_1343971 3300020076 Bacteria 1072
95 Ga0206351_10405606 3300020077 Bacteria 840
96 Ga0206352_10119601 3300020078 Bacteria 3009
97 Ga0206350_10040517 3300020080 Unclassified 749
98 Ga0206350_10334234 3300020080 Unclassified 710
99 Ga0206350_10842659 3300020080 Bacteria 3259
100 Ga0206354_10179687 3300020081 Bacteria 1053
101 Ga0206354_11003427 3300020081 Bacteria 3025
102 Ga0206353_10092303 3300020082 Bacteria 2018
103 Ga0206353_10516499 3300020082 Unclassified 1126
104 Ga0154015_1320118 3300020610 Bacteria 1565
105 Ga0154015_1531012 3300020610 Bacteria 956
106 Ga0213874_10394913 3300021377 Unclassified 537
107 Ga0224712_10008483 3300022467 Bacteria 3050
108 Ga0224712_10133169 3300022467 Bacteria 1087
109 Ga0224712_10167677 3300022467 Bacteria 983
110 Ga0207647_10552367 3300025904 Bacteria 639
111 Ga0207705_10023688 3300025909 Bacteria 4380
112 Ga0207705_10548592 3300025909 Bacteria 899
113 Ga0207705_11197001 3300025909 Unclassified 583
114 Ga0207695_10000196 3300025913 Bacteria 171024
115 Ga0207695_10078623 3300025913 Bacteria 3346
116 Ga0207695_10851304 3300025913 Bacteria 792
117 Ga0207671_10000067 3300025914 Bacteria 162184
118 Ga0207671_10005939 3300025914 Bacteria 11066
119 Ga0207662_10207334 3300025918 Bacteria 1271
120 Ga0207657_10053672 3300025919 Bacteria 3490
121 Ga0207652_11424478 3300025921 Bacteria 596
122 Ga0207646_10000386 3300025922 Bacteria 59216
123 Ga0207646_11061744 3300025922 Bacteria 714
124 Ga0207681_11730504 3300025923 Unclassified 522
125 Ga0207650_11546334 3300025925 Bacteria 563
126 Ga0207659_10240495 3300025926 Bacteria 1464
127 Ga0207690_10834354 3300025932 Bacteria 763
128 Ga0207706_10448097 3300025933 Bacteria 1117
129 Ga0207670_10182148 3300025936 Bacteria 1583
130 Ga0207665_11669772 3300025939 Bacteria 504
131 Ga0207667_11063758 3300025949 Bacteria 794
132 Ga0207651_11003872 3300025960 Bacteria 746
133 Ga0207668_10217210 3300025972 Bacteria 1533
134 Ga0207640_10513086 3300025981 Bacteria 1000
135 Ga0207658_12114793 3300025986 Unclassified 511
136 Ga0207677_11301329 3300026023 Bacteria 668
137 Ga0207703_10023862 3300026035 Bacteria 4810
138 Ga0207703_10125715 3300026035 Bacteria 2207
139 Ga0207708_10098236 3300026075 Bacteria 2263
140 Ga0207702_10127563 3300026078 Bacteria 2286
141 Ga0207641_11032059 3300026088 Bacteria 820
142 Ga0207674_10338428 3300026116 Bacteria 1455
143 Ga0207674_10461648 3300026116 Bacteria 1227
144 Ga0207675_100033806 3300026118 Unclassified 4764
145 Ga0207675_100588563 3300026118 Bacteria 1115
146 Ga0207698_12366820 3300026142 Bacteria 542
147 Ga0209982_1057461 3300027552 Bacteria 631
148 Ga0207428_10116024 3300027907 Bacteria 2057
149 Ga0268265_10147347 3300028380 Bacteria 1980
150 Ga0268265_11417124 3300028380 Bacteria 697
151 Ga0265323_10022827 3300028653 Bacteria 2389
152 Ga0265323_10036781 3300028653 Bacteria 1798
153 Ga0265322_10017822 3300028654 Bacteria 2043
154 Ga0265322_10102702 3300028654 Unclassified 813
155 Ga0265330_10046159 3300031235 Bacteria 1920
156 Ga0265330_10090105 3300031235 Bacteria 1317
157 Ga0265330_10162071 3300031235 Unclassified 949
158 Ga0265328_10370060 3300031239 Unclassified 560
159 Ga0265329_10060037 3300031242 Unclassified 1204
160 Ga0265339_10134232 3300031249 Unclassified 1264
161 Ga0265316_10005732 3300031344 Bacteria 11990
162 Ga0265316_10009915 3300031344 Bacteria 8727
163 Ga0265316_10011956 3300031344 Bacteria 7801
164 Ga0265316_10059414 3300031344 Bacteria 2973
165 Ga0265316_10149870 3300031344 Bacteria 1747
166 Ga0265316_11099702 3300031344 Bacteria 551
167 Ga0265316_11112210 3300031344 Bacteria 548
168 Ga0307509_10102591 3300031507 Bacteria 2892
