F396152
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 198 | 301 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300049531|Ga0501315_044570|Ga0501315_044570_12_326 |
| Length | 104 |
| Sequence | MAHKKGVGSSKNGRDSNPKYRGIKKYGGEQVIAGNIIVRQVGTVFHPGRNVGLGRDYTIYSLIDGVVKFEHKSKSRQRVSVYPAERPAAVEVESAAAAEQAAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 70 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 118 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 121 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 133 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 140 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 141 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 147 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 150 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 151 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 154 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 170 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 183 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 184 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 191 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 192 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 194 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 195 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.74 |
| Metatranscriptomes | 23.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0 |
| Rhizoplane | 2.66 |
| Rhizosphere | 92.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10000547 | 3300001991 | Bacteria | 4473 |
| 2 | Ga0058863_11654222 | 3300004799 | Bacteria | 628 |
| 3 | Ga0058863_11956870 | 3300004799 | Bacteria | 733 |
| 4 | Ga0058861_12007962 | 3300004800 | Bacteria | 562 |
| 5 | Ga0058860_10017322 | 3300004801 | Bacteria | 1858 |
| 6 | Ga0058862_11228693 | 3300004803 | Bacteria | 690 |
| 7 | Ga0058862_11754219 | 3300004803 | Bacteria | 673 |
| 8 | Ga0058862_12853248 | 3300004803 | Bacteria | 664 |
| 9 | Ga0065714_10076570 | 3300005288 | Bacteria | 2778 |
| 10 | Ga0065704_10338145 | 3300005289 | Bacteria | 827 |
| 11 | Ga0070658_10180969 | 3300005327 | Bacteria | 1774 |
| 12 | Ga0070658_11853855 | 3300005327 | Unclassified | 521 |
| 13 | Ga0070683_100190080 | 3300005329 | Bacteria | 1949 |
| 14 | Ga0070670_101306306 | 3300005331 | Bacteria | 664 |
| 15 | Ga0070677_10485184 | 3300005333 | Bacteria | 667 |
| 16 | Ga0070680_101671427 | 3300005336 | Bacteria | 552 |
| 17 | Ga0068868_100918668 | 3300005338 | Unclassified | 796 |
| 18 | Ga0070687_100258070 | 3300005343 | Bacteria | 1086 |
| 19 | Ga0070668_100218073 | 3300005347 | Bacteria | 1572 |
| 20 | Ga0070668_100266322 | 3300005347 | Bacteria | 1427 |
| 21 | Ga0070668_100823296 | 3300005347 | Bacteria | 826 |
| 22 | Ga0070669_100277787 | 3300005353 | Bacteria | 1341 |
| 23 | Ga0070669_101862978 | 3300005353 | Unclassified | 525 |
| 24 | Ga0070675_100070459 | 3300005354 | Bacteria | 2898 |
| 25 | Ga0070674_100322337 | 3300005356 | Bacteria | 1239 |
| 26 | Ga0070673_100811649 | 3300005364 | Bacteria | 864 |
| 27 | Ga0070667_100157538 | 3300005367 | Bacteria | 1998 |
| 28 | Ga0070711_100648834 | 3300005439 | Bacteria | 885 |
| 29 | Ga0070700_100257036 | 3300005441 | Bacteria | 1256 |
| 30 | Ga0070678_101710444 | 3300005456 | Bacteria | 592 |
| 31 | Ga0070662_100540878 | 3300005457 | Bacteria | 975 |
| 32 | Ga0070662_100620737 | 3300005457 | Bacteria | 910 |
| 33 | Ga0068867_101171244 | 3300005459 | Bacteria | 705 |
| 34 | Ga0070706_101859303 | 3300005467 | Bacteria | 547 |
| 35 | Ga0070707_100000846 | 3300005468 | Bacteria | 30361 |
| 36 | Ga0070679_100509573 | 3300005530 | Unclassified | 1147 |
| 37 | Ga0070704_100783105 | 3300005549 | Unclassified | 851 |
| 38 | Ga0068855_100647374 | 3300005563 | Bacteria | 1135 |