169 Ga0316575_10141163 3300031665 Bacteria 991
170 Ga0316579_10432159 3300031691 Bacteria 637
171 Ga0265342_10023209 3300031712 Bacteria 3931
172 Ga0265342_10137724 3300031712 Unclassified 1363
173 Ga0265342_10150270 3300031712 Bacteria 1293
174 Ga0265342_10241504 3300031712 Bacteria 967
175 Ga0316576_10132157 3300031727 Bacteria 1878
176 Ga0316576_11148935 3300031727 Unclassified 550
177 Ga0316578_10028520 3300031728 Bacteria 3161
178 Ga0316578_10273989 3300031728 Unclassified 1011
179 Ga0307405_10191339 3300031731 Bacteria 1478
180 Ga0316577_10795785 3300031733 Bacteria 536
181 Ga0307410_10001921 3300031852 Bacteria 9736
182 Ga0307410_10111297 3300031852 Bacteria 1981
183 Ga0307407_10132612 3300031903 Bacteria 1596
184 Ga0307407_10187927 3300031903 Bacteria 1374
185 Ga0307407_11176413 3300031903 Bacteria 598
186 Ga0307407_11701144 3300031903 Bacteria 502
187 Ga0307412_10269731 3300031911 Bacteria 1331
188 Ga0307412_12304596 3300031911 Unclassified 502
189 Ga0307409_100020322 3300031995 Bacteria 4522
190 Ga0307409_100103730 3300031995 Bacteria 2366
191 Ga0307409_100125976 3300031995 Bacteria 2179
192 Ga0307409_100207681 3300031995 Bacteria 1757
193 Ga0307416_100001374 3300032002 Bacteria 13144
194 Ga0307416_100045974 3300032002 Bacteria 3442
195 Ga0307416_101394520 3300032002 Bacteria 806
196 Ga0307414_10019404 3300032004 Bacteria 4213
197 Ga0307414_10438174 3300032004 Bacteria 1143
198 Ga0307411_10006107 3300032005 Bacteria 5991
199 Ga0307411_10033989 3300032005 Bacteria 3168
200 Ga0307415_100001757 3300032126 Bacteria 10581
201 Ga0307415_100560193 3300032126 Bacteria 1010
202 Ga0307415_100648482 3300032126 Bacteria 946
203 Ga0316585_10016953 3300032137 Bacteria 2198
204 Ga0316593_10016424 3300032168 Unclassified 2244
205 Ga0316593_10026401 3300032168 Bacteria 1857
206 Ga0316593_10063816 3300032168 Unclassified 1263
207 Ga0316593_10069862 3300032168 Bacteria 1213
208 Ga0316593_10076961 3300032168 Bacteria 1160
209 Ga0316593_10083586 3300032168 Bacteria 1117
210 Ga0316593_10101281 3300032168 Bacteria 1022
211 Ga0316593_10162277 3300032168 Bacteria 816
212 Ga0316593_10163580 3300032168 Bacteria 813
213 Ga0316593_10191161 3300032168 Unclassified 754
214 Ga0316593_10225805 3300032168 Bacteria 696
215 Ga0307510_10543758 3300033180 Bacteria 607
216 Ga0316592_1013775 3300033524 Bacteria 1672
217 Ga0316592_1050952 3300033524 Unclassified 924
218 Ga0316592_1089174 3300033524 Bacteria 705
219 Ga0316588_1016464 3300033528 Bacteria 1639
220 Ga0316588_1072144 3300033528 Bacteria 849
221 Ga0316588_1113617 3300033528 Unclassified 682
222 Ga0316588_1126440 3300033528 Bacteria 648
223 Ga0316587_1014593 3300033529 Bacteria 1297
224 Ga0316596_1045813 3300033541 Bacteria 1154
225 Ga0316596_1095539 3300033541 Unclassified 802
226 Ga0316596_1115489 3300033541 Bacteria 729
227 Ga0316596_1119038 3300033541 Bacteria 718
228 Ga0316596_1156606 3300033541 Bacteria 626
229 Ga0316574_0001164 3300035398 Bacteria 12150
230 Ga0316574_0046165 3300035398 Bacteria 2700
231 Ga0316574_0406610 3300035398 Unclassified 857
232 Ga0316582_0132590 3300036647 Bacteria 1675
233 Ga0316582_0354789 3300036647 Bacteria 1009
234 Ga0316582_0386619 3300036647 Bacteria 963
235 Ga0316582_0967881 3300036647 Bacteria 581
236 Ga0316582_1000514 3300036647 Bacteria 571
237 Ga0316584_0181634 3300036712 Bacteria 1557
238 Ga0395900_0279246 3300037418 Bacteria 1663
239 Ga0436365_1190990 3300039437 Bacteria 684
240 Ga0436365_1720911 3300039437 Bacteria 1235
241 Ga0436363_0116612 3300039450 Bacteria 986
242 Ga0436363_0184799 3300039450 Bacteria 631
243 Ga0436362_1143591 3300039453 Bacteria 656
244 Ga0451794_11728 3300041446 Bacteria 886