| 39 | Ga0068857_100588466 | 3300005577 | Bacteria | 1051 |
| 40 | Ga0068857_100672193 | 3300005577 | Bacteria | 982 |
| 41 | Ga0068856_100148638 | 3300005614 | Bacteria | 2351 |
| 42 | Ga0068856_100605829 | 3300005614 | Bacteria | 1116 |
| 43 | Ga0068856_101450925 | 3300005614 | Bacteria | 700 |
| 44 | Ga0070702_100238827 | 3300005615 | Bacteria | 1225 |
| 45 | Ga0068852_100395308 | 3300005616 | Bacteria | 1359 |
| 46 | Ga0068852_102327798 | 3300005616 | Bacteria | 557 |
| 47 | Ga0068859_100020653 | 3300005617 | Bacteria | 6609 |
| 48 | Ga0068861_100908129 | 3300005719 | Bacteria | 835 |
| 49 | Ga0068861_102227859 | 3300005719 | Bacteria | 549 |
| 50 | Ga0068858_100530140 | 3300005842 | Bacteria | 1139 |
| 51 | Ga0068862_100046360 | 3300005844 | Bacteria | 3709 |
| 52 | Ga0068862_100727986 | 3300005844 | Bacteria | 963 |
| 53 | Ga0081539_10012213 | 3300005985 | Bacteria | 6664 |
| 54 | Ga0070717_10394399 | 3300006028 | Bacteria | 1243 |
| 55 | Ga0068871_100630718 | 3300006358 | Bacteria | 977 |
| 56 | Ga0068871_101303580 | 3300006358 | Bacteria | 683 |
| 57 | Ga0075429_100915621 | 3300006880 | Bacteria | 767 |
| 58 | Ga0075436_100076736 | 3300006914 | Bacteria | 2314 |
| 59 | Ga0097620_100020652 | 3300006931 | Bacteria | 6609 |
| 60 | Ga0075435_102060502 | 3300007076 | Bacteria | 501 |
| 61 | Ga0105251_10584041 | 3300009011 | Unclassified | 529 |
| 62 | Ga0105240_10018981 | 3300009093 | Bacteria | 9207 |
| 63 | Ga0111539_10135507 | 3300009094 | Unclassified | 2884 |
| 64 | Ga0111539_11823367 | 3300009094 | Bacteria | 705 |
| 65 | Ga0111539_12014824 | 3300009094 | Bacteria | 669 |
| 66 | Ga0105247_10067681 | 3300009101 | Bacteria | 2226 |
| 67 | Ga0114129_10286259 | 3300009147 | Bacteria | 2200 |
| 68 | Ga0105242_12988819 | 3300009176 | Bacteria | 523 |
| 69 | Ga0105248_11249236 | 3300009177 | Bacteria | 840 |
| 70 | Ga0105237_10437619 | 3300009545 | Bacteria | 1313 |
| 71 | Ga0105238_11899325 | 3300009551 | Bacteria | 628 |
| 72 | Ga0099796_10098434 | 3300010159 | Bacteria | 1097 |
| 73 | Ga0105239_10480476 | 3300010375 | Bacteria | 1411 |
| 74 | Ga0157369_10452513 | 3300013105 | Bacteria | 1330 |
| 75 | Ga0163162_10141339 | 3300013306 | Bacteria | 2521 |
| 76 | Ga0163162_11803815 | 3300013306 | Bacteria | 699 |
| 77 | Ga0157372_12051327 | 3300013307 | Bacteria | 657 |
| 78 | Ga0157375_13422600 | 3300013308 | Bacteria | 528 |
| 79 | Ga0163163_10005152 | 3300014325 | Bacteria | 11269 |
| 80 | Ga0163163_12706937 | 3300014325 | Bacteria | 553 |
| 81 | Ga0157380_12198870 | 3300014326 | Bacteria | 615 |
| 82 | Ga0157377_10685333 | 3300014745 | Unclassified | 742 |
| 83 | Ga0157379_10845444 | 3300014968 | Unclassified | 866 |
| 84 | Ga0157376_10860888 | 3300014969 | Bacteria | 922 |
| 85 | Ga0197907_10117606 | 3300020069 | Bacteria | 3568 |
| 86 | Ga0197907_11016605 | 3300020069 | Unclassified | 813 |
| 87 | Ga0206356_10411573 | 3300020070 | Bacteria | 1112 |
| 88 | Ga0206356_10591580 | 3300020070 | Bacteria | 1606 |
| 89 | Ga0206356_11814740 | 3300020070 | Bacteria | 747 |
| 90 | Ga0206349_1016521 | 3300020075 | Unclassified | 706 |
| 91 | Ga0206349_1674872 | 3300020075 | Bacteria | 650 |
| 92 | Ga0206349_1689644 | 3300020075 | Bacteria | 1989 |
| 93 | Ga0206355_1092246 | 3300020076 | Bacteria | 3585 |
| 94 | Ga0206355_1343971 | 3300020076 | Bacteria | 1072 |
| 95 | Ga0206351_10405606 | 3300020077 | Bacteria | 840 |
| 96 | Ga0206352_10119601 | 3300020078 | Bacteria | 3009 |
| 97 | Ga0206350_10040517 | 3300020080 | Unclassified | 749 |
| 98 | Ga0206350_10334234 | 3300020080 | Unclassified | 710 |
| 99 | Ga0206350_10842659 | 3300020080 | Bacteria | 3259 |
| 100 | Ga0206354_10179687 | 3300020081 | Bacteria | 1053 |
| 101 | Ga0206354_11003427 | 3300020081 | Bacteria | 3025 |
| 102 | Ga0206353_10092303 | 3300020082 | Bacteria | 2018 |
| 103 | Ga0206353_10516499 | 3300020082 | Unclassified | 1126 |
| 104 | Ga0154015_1320118 | 3300020610 | Bacteria | 1565 |
| 105 | Ga0154015_1531012 | 3300020610 | Bacteria | 956 |
| 106 | Ga0213874_10394913 | 3300021377 | Unclassified | 537 |
| 107 | Ga0224712_10008483 | 3300022467 | Bacteria | 3050 |
| 108 | Ga0224712_10133169 | 3300022467 | Bacteria | 1087 |
| 109 | Ga0224712_10167677 | 3300022467 | Bacteria | 983 |
| 110 | Ga0207647_10552367 | 3300025904 | Bacteria | 639 |
| 111 | Ga0207705_10023688 | 3300025909 | Bacteria | 4380 |
| 112 | Ga0207705_10548592 | 3300025909 | Bacteria | 899 |
| 113 | Ga0207705_11197001 | 3300025909 | Unclassified | 583 |
| 114 | Ga0207695_10000196 | 3300025913 | Bacteria | 171024 |
| 115 | Ga0207695_10078623 | 3300025913 | Bacteria | 3346 |
| 116 | Ga0207695_10851304 | 3300025913 | Bacteria | 792 |
| 117 | Ga0207671_10000067 | 3300025914 | Bacteria | 162184 |
| 118 | Ga0207671_10005939 | 3300025914 | Bacteria | 11066 |
| 119 | Ga0207662_10207334 | 3300025918 | Bacteria | 1271 |
| 120 | Ga0207657_10053672 | 3300025919 | Bacteria | 3490 |
| 121 | Ga0207652_11424478 | 3300025921 | Bacteria | 596 |
| 122 | Ga0207646_10000386 | 3300025922 | Bacteria | 59216 |
| 123 | Ga0207646_11061744 | 3300025922 | Bacteria | 714 |
| 124 | Ga0207681_11730504 | 3300025923 | Unclassified | 522 |
| 125 | Ga0207650_11546334 | 3300025925 | Bacteria | 563 |
| 126 | Ga0207659_10240495 | 3300025926 | Bacteria | 1464 |
| 127 | Ga0207690_10834354 | 3300025932 | Bacteria | 763 |
| 128 | Ga0207706_10448097 | 3300025933 | Bacteria | 1117 |
| 129 | Ga0207670_10182148 | 3300025936 | Bacteria | 1583 |
| 130 | Ga0207665_11669772 | 3300025939 | Bacteria | 504 |
| 131 | Ga0207667_11063758 | 3300025949 | Bacteria | 794 |
| 132 | Ga0207651_11003872 | 3300025960 | Bacteria | 746 |
| 133 | Ga0207668_10217210 | 3300025972 | Bacteria | 1533 |
| 134 | Ga0207640_10513086 | 3300025981 | Bacteria | 1000 |
| 135 | Ga0207658_12114793 | 3300025986 | Unclassified | 511 |
| 136 | Ga0207677_11301329 | 3300026023 | Bacteria | 668 |
| 137 | Ga0207703_10023862 | 3300026035 | Bacteria | 4810 |
| 138 | Ga0207703_10125715 | 3300026035 | Bacteria | 2207 |
| 139 | Ga0207708_10098236 | 3300026075 | Bacteria | 2263 |
| 140 | Ga0207702_10127563 | 3300026078 | Bacteria | 2286 |
| 141 | Ga0207641_11032059 | 3300026088 | Bacteria | 820 |
| 142 | Ga0207674_10338428 | 3300026116 | Bacteria | 1455 |
| 143 | Ga0207674_10461648 | 3300026116 | Bacteria | 1227 |
| 144 | Ga0207675_100033806 | 3300026118 | Unclassified | 4764 |
| 145 | Ga0207675_100588563 | 3300026118 | Bacteria | 1115 |
| 146 | Ga0207698_12366820 | 3300026142 | Bacteria | 542 |
| 147 | Ga0209982_1057461 | 3300027552 | Bacteria | 631 |
| 148 | Ga0207428_10116024 | 3300027907 | Bacteria | 2057 |
| 149 | Ga0268265_10147347 | 3300028380 | Bacteria | 1980 |
| 150 | Ga0268265_11417124 | 3300028380 | Bacteria | 697 |
| 151 | Ga0265323_10022827 | 3300028653 | Bacteria | 2389 |
| 152 | Ga0265323_10036781 | 3300028653 | Bacteria | 1798 |
| 153 | Ga0265322_10017822 | 3300028654 | Bacteria | 2043 |
| 154 | Ga0265322_10102702 | 3300028654 | Unclassified | 813 |
| 155 | Ga0265330_10046159 | 3300031235 | Bacteria | 1920 |
| 156 | Ga0265330_10090105 | 3300031235 | Bacteria | 1317 |
| 157 | Ga0265330_10162071 | 3300031235 | Unclassified | 949 |
| 158 | Ga0265328_10370060 | 3300031239 | Unclassified | 560 |
| 159 | Ga0265329_10060037 | 3300031242 | Unclassified | 1204 |
| 160 | Ga0265339_10134232 | 3300031249 | Unclassified | 1264 |
| 161 | Ga0265316_10005732 | 3300031344 | Bacteria | 11990 |
| 162 | Ga0265316_10009915 | 3300031344 | Bacteria | 8727 |
| 163 | Ga0265316_10011956 | 3300031344 | Bacteria | 7801 |