245 Ga0451797_1027803 3300041453 Bacteria 1916
246 Ga0451807_1762608 3300041486 Bacteria 1163
247 Ga0451837_1159923 3300041494 Bacteria 637
248 Ga0451853_1066520 3300041512 Bacteria 538
249 Ga0439448_0134758 3300042005 Bacteria 853
250 Ga0451577_0000074 3300042876 Bacteria 232698
251 Ga0466972_0035879 3300044658 Bacteria 2427
252 Ga0453683_0264601 3300044673 Unclassified 1097
253 Ga0466961_0879469 3300044693 Bacteria 534
254 Ga0453684_0001299 3300044712 Bacteria 74288
255 Ga0453684_0345891 3300044712 Bacteria 1678
256 Ga0466970_0001420 3300044765 Bacteria 11583
257 Ga0466959_0963148 3300045049 Bacteria 569
258 Ga0451576_0327551 3300045051 Bacteria 1603
259 Ga0451576_2182551 3300045051 Bacteria 569
260 Ga0466967_1248514 3300045976 Bacteria 740
261 Ga0495598_0124081 3300046537 Bacteria 879
262 Ga0495656_0000013 3300046615 Bacteria 135874
263 Ga0495659_0009931 3300046664 Bacteria 3044
264 Ga0495659_0386264 3300046664 Bacteria 602
265 Ga0496102_0688104 3300048905 Bacteria 946
266 Ga0496106_1563723 3300048909 Unclassified 506
267 Ga0496110_1800399 3300048913 Bacteria 522
268 Ga0496112_0009121 3300048915 Bacteria 8913
269 Ga0496115_1267275 3300048918 Bacteria 551
270 Ga0496121_0216404 3300048924 Bacteria 1353
271 Ga0501306_049350 3300049127 Bacteria 672
272 Ga0501309_045884 3300049129 Bacteria 677
273 Ga0501310_047916 3300049130 Bacteria 611
274 Ga0501307_077559 3300049162 Bacteria 538
275 Ga0501307_091434 3300049162 Bacteria 508
276 Ga0501312_059348 3300049528 Bacteria 660
277 Ga0501315_044570 3300049531 Bacteria 681
278 Ga0501315_048695 3300049531 Bacteria 660
279 Ga0501321_041053 3300049537 Bacteria 651
280 Ga0501323_078751 3300049539 Bacteria 536
281 Ga0501340_010805 3300049556 Bacteria 674
282 Ga0501034_0179279 3300049571 Bacteria 2084
283 Ga0501047_0853437 3300049581 Bacteria 724
284 Ga0501070_0290447 3300049586 Bacteria 1333
285 Ga0501242_032787 3300049674 Bacteria 710
286 Ga0501247_063684 3300049677 Bacteria 571
287 Ga0501249_087286 3300049679 Bacteria 737
288 Ga0501080_0078938 3300049742 Bacteria 3060
289 Ga0501044_0607639 3300049823 Bacteria 986
290 nmdc:mga09592_1471569_c1 3300050508 Bacteria 555
291 nmdc:mga08y16_928591_c1 3300050511 Bacteria 855
292 nmdc:mga08x19_151279_c1 3300050514 Bacteria 1572
293 Ga0500578_0000934 3300053086 Bacteria 32814
294 Ga0500651_0002611 3300053093 Bacteria 9568
295 Ga0500616_0015451 3300053153 Bacteria 4365
296 Ga0500622_0172702 3300053156 Bacteria 1005
297 Ga0590075_072463 3300059424 Bacteria 891
298 Ga0587084_049805 3300059477 Bacteria 738
299 Ga0587092_090984 3300059512 Unclassified 616
300 Ga0587110_018926 3300059654 Bacteria 765
301 Ga0466962_0426887 3300061719 Bacteria 666

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1190990 Ga0436365_1190990_396_650 79
2 3300005347 Ga0070668_100823296 Ga0070668_1008232962 80
3 3300005353 Ga0070669_101862978 Ga0070669_1018629781 80
4 3300005985 Ga0081539_10012213 Ga0081539_100122137 80
5 3300006358 Ga0068871_101303580 Ga0068871_1013035801 80
6 3300009094 Ga0111539_12014824 Ga0111539_120148241 80
7 3300009176 Ga0105242_12988819 Ga0105242_129888192 80
8 3300025923 Ga0207681_11730504 Ga0207681_117305041 80
9 3300025932 Ga0207690_10834354 Ga0207690_108343541 80
10 3300026023 Ga0207677_11301329 Ga0207677_113013291 80
11 3300032126 Ga0307415_100560193 Ga0307415_1005601932 80
12 3300033541 Ga0316596_1156606 Ga0316596_11566061 80
13 3300004799 Ga0058863_11654222 Ga0058863_116542222 81
14 3300004803 Ga0058862_11754219 Ga0058862_117542192 81
15 3300004803 Ga0058862_12853248 Ga0058862_128532482 81
16 3300005288 Ga0065714_10076570 Ga0065714_100765703 81