| 164 | Ga0265316_10059414 | 3300031344 | Bacteria | 2973 |
| 165 | Ga0265316_10149870 | 3300031344 | Bacteria | 1747 |
| 166 | Ga0265316_11099702 | 3300031344 | Bacteria | 551 |
| 167 | Ga0265316_11112210 | 3300031344 | Bacteria | 548 |
| 168 | Ga0307509_10102591 | 3300031507 | Bacteria | 2892 |
| 169 | Ga0316575_10141163 | 3300031665 | Bacteria | 991 |
| 170 | Ga0316579_10432159 | 3300031691 | Bacteria | 637 |
| 171 | Ga0265342_10023209 | 3300031712 | Bacteria | 3931 |
| 172 | Ga0265342_10137724 | 3300031712 | Unclassified | 1363 |
| 173 | Ga0265342_10150270 | 3300031712 | Bacteria | 1293 |
| 174 | Ga0265342_10241504 | 3300031712 | Bacteria | 967 |
| 175 | Ga0316576_10132157 | 3300031727 | Bacteria | 1878 |
| 176 | Ga0316576_11148935 | 3300031727 | Unclassified | 550 |
| 177 | Ga0316578_10028520 | 3300031728 | Bacteria | 3161 |
| 178 | Ga0316578_10273989 | 3300031728 | Unclassified | 1011 |
| 179 | Ga0307405_10191339 | 3300031731 | Bacteria | 1478 |
| 180 | Ga0316577_10795785 | 3300031733 | Bacteria | 536 |
| 181 | Ga0307410_10001921 | 3300031852 | Bacteria | 9736 |
| 182 | Ga0307410_10111297 | 3300031852 | Bacteria | 1981 |
| 183 | Ga0307407_10132612 | 3300031903 | Bacteria | 1596 |
| 184 | Ga0307407_10187927 | 3300031903 | Bacteria | 1374 |
| 185 | Ga0307407_11176413 | 3300031903 | Bacteria | 598 |
| 186 | Ga0307407_11701144 | 3300031903 | Bacteria | 502 |
| 187 | Ga0307412_10269731 | 3300031911 | Bacteria | 1331 |
| 188 | Ga0307412_12304596 | 3300031911 | Unclassified | 502 |
| 189 | Ga0307409_100020322 | 3300031995 | Bacteria | 4522 |
| 190 | Ga0307409_100103730 | 3300031995 | Bacteria | 2366 |
| 191 | Ga0307409_100125976 | 3300031995 | Bacteria | 2179 |
| 192 | Ga0307409_100207681 | 3300031995 | Bacteria | 1757 |
| 193 | Ga0307416_100001374 | 3300032002 | Bacteria | 13144 |
| 194 | Ga0307416_100045974 | 3300032002 | Bacteria | 3442 |
| 195 | Ga0307416_101394520 | 3300032002 | Bacteria | 806 |
| 196 | Ga0307414_10019404 | 3300032004 | Bacteria | 4213 |
| 197 | Ga0307414_10438174 | 3300032004 | Bacteria | 1143 |
| 198 | Ga0307411_10006107 | 3300032005 | Bacteria | 5991 |
| 199 | Ga0307411_10033989 | 3300032005 | Bacteria | 3168 |
| 200 | Ga0307415_100001757 | 3300032126 | Bacteria | 10581 |
| 201 | Ga0307415_100560193 | 3300032126 | Bacteria | 1010 |
| 202 | Ga0307415_100648482 | 3300032126 | Bacteria | 946 |
| 203 | Ga0316585_10016953 | 3300032137 | Bacteria | 2198 |
| 204 | Ga0316593_10016424 | 3300032168 | Unclassified | 2244 |
| 205 | Ga0316593_10026401 | 3300032168 | Bacteria | 1857 |
| 206 | Ga0316593_10063816 | 3300032168 | Unclassified | 1263 |
| 207 | Ga0316593_10069862 | 3300032168 | Bacteria | 1213 |
| 208 | Ga0316593_10076961 | 3300032168 | Bacteria | 1160 |
| 209 | Ga0316593_10083586 | 3300032168 | Bacteria | 1117 |
| 210 | Ga0316593_10101281 | 3300032168 | Bacteria | 1022 |
| 211 | Ga0316593_10162277 | 3300032168 | Bacteria | 816 |
| 212 | Ga0316593_10163580 | 3300032168 | Bacteria | 813 |
| 213 | Ga0316593_10191161 | 3300032168 | Unclassified | 754 |
| 214 | Ga0316593_10225805 | 3300032168 | Bacteria | 696 |
| 215 | Ga0307510_10543758 | 3300033180 | Bacteria | 607 |
| 216 | Ga0316592_1013775 | 3300033524 | Bacteria | 1672 |
| 217 | Ga0316592_1050952 | 3300033524 | Unclassified | 924 |
| 218 | Ga0316592_1089174 | 3300033524 | Bacteria | 705 |
| 219 | Ga0316588_1016464 | 3300033528 | Bacteria | 1639 |
| 220 | Ga0316588_1072144 | 3300033528 | Bacteria | 849 |
| 221 | Ga0316588_1113617 | 3300033528 | Unclassified | 682 |
| 222 | Ga0316588_1126440 | 3300033528 | Bacteria | 648 |
| 223 | Ga0316587_1014593 | 3300033529 | Bacteria | 1297 |
| 224 | Ga0316596_1045813 | 3300033541 | Bacteria | 1154 |
| 225 | Ga0316596_1095539 | 3300033541 | Unclassified | 802 |
| 226 | Ga0316596_1115489 | 3300033541 | Bacteria | 729 |