17 3300005327 Ga0070658_11853855 Ga0070658_118538551 81
18 3300005530 Ga0070679_100509573 Ga0070679_1005095733 81
19 3300005563 Ga0068855_100647374 Ga0068855_1006473743 81
20 3300005614 Ga0068856_100605829 Ga0068856_1006058293 81
21 3300005614 Ga0068856_101450925 Ga0068856_1014509252 81
22 3300009093 Ga0105240_10018981 Ga0105240_100189818 81
23 3300020069 Ga0197907_10117606 Ga0197907_101176063 81
24 3300020070 Ga0206356_10591580 Ga0206356_105915803 81
25 3300020075 Ga0206349_1674872 Ga0206349_16748722 81
26 3300020075 Ga0206349_1689644 Ga0206349_16896443 81
27 3300020076 Ga0206355_1092246 Ga0206355_10922463 81
28 3300020077 Ga0206351_10405606 Ga0206351_104056062 81
29 3300020078 Ga0206352_10119601 Ga0206352_101196013 81
30 3300020080 Ga0206350_10842659 Ga0206350_108426593 81
31 3300020081 Ga0206354_11003427 Ga0206354_110034273 81
32 3300020082 Ga0206353_10092303 Ga0206353_100923033 81
33 3300020610 Ga0154015_1320118 Ga0154015_13201182 81
34 3300022467 Ga0224712_10008483 Ga0224712_100084833 81
35 3300025909 Ga0207705_11197001 Ga0207705_111970011 81
36 3300025913 Ga0207695_10078623 Ga0207695_100786233 81
37 3300025921 Ga0207652_11424478 Ga0207652_114244782 81
38 3300028653 Ga0265323_10022827 Ga0265323_100228275 81
39 3300028653 Ga0265323_10036781 Ga0265323_100367813 81
40 3300028654 Ga0265322_10017822 Ga0265322_100178223 81
41 3300028654 Ga0265322_10102702 Ga0265322_101027023 81
42 3300031235 Ga0265330_10046159 Ga0265330_100461594 81
43 3300031235 Ga0265330_10090105 Ga0265330_100901053 81
44 3300031235 Ga0265330_10162071 Ga0265330_101620712 81
45 3300031239 Ga0265328_10370060 Ga0265328_103700602 81
46 3300031242 Ga0265329_10060037 Ga0265329_100600373 81
47 3300031249 Ga0265339_10134232 Ga0265339_101342323 81
48 3300031344 Ga0265316_10005732 Ga0265316_100057324 81
49 3300031344 Ga0265316_10009915 Ga0265316_100099157 81
50 3300031344 Ga0265316_10011956 Ga0265316_100119566 81
51 3300031344 Ga0265316_10059414 Ga0265316_100594144 81
52 3300031344 Ga0265316_10149870 Ga0265316_101498703 81
53 3300031344 Ga0265316_11099702 Ga0265316_110997022 81
54 3300031344 Ga0265316_11112210 Ga0265316_111122101 81
55 3300031712 Ga0265342_10023209 Ga0265342_100232095 81
56 3300031712 Ga0265342_10137724 Ga0265342_101377243 81
57 3300031712 Ga0265342_10150270 Ga0265342_101502703 81
58 3300031712 Ga0265342_10241504 Ga0265342_102415041 81
59 3300031727 Ga0316576_10132157 Ga0316576_101321575 81
60 3300031727 Ga0316576_11148935 Ga0316576_111489352 81
61 3300031728 Ga0316578_10273989 Ga0316578_102739892 81
62 3300032168 Ga0316593_10162277 Ga0316593_101622772 81
63 3300032168 Ga0316593_10191161 Ga0316593_101911612 81
64 3300033524 Ga0316592_1050952 Ga0316592_10509522 81
65 3300033528 Ga0316588_1113617 Ga0316588_11136172 81
66 3300033529 Ga0316587_1014593 Ga0316587_10145932 81
67 3300045051 Ga0451576_0327551 Ga0451576_0327551_1101_1355 81
68 3300046615 Ga0495656_0000013 Ga0495656_0000013_103616_103870 81
69 3300046664 Ga0495659_0009931 Ga0495659_0009931_2720_2974 81
70 3300046664 Ga0495659_0386264 Ga0495659_0386264_278_532 81
71 3300048905 Ga0496102_0688104 Ga0496102_0688104_579_833 81
72 3300048915 Ga0496112_0009121 Ga0496112_0009121_4292_4546 81
73 3300059477 Ga0587084_049805 Ga0587084_049805_329_595 81
74 3300059512 Ga0587092_090984 Ga0587092_090984_16_282 81
75 3300005331 Ga0070670_101306306 Ga0070670_1013063062 82
76 3300005333 Ga0070677_10485184 Ga0070677_104851841 82
77 3300005577 Ga0068857_100588466 Ga0068857_1005884662 82
78 3300005614 Ga0068856_100148638 Ga0068856_1001486383 82
79 3300007076 Ga0075435_102060502 Ga0075435_1020605021 82
80 3300009545 Ga0105237_10437619 Ga0105237_104376193 82