| 227 | Ga0316596_1119038 | 3300033541 | Bacteria | 718 |
| 228 | Ga0316596_1156606 | 3300033541 | Bacteria | 626 |
| 229 | Ga0316574_0001164 | 3300035398 | Bacteria | 12150 |
| 230 | Ga0316574_0046165 | 3300035398 | Bacteria | 2700 |
| 231 | Ga0316574_0406610 | 3300035398 | Unclassified | 857 |
| 232 | Ga0316582_0132590 | 3300036647 | Bacteria | 1675 |
| 233 | Ga0316582_0354789 | 3300036647 | Bacteria | 1009 |
| 234 | Ga0316582_0386619 | 3300036647 | Bacteria | 963 |
| 235 | Ga0316582_0967881 | 3300036647 | Bacteria | 581 |
| 236 | Ga0316582_1000514 | 3300036647 | Bacteria | 571 |
| 237 | Ga0316584_0181634 | 3300036712 | Bacteria | 1557 |
| 238 | Ga0395900_0279246 | 3300037418 | Bacteria | 1663 |
| 239 | Ga0436365_1190990 | 3300039437 | Bacteria | 684 |
| 240 | Ga0436365_1720911 | 3300039437 | Bacteria | 1235 |
| 241 | Ga0436363_0116612 | 3300039450 | Bacteria | 986 |
| 242 | Ga0436363_0184799 | 3300039450 | Bacteria | 631 |
| 243 | Ga0436362_1143591 | 3300039453 | Bacteria | 656 |
| 244 | Ga0451794_11728 | 3300041446 | Bacteria | 886 |
| 245 | Ga0451797_1027803 | 3300041453 | Bacteria | 1916 |
| 246 | Ga0451807_1762608 | 3300041486 | Bacteria | 1163 |
| 247 | Ga0451837_1159923 | 3300041494 | Bacteria | 637 |
| 248 | Ga0451853_1066520 | 3300041512 | Bacteria | 538 |
| 249 | Ga0439448_0134758 | 3300042005 | Bacteria | 853 |
| 250 | Ga0451577_0000074 | 3300042876 | Bacteria | 232698 |
| 251 | Ga0466972_0035879 | 3300044658 | Bacteria | 2427 |
| 252 | Ga0453683_0264601 | 3300044673 | Unclassified | 1097 |
| 253 | Ga0466961_0879469 | 3300044693 | Bacteria | 534 |
| 254 | Ga0453684_0001299 | 3300044712 | Bacteria | 74288 |
| 255 | Ga0453684_0345891 | 3300044712 | Bacteria | 1678 |
| 256 | Ga0466970_0001420 | 3300044765 | Bacteria | 11583 |
| 257 | Ga0466959_0963148 | 3300045049 | Bacteria | 569 |
| 258 | Ga0451576_0327551 | 3300045051 | Bacteria | 1603 |
| 259 | Ga0451576_2182551 | 3300045051 | Bacteria | 569 |
| 260 | Ga0466967_1248514 | 3300045976 | Bacteria | 740 |
| 261 | Ga0495598_0124081 | 3300046537 | Bacteria | 879 |
| 262 | Ga0495656_0000013 | 3300046615 | Bacteria | 135874 |
| 263 | Ga0495659_0009931 | 3300046664 | Bacteria | 3044 |
| 264 | Ga0495659_0386264 | 3300046664 | Bacteria | 602 |
| 265 | Ga0496102_0688104 | 3300048905 | Bacteria | 946 |
| 266 | Ga0496106_1563723 | 3300048909 | Unclassified | 506 |
| 267 | Ga0496110_1800399 | 3300048913 | Bacteria | 522 |
| 268 | Ga0496112_0009121 | 3300048915 | Bacteria | 8913 |
| 269 | Ga0496115_1267275 | 3300048918 | Bacteria | 551 |
| 270 | Ga0496121_0216404 | 3300048924 | Bacteria | 1353 |
| 271 | Ga0501306_049350 | 3300049127 | Bacteria | 672 |
| 272 | Ga0501309_045884 | 3300049129 | Bacteria | 677 |
| 273 | Ga0501310_047916 | 3300049130 | Bacteria | 611 |
| 274 | Ga0501307_077559 | 3300049162 | Bacteria | 538 |
| 275 | Ga0501307_091434 | 3300049162 | Bacteria | 508 |
| 276 | Ga0501312_059348 | 3300049528 | Bacteria | 660 |
| 277 | Ga0501315_044570 | 3300049531 | Bacteria | 681 |
| 278 | Ga0501315_048695 | 3300049531 | Bacteria | 660 |
| 279 | Ga0501321_041053 | 3300049537 | Bacteria | 651 |
| 280 | Ga0501323_078751 | 3300049539 | Bacteria | 536 |
| 281 | Ga0501340_010805 | 3300049556 | Bacteria | 674 |
| 282 | Ga0501034_0179279 | 3300049571 | Bacteria | 2084 |
| 283 | Ga0501047_0853437 | 3300049581 | Bacteria | 724 |
| 284 | Ga0501070_0290447 | 3300049586 | Bacteria | 1333 |
| 285 | Ga0501242_032787 | 3300049674 | Bacteria | 710 |
| 286 | Ga0501247_063684 | 3300049677 | Bacteria | 571 |
| 287 | Ga0501249_087286 | 3300049679 | Bacteria | 737 |
| 288 | Ga0501080_0078938 | 3300049742 | Bacteria | 3060 |
| 289 | Ga0501044_0607639 | 3300049823 | Bacteria | 986 |
| 290 | nmdc:mga09592_1471569_c1 | 3300050508 | Bacteria | 555 |