81 3300013105 Ga0157369_10452513 Ga0157369_104525132 82
82 3300014326 Ga0157380_12198870 Ga0157380_121988702 82
83 3300025913 Ga0207695_10851304 Ga0207695_108513041 82
84 3300025914 Ga0207671_10000067 Ga0207671_100000674 82
85 3300025925 Ga0207650_11546334 Ga0207650_115463342 82
86 3300026078 Ga0207702_10127563 Ga0207702_101275632 82
87 3300026116 Ga0207674_10338428 Ga0207674_103384282 82
88 3300031665 Ga0316575_10141163 Ga0316575_101411632 82
89 3300031728 Ga0316578_10028520 Ga0316578_100285205 82
90 3300031911 Ga0307412_12304596 Ga0307412_123045961 82
91 3300032137 Ga0316585_10016953 Ga0316585_100169534 82
92 3300032168 Ga0316593_10016424 Ga0316593_100164243 82
93 3300032168 Ga0316593_10063816 Ga0316593_100638162 82
94 3300032168 Ga0316593_10101281 Ga0316593_101012812 82
95 3300033524 Ga0316592_1013775 Ga0316592_10137752 82
96 3300033528 Ga0316588_1016464 Ga0316588_10164642 82
97 3300033528 Ga0316588_1072144 Ga0316588_10721442 82
98 3300033541 Ga0316596_1095539 Ga0316596_10955392 82
99 3300033541 Ga0316596_1119038 Ga0316596_11190382 82
100 3300035398 Ga0316574_0001164 Ga0316574_0001164_10296_10556 82
101 3300035398 Ga0316574_0046165 Ga0316574_0046165_357_614 82
102 3300035398 Ga0316574_0406610 Ga0316574_0406610_319_582 82
103 3300036647 Ga0316582_0354789 Ga0316582_0354789_233_493 82
104 3300036647 Ga0316582_0386619 Ga0316582_0386619_674_931 82
105 3300036647 Ga0316582_1000514 Ga0316582_1000514_196_453 82
106 3300036712 Ga0316584_0181634 Ga0316584_0181634_1111_1368 82
107 3300041446 Ga0451794_11728 Ga0451794_11728_222_479 82
108 3300042876 Ga0451577_0000074 Ga0451577_0000074_191984_192241 82
109 3300044712 Ga0453684_0001299 Ga0453684_0001299_33808_34065 82
110 3300044712 Ga0453684_0345891 Ga0453684_0345891_1001_1258 82
111 3300045051 Ga0451576_2182551 Ga0451576_2182551_82_339 82
112 3300053086 Ga0500578_0000934 Ga0500578_0000934_22867_23124 82
113 3300059424 Ga0590075_072463 Ga0590075_072463_506_787 82
114 3300001991 JGI24743J22301_10000547 JGI24743J22301_100005473 83
115 3300004799 Ga0058863_11956870 Ga0058863_119568702 83
116 3300004800 Ga0058861_12007962 Ga0058861_120079622 83
117 3300004801 Ga0058860_10017322 Ga0058860_100173222 83
118 3300004803 Ga0058862_11228693 Ga0058862_112286932 83
119 3300005289 Ga0065704_10338145 Ga0065704_103381452 83
120 3300005327 Ga0070658_10180969 Ga0070658_101809691 83
121 3300005329 Ga0070683_100190080 Ga0070683_1001900803 83
122 3300005336 Ga0070680_101671427 Ga0070680_1016714272 83
123 3300005338 Ga0068868_100918668 Ga0068868_1009186682 83
124 3300005343 Ga0070687_100258070 Ga0070687_1002580703 83
125 3300005347 Ga0070668_100218073 Ga0070668_1002180732 83
126 3300005347 Ga0070668_100266322 Ga0070668_1002663222 83
127 3300005353 Ga0070669_100277787 Ga0070669_1002777871 83
128 3300005354 Ga0070675_100070459 Ga0070675_1000704592 83
129 3300005356 Ga0070674_100322337 Ga0070674_1003223373 83
130 3300005364 Ga0070673_100811649 Ga0070673_1008116491 83
131 3300005367 Ga0070667_100157538 Ga0070667_1001575381 83
132 3300005439 Ga0070711_100648834 Ga0070711_1006488342 83
133 3300005441 Ga0070700_100257036 Ga0070700_1002570362 83
134 3300005456 Ga0070678_101710444 Ga0070678_1017104442 83
135 3300005457 Ga0070662_100540878 Ga0070662_1005408782 83
136 3300005457 Ga0070662_100620737 Ga0070662_1006207371 83
137 3300005459 Ga0068867_101171244 Ga0068867_1011712441 83
138 3300005467 Ga0070706_101859303 Ga0070706_1018593031 83
139 3300005468 Ga0070707_100000846 Ga0070707_10000084622 83
140 3300005549 Ga0070704_100783105 Ga0070704_1007831052 83
141 3300005577 Ga0068857_100672193 Ga0068857_1006721932 83
142 3300005615 Ga0070702_100238827 Ga0070702_1002388272 83
143 3300005616 Ga0068852_100395308 Ga0068852_1003953082 83
144 3300005616 Ga0068852_102327798 Ga0068852_1023277982 83
145 3300005617 Ga0068859_100020653 Ga0068859_1000206534 83
146 3300005719 Ga0068861_100908129 Ga0068861_1009081292 83
147 3300005719 Ga0068861_102227859 Ga0068861_1022278592 83
148 3300005842 Ga0068858_100530140 Ga0068858_1005301403 83
149 3300005844 Ga0068862_100046360 Ga0068862_1000463603 83
150 3300005844 Ga0068862_100727986 Ga0068862_1007279862 83
151 3300006028 Ga0070717_10394399 Ga0070717_103943992 83
152 3300006358 Ga0068871_100630718 Ga0068871_1006307182 83
153 3300006880 Ga0075429_100915621 Ga0075429_1009156212 83
154 3300006914 Ga0075436_100076736 Ga0075436_1000767365 83
155 3300006931 Ga0097620_100020652 Ga0097620_1000206524 83
156 3300009011 Ga0105251_10584041 Ga0105251_105840411 83
157 3300009094 Ga0111539_10135507 Ga0111539_101355073 83
158 3300009094 Ga0111539_11823367 Ga0111539_118233671 83
159 3300009101 Ga0105247_10067681 Ga0105247_100676811 83
160 3300009147 Ga0114129_10286259 Ga0114129_102862593 83
161 3300009177 Ga0105248_11249236 Ga0105248_112492362 83
162 3300009551 Ga0105238_11899325 Ga0105238_118993251 83
163 3300010159 Ga0099796_10098434 Ga0099796_100984342 83
164 3300010375 Ga0105239_10480476 Ga0105239_104804763 83
165 3300013306 Ga0163162_10141339 Ga0163162_101413392 83
166 3300013306 Ga0163162_11803815 Ga0163162_118038151 83
167 3300013307 Ga0157372_12051327 Ga0157372_120513271 83
168 3300013308 Ga0157375_13422600 Ga0157375_134226002 83
169 3300014325 Ga0163163_10005152 Ga0163163_100051528 83
170 3300014325 Ga0163163_12706937 Ga0163163_127069371 83
171 3300014745 Ga0157377_10685333 Ga0157377_106853332 83
172 3300014968 Ga0157379_10845444 Ga0157379_108454442 83
173 3300014969 Ga0157376_10860888 Ga0157376_108608881 83
174 3300020069 Ga0197907_11016605 Ga0197907_110166052 83
175 3300020070 Ga0206356_10411573 Ga0206356_104115732 83
176 3300020070 Ga0206356_11814740 Ga0206356_118147401 83
177 3300020075 Ga0206349_1016521 Ga0206349_10165211 83
178 3300020076 Ga0206355_1343971 Ga0206355_13439712 83
179 3300020080 Ga0206350_10040517 Ga0206350_100405171 83
180 3300020080 Ga0206350_10334234 Ga0206350_103342342 83
181 3300020081 Ga0206354_10179687 Ga0206354_101796872 83
182 3300020082 Ga0206353_10516499 Ga0206353_105164992 83
183 3300020610 Ga0154015_1531012 Ga0154015_15310122 83
184 3300021377 Ga0213874_10394913 Ga0213874_103949132 83
185 3300022467 Ga0224712_10133169 Ga0224712_101331692 83
186 3300022467 Ga0224712_10167677 Ga0224712_101676772 83
187 3300025904 Ga0207647_10552367 Ga0207647_105523672 83
188 3300025909 Ga0207705_10023688 Ga0207705_100236882 83
189 3300025909 Ga0207705_10548592 Ga0207705_105485922 83
190 3300025913 Ga0207695_10000196 Ga0207695_10000196138 83
191 3300025914 Ga0207671_10005939 Ga0207671_100059395 83
192 3300025918 Ga0207662_10207334 Ga0207662_102073342 83
193 3300025919 Ga0207657_10053672 Ga0207657_100536723 83
194 3300025922 Ga0207646_10000386 Ga0207646_1000038616 83
195 3300025922 Ga0207646_11061744 Ga0207646_110617442 83
196 3300025926 Ga0207659_10240495 Ga0207659_102404954 83
197 3300025933 Ga0207706_10448097 Ga0207706_104480973 83
198 3300025936 Ga0207670_10182148 Ga0207670_101821481 83
199 3300025939 Ga0207665_11669772 Ga0207665_116697722 83
200 3300025949 Ga0207667_11063758 Ga0207667_110637582 83
201 3300025960 Ga0207651_11003872 Ga0207651_110038721 83
202 3300025972 Ga0207668_10217210 Ga0207668_102172102 83
203 3300025981 Ga0207640_10513086 Ga0207640_105130862 83
204 3300025986 Ga0207658_12114793 Ga0207658_121147931 83