| 291 | nmdc:mga08y16_928591_c1 | 3300050511 | Bacteria | 855 |
| 292 | nmdc:mga08x19_151279_c1 | 3300050514 | Bacteria | 1572 |
| 293 | Ga0500578_0000934 | 3300053086 | Bacteria | 32814 |
| 294 | Ga0500651_0002611 | 3300053093 | Bacteria | 9568 |
| 295 | Ga0500616_0015451 | 3300053153 | Bacteria | 4365 |
| 296 | Ga0500622_0172702 | 3300053156 | Bacteria | 1005 |
| 297 | Ga0590075_072463 | 3300059424 | Bacteria | 891 |
| 298 | Ga0587084_049805 | 3300059477 | Bacteria | 738 |
| 299 | Ga0587092_090984 | 3300059512 | Unclassified | 616 |
| 300 | Ga0587110_018926 | 3300059654 | Bacteria | 765 |
| 301 | Ga0466962_0426887 | 3300061719 | Bacteria | 666 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1190990 | Ga0436365_1190990_396_650 | 79 |
| 2 | 3300005347 | Ga0070668_100823296 | Ga0070668_1008232962 | 80 |
| 3 | 3300005353 | Ga0070669_101862978 | Ga0070669_1018629781 | 80 |
| 4 | 3300005985 | Ga0081539_10012213 | Ga0081539_100122137 | 80 |
| 5 | 3300006358 | Ga0068871_101303580 | Ga0068871_1013035801 | 80 |
| 6 | 3300009094 | Ga0111539_12014824 | Ga0111539_120148241 | 80 |
| 7 | 3300009176 | Ga0105242_12988819 | Ga0105242_129888192 | 80 |
| 8 | 3300025923 | Ga0207681_11730504 | Ga0207681_117305041 | 80 |
| 9 | 3300025932 | Ga0207690_10834354 | Ga0207690_108343541 | 80 |
| 10 | 3300026023 | Ga0207677_11301329 | Ga0207677_113013291 | 80 |
| 11 | 3300032126 | Ga0307415_100560193 | Ga0307415_1005601932 | 80 |
| 12 | 3300033541 | Ga0316596_1156606 | Ga0316596_11566061 | 80 |
| 13 | 3300004799 | Ga0058863_11654222 | Ga0058863_116542222 | 81 |
| 14 | 3300004803 | Ga0058862_11754219 | Ga0058862_117542192 | 81 |
| 15 | 3300004803 | Ga0058862_12853248 | Ga0058862_128532482 | 81 |
| 16 | 3300005288 | Ga0065714_10076570 | Ga0065714_100765703 | 81 |
| 17 | 3300005327 | Ga0070658_11853855 | Ga0070658_118538551 | 81 |
| 18 | 3300005530 | Ga0070679_100509573 | Ga0070679_1005095733 | 81 |
| 19 | 3300005563 | Ga0068855_100647374 | Ga0068855_1006473743 | 81 |
| 20 | 3300005614 | Ga0068856_100605829 | Ga0068856_1006058293 | 81 |
| 21 | 3300005614 | Ga0068856_101450925 | Ga0068856_1014509252 | 81 |
| 22 | 3300009093 | Ga0105240_10018981 | Ga0105240_100189818 | 81 |
| 23 | 3300020069 | Ga0197907_10117606 | Ga0197907_101176063 | 81 |
| 24 | 3300020070 | Ga0206356_10591580 | Ga0206356_105915803 | 81 |
| 25 | 3300020075 | Ga0206349_1674872 | Ga0206349_16748722 | 81 |
| 26 | 3300020075 | Ga0206349_1689644 | Ga0206349_16896443 | 81 |
| 27 | 3300020076 | Ga0206355_1092246 | Ga0206355_10922463 | 81 |
| 28 | 3300020077 | Ga0206351_10405606 | Ga0206351_104056062 | 81 |
| 29 | 3300020078 | Ga0206352_10119601 | Ga0206352_101196013 | 81 |
| 30 | 3300020080 | Ga0206350_10842659 | Ga0206350_108426593 | 81 |
| 31 | 3300020081 | Ga0206354_11003427 | Ga0206354_110034273 | 81 |
| 32 | 3300020082 | Ga0206353_10092303 | Ga0206353_100923033 | 81 |
| 33 | 3300020610 | Ga0154015_1320118 | Ga0154015_13201182 | 81 |
| 34 | 3300022467 | Ga0224712_10008483 | Ga0224712_100084833 | 81 |
| 35 | 3300025909 | Ga0207705_11197001 | Ga0207705_111970011 | 81 |
| 36 | 3300025913 | Ga0207695_10078623 | Ga0207695_100786233 | 81 |
| 37 | 3300025921 | Ga0207652_11424478 | Ga0207652_114244782 | 81 |
| 38 | 3300028653 | Ga0265323_10022827 | Ga0265323_100228275 | 81 |
| 39 | 3300028653 | Ga0265323_10036781 | Ga0265323_100367813 | 81 |
| 40 | 3300028654 | Ga0265322_10017822 | Ga0265322_100178223 | 81 |
| 41 | 3300028654 | Ga0265322_10102702 | Ga0265322_101027023 | 81 |
| 42 | 3300031235 | Ga0265330_10046159 | Ga0265330_100461594 | 81 |
| 43 | 3300031235 | Ga0265330_10090105 | Ga0265330_100901053 | 81 |
| 44 | 3300031235 | Ga0265330_10162071 | Ga0265330_101620712 | 81 |
| 45 | 3300031239 | Ga0265328_10370060 | Ga0265328_103700602 | 81 |