205 3300026035 Ga0207703_10023862 Ga0207703_100238626 83
206 3300026035 Ga0207703_10125715 Ga0207703_101257152 83
207 3300026075 Ga0207708_10098236 Ga0207708_100982363 83
208 3300026088 Ga0207641_11032059 Ga0207641_110320591 83
209 3300026116 Ga0207674_10461648 Ga0207674_104616482 83
210 3300026118 Ga0207675_100033806 Ga0207675_1000338065 83
211 3300026118 Ga0207675_100588563 Ga0207675_1005885631 83
212 3300026142 Ga0207698_12366820 Ga0207698_123668202 83
213 3300027552 Ga0209982_1057461 Ga0209982_10574612 83
214 3300027907 Ga0207428_10116024 Ga0207428_101160243 83
215 3300028380 Ga0268265_10147347 Ga0268265_101473472 83
216 3300028380 Ga0268265_11417124 Ga0268265_114171242 83
217 3300031507 Ga0307509_10102591 Ga0307509_101025914 83
218 3300031691 Ga0316579_10432159 Ga0316579_104321592 83
219 3300031731 Ga0307405_10191339 Ga0307405_101913392 83
220 3300031733 Ga0316577_10795785 Ga0316577_107957852 83
221 3300031852 Ga0307410_10001921 Ga0307410_100019217 83
222 3300031852 Ga0307410_10111297 Ga0307410_101112973 83
223 3300031903 Ga0307407_10132612 Ga0307407_101326122 83
224 3300031903 Ga0307407_10187927 Ga0307407_101879272 83
225 3300031903 Ga0307407_11176413 Ga0307407_111764131 83
226 3300031903 Ga0307407_11701144 Ga0307407_117011442 83
227 3300031911 Ga0307412_10269731 Ga0307412_102697311 83
228 3300031995 Ga0307409_100020322 Ga0307409_1000203223 83
229 3300031995 Ga0307409_100103730 Ga0307409_1001037303 83
230 3300031995 Ga0307409_100125976 Ga0307409_1001259761 83
231 3300031995 Ga0307409_100207681 Ga0307409_1002076813 83
232 3300032002 Ga0307416_100001374 Ga0307416_1000013743 83
233 3300032002 Ga0307416_100045974 Ga0307416_1000459742 83
234 3300032002 Ga0307416_101394520 Ga0307416_1013945202 83
235 3300032004 Ga0307414_10019404 Ga0307414_100194044 83
236 3300032004 Ga0307414_10438174 Ga0307414_104381742 83
237 3300032005 Ga0307411_10006107 Ga0307411_100061076 83
238 3300032005 Ga0307411_10033989 Ga0307411_100339893 83
239 3300032126 Ga0307415_100001757 Ga0307415_1000017572 83
240 3300032126 Ga0307415_100648482 Ga0307415_1006484822 83
241 3300032168 Ga0316593_10026401 Ga0316593_100264015 83
242 3300032168 Ga0316593_10069862 Ga0316593_100698623 83
243 3300032168 Ga0316593_10076961 Ga0316593_100769612 83
244 3300032168 Ga0316593_10083586 Ga0316593_100835863 83
245 3300032168 Ga0316593_10163580 Ga0316593_101635802 83
246 3300032168 Ga0316593_10225805 Ga0316593_102258052 83
247 3300033180 Ga0307510_10543758 Ga0307510_105437582 83
248 3300033524 Ga0316592_1089174 Ga0316592_10891741 83
249 3300033528 Ga0316588_1126440 Ga0316588_11264402 83
250 3300033541 Ga0316596_1045813 Ga0316596_10458132 83
251 3300033541 Ga0316596_1115489 Ga0316596_11154892 83
252 3300036647 Ga0316582_0132590 Ga0316582_0132590_440_700 83
253 3300036647 Ga0316582_0967881 Ga0316582_0967881_217_477 83
254 3300037418 Ga0395900_0279246 Ga0395900_0279246_686_943 83
255 3300039437 Ga0436365_1720911 Ga0436365_1720911_93_404 83
256 3300039450 Ga0436363_0116612 Ga0436363_0116612_156_410 83
257 3300039450 Ga0436363_0184799 Ga0436363_0184799_79_339 83
258 3300039453 Ga0436362_1143591 Ga0436362_1143591_60_371 83
259 3300041453 Ga0451797_1027803 Ga0451797_1027803_807_1076 83
260 3300041486 Ga0451807_1762608 Ga0451807_1762608_405_674 83
261 3300041494 Ga0451837_1159923 Ga0451837_1159923_178_447 83
262 3300041512 Ga0451853_1066520 Ga0451853_1066520_39_308 83
263 3300042005 Ga0439448_0134758 Ga0439448_0134758_314_571 83
264 3300044658 Ga0466972_0035879 Ga0466972_0035879_388_660 83
265 3300044673 Ga0453683_0264601 Ga0453683_0264601_469_738 83
266 3300044693 Ga0466961_0879469 Ga0466961_0879469_179_451 83