| 46 | 3300031242 | Ga0265329_10060037 | Ga0265329_100600373 | 81 |
| 47 | 3300031249 | Ga0265339_10134232 | Ga0265339_101342323 | 81 |
| 48 | 3300031344 | Ga0265316_10005732 | Ga0265316_100057324 | 81 |
| 49 | 3300031344 | Ga0265316_10009915 | Ga0265316_100099157 | 81 |
| 50 | 3300031344 | Ga0265316_10011956 | Ga0265316_100119566 | 81 |
| 51 | 3300031344 | Ga0265316_10059414 | Ga0265316_100594144 | 81 |
| 52 | 3300031344 | Ga0265316_10149870 | Ga0265316_101498703 | 81 |
| 53 | 3300031344 | Ga0265316_11099702 | Ga0265316_110997022 | 81 |
| 54 | 3300031344 | Ga0265316_11112210 | Ga0265316_111122101 | 81 |
| 55 | 3300031712 | Ga0265342_10023209 | Ga0265342_100232095 | 81 |
| 56 | 3300031712 | Ga0265342_10137724 | Ga0265342_101377243 | 81 |
| 57 | 3300031712 | Ga0265342_10150270 | Ga0265342_101502703 | 81 |
| 58 | 3300031712 | Ga0265342_10241504 | Ga0265342_102415041 | 81 |
| 59 | 3300031727 | Ga0316576_10132157 | Ga0316576_101321575 | 81 |
| 60 | 3300031727 | Ga0316576_11148935 | Ga0316576_111489352 | 81 |
| 61 | 3300031728 | Ga0316578_10273989 | Ga0316578_102739892 | 81 |
| 62 | 3300032168 | Ga0316593_10162277 | Ga0316593_101622772 | 81 |
| 63 | 3300032168 | Ga0316593_10191161 | Ga0316593_101911612 | 81 |
| 64 | 3300033524 | Ga0316592_1050952 | Ga0316592_10509522 | 81 |
| 65 | 3300033528 | Ga0316588_1113617 | Ga0316588_11136172 | 81 |
| 66 | 3300033529 | Ga0316587_1014593 | Ga0316587_10145932 | 81 |
| 67 | 3300045051 | Ga0451576_0327551 | Ga0451576_0327551_1101_1355 | 81 |
| 68 | 3300046615 | Ga0495656_0000013 | Ga0495656_0000013_103616_103870 | 81 |
| 69 | 3300046664 | Ga0495659_0009931 | Ga0495659_0009931_2720_2974 | 81 |
| 70 | 3300046664 | Ga0495659_0386264 | Ga0495659_0386264_278_532 | 81 |
| 71 | 3300048905 | Ga0496102_0688104 | Ga0496102_0688104_579_833 | 81 |
| 72 | 3300048915 | Ga0496112_0009121 | Ga0496112_0009121_4292_4546 | 81 |
| 73 | 3300059477 | Ga0587084_049805 | Ga0587084_049805_329_595 | 81 |
| 74 | 3300059512 | Ga0587092_090984 | Ga0587092_090984_16_282 | 81 |
| 75 | 3300005331 | Ga0070670_101306306 | Ga0070670_1013063062 | 82 |
| 76 | 3300005333 | Ga0070677_10485184 | Ga0070677_104851841 | 82 |
| 77 | 3300005577 | Ga0068857_100588466 | Ga0068857_1005884662 | 82 |
| 78 | 3300005614 | Ga0068856_100148638 | Ga0068856_1001486383 | 82 |
| 79 | 3300007076 | Ga0075435_102060502 | Ga0075435_1020605021 | 82 |
| 80 | 3300009545 | Ga0105237_10437619 | Ga0105237_104376193 | 82 |
| 81 | 3300013105 | Ga0157369_10452513 | Ga0157369_104525132 | 82 |
| 82 | 3300014326 | Ga0157380_12198870 | Ga0157380_121988702 | 82 |
| 83 | 3300025913 | Ga0207695_10851304 | Ga0207695_108513041 | 82 |
| 84 | 3300025914 | Ga0207671_10000067 | Ga0207671_100000674 | 82 |
| 85 | 3300025925 | Ga0207650_11546334 | Ga0207650_115463342 | 82 |
| 86 | 3300026078 | Ga0207702_10127563 | Ga0207702_101275632 | 82 |
| 87 | 3300026116 | Ga0207674_10338428 | Ga0207674_103384282 | 82 |
| 88 | 3300031665 | Ga0316575_10141163 | Ga0316575_101411632 | 82 |
| 89 | 3300031728 | Ga0316578_10028520 | Ga0316578_100285205 | 82 |
| 90 | 3300031911 | Ga0307412_12304596 | Ga0307412_123045961 | 82 |
| 91 | 3300032137 | Ga0316585_10016953 | Ga0316585_100169534 | 82 |
| 92 | 3300032168 | Ga0316593_10016424 | Ga0316593_100164243 | 82 |
| 93 | 3300032168 | Ga0316593_10063816 | Ga0316593_100638162 | 82 |
| 94 | 3300032168 | Ga0316593_10101281 | Ga0316593_101012812 | 82 |
| 95 | 3300033524 | Ga0316592_1013775 | Ga0316592_10137752 | 82 |
| 96 | 3300033528 | Ga0316588_1016464 | Ga0316588_10164642 | 82 |
| 97 | 3300033528 | Ga0316588_1072144 | Ga0316588_10721442 | 82 |
| 98 | 3300033541 | Ga0316596_1095539 | Ga0316596_10955392 | 82 |
| 99 | 3300033541 | Ga0316596_1119038 | Ga0316596_11190382 | 82 |
| 100 | 3300035398 | Ga0316574_0001164 | Ga0316574_0001164_10296_10556 | 82 |