267 3300044765 Ga0466970_0001420 Ga0466970_0001420_6115_6387 83
268 3300045049 Ga0466959_0963148 Ga0466959_0963148_119_427 83
269 3300045976 Ga0466967_1248514 Ga0466967_1248514_385_696 83
270 3300046537 Ga0495598_0124081 Ga0495598_0124081_113_379 83
271 3300048909 Ga0496106_1563723 Ga0496106_1563723_111_392 83
272 3300048913 Ga0496110_1800399 Ga0496110_1800399_214_495 83
273 3300048918 Ga0496115_1267275 Ga0496115_1267275_55_333 83
274 3300048924 Ga0496121_0216404 Ga0496121_0216404_191_451 83
275 3300049127 Ga0501306_049350 Ga0501306_049350_14_319 83
276 3300049129 Ga0501309_045884 Ga0501309_045884_350_640 83
277 3300049130 Ga0501310_047916 Ga0501310_047916_14_319 83
278 3300049162 Ga0501307_077559 Ga0501307_077559_215_520 83
279 3300049162 Ga0501307_091434 Ga0501307_091434_215_478 83
280 3300049528 Ga0501312_059348 Ga0501312_059348_17_310 83
281 3300049531 Ga0501315_044570 Ga0501315_044570_12_326 83
282 3300049531 Ga0501315_048695 Ga0501315_048695_348_641 83
283 3300049537 Ga0501321_041053 Ga0501321_041053_324_614 83
284 3300049539 Ga0501323_078751 Ga0501323_078751_223_519 83
285 3300049556 Ga0501340_010805 Ga0501340_010805_343_648 83
286 3300049571 Ga0501034_0179279 Ga0501034_0179279_381_647 83
287 3300049581 Ga0501047_0853437 Ga0501047_0853437_302_568 83
288 3300049586 Ga0501070_0290447 Ga0501070_0290447_203_469 83
289 3300049674 Ga0501242_032787 Ga0501242_032787_28_333 83
290 3300049677 Ga0501247_063684 Ga0501247_063684_62_358 83
291 3300049679 Ga0501249_087286 Ga0501249_087286_391_681 83
292 3300049742 Ga0501080_0078938 Ga0501080_0078938_1937_2191 83
293 3300049823 Ga0501044_0607639 Ga0501044_0607639_442_708 83
294 3300050508 nmdc:mga09592_1471569_c1 nmdc:mga09592_1471569_c1_218_484 83
295 3300050511 nmdc:mga08y16_928591_c1 nmdc:mga08y16_928591_c1_211_492 83
296 3300050514 nmdc:mga08x19_151279_c1 nmdc:mga08x19_151279_c1_37_291 83
297 3300053093 Ga0500651_0002611 Ga0500651_0002611_1519_1785 83
298 3300053153 Ga0500616_0015451 Ga0500616_0015451_477_731 83
299 3300053156 Ga0500622_0172702 Ga0500622_0172702_488_748 83
300 3300059654 Ga0587110_018926 Ga0587110_018926_269_535 83
301 3300061719 Ga0466962_0426887 Ga0466962_0426887_189_500 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9426 20 81
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9338 20 82
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9029 18 81
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.8963 15 79
6ywy-assembly1.cif.gz_R the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.8866 14 81
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9338 20 82 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8803 20 82 2.40.50.100
2ba1A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8308 30 83 2.40.50.100
af_Q9U0I4_44_103_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8239 28 83 2.40.50.100
af_Q9ZVX0_51_147_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8192 8 81 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A4Q2WZY0-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9432 18 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A4Q2WZY0-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9295 18 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A351MV09-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.8834 13 82 GO:0003735
GO:0006412
GO:0022625
AF-A0A0G0UDD9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.8819 15 80 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A351MV09-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.8713 13 82 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
89.05 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map