| 101 | 3300035398 | Ga0316574_0046165 | Ga0316574_0046165_357_614 | 82 |
| 102 | 3300035398 | Ga0316574_0406610 | Ga0316574_0406610_319_582 | 82 |
| 103 | 3300036647 | Ga0316582_0354789 | Ga0316582_0354789_233_493 | 82 |
| 104 | 3300036647 | Ga0316582_0386619 | Ga0316582_0386619_674_931 | 82 |
| 105 | 3300036647 | Ga0316582_1000514 | Ga0316582_1000514_196_453 | 82 |
| 106 | 3300036712 | Ga0316584_0181634 | Ga0316584_0181634_1111_1368 | 82 |
| 107 | 3300041446 | Ga0451794_11728 | Ga0451794_11728_222_479 | 82 |
| 108 | 3300042876 | Ga0451577_0000074 | Ga0451577_0000074_191984_192241 | 82 |
| 109 | 3300044712 | Ga0453684_0001299 | Ga0453684_0001299_33808_34065 | 82 |
| 110 | 3300044712 | Ga0453684_0345891 | Ga0453684_0345891_1001_1258 | 82 |
| 111 | 3300045051 | Ga0451576_2182551 | Ga0451576_2182551_82_339 | 82 |
| 112 | 3300053086 | Ga0500578_0000934 | Ga0500578_0000934_22867_23124 | 82 |
| 113 | 3300059424 | Ga0590075_072463 | Ga0590075_072463_506_787 | 82 |
| 114 | 3300001991 | JGI24743J22301_10000547 | JGI24743J22301_100005473 | 83 |
| 115 | 3300004799 | Ga0058863_11956870 | Ga0058863_119568702 | 83 |
| 116 | 3300004800 | Ga0058861_12007962 | Ga0058861_120079622 | 83 |
| 117 | 3300004801 | Ga0058860_10017322 | Ga0058860_100173222 | 83 |
| 118 | 3300004803 | Ga0058862_11228693 | Ga0058862_112286932 | 83 |
| 119 | 3300005289 | Ga0065704_10338145 | Ga0065704_103381452 | 83 |
| 120 | 3300005327 | Ga0070658_10180969 | Ga0070658_101809691 | 83 |
| 121 | 3300005329 | Ga0070683_100190080 | Ga0070683_1001900803 | 83 |
| 122 | 3300005336 | Ga0070680_101671427 | Ga0070680_1016714272 | 83 |
| 123 | 3300005338 | Ga0068868_100918668 | Ga0068868_1009186682 | 83 |
| 124 | 3300005343 | Ga0070687_100258070 | Ga0070687_1002580703 | 83 |
| 125 | 3300005347 | Ga0070668_100218073 | Ga0070668_1002180732 | 83 |
| 126 | 3300005347 | Ga0070668_100266322 | Ga0070668_1002663222 | 83 |
| 127 | 3300005353 | Ga0070669_100277787 | Ga0070669_1002777871 | 83 |
| 128 | 3300005354 | Ga0070675_100070459 | Ga0070675_1000704592 | 83 |
| 129 | 3300005356 | Ga0070674_100322337 | Ga0070674_1003223373 | 83 |
| 130 | 3300005364 | Ga0070673_100811649 | Ga0070673_1008116491 | 83 |
| 131 | 3300005367 | Ga0070667_100157538 | Ga0070667_1001575381 | 83 |
| 132 | 3300005439 | Ga0070711_100648834 | Ga0070711_1006488342 | 83 |
| 133 | 3300005441 | Ga0070700_100257036 | Ga0070700_1002570362 | 83 |
| 134 | 3300005456 | Ga0070678_101710444 | Ga0070678_1017104442 | 83 |
| 135 | 3300005457 | Ga0070662_100540878 | Ga0070662_1005408782 | 83 |
| 136 | 3300005457 | Ga0070662_100620737 | Ga0070662_1006207371 | 83 |
| 137 | 3300005459 | Ga0068867_101171244 | Ga0068867_1011712441 | 83 |
| 138 | 3300005467 | Ga0070706_101859303 | Ga0070706_1018593031 | 83 |
| 139 | 3300005468 | Ga0070707_100000846 | Ga0070707_10000084622 | 83 |
| 140 | 3300005549 | Ga0070704_100783105 | Ga0070704_1007831052 | 83 |
| 141 | 3300005577 | Ga0068857_100672193 | Ga0068857_1006721932 | 83 |
| 142 | 3300005615 | Ga0070702_100238827 | Ga0070702_1002388272 | 83 |
| 143 | 3300005616 | Ga0068852_100395308 | Ga0068852_1003953082 | 83 |
| 144 | 3300005616 | Ga0068852_102327798 | Ga0068852_1023277982 | 83 |
| 145 | 3300005617 | Ga0068859_100020653 | Ga0068859_1000206534 | 83 |
| 146 | 3300005719 | Ga0068861_100908129 | Ga0068861_1009081292 | 83 |
| 147 | 3300005719 | Ga0068861_102227859 | Ga0068861_1022278592 | 83 |
| 148 | 3300005842 | Ga0068858_100530140 | Ga0068858_1005301403 | 83 |
| 149 | 3300005844 | Ga0068862_100046360 | Ga0068862_1000463603 | 83 |
| 150 | 3300005844 | Ga0068862_100727986 | Ga0068862_1007279862 | 83 |
| 151 | 3300006028 | Ga0070717_10394399 | Ga0070717_103943992 | 83 |
| 152 | 3300006358 | Ga0068871_100630718 | Ga0068871_1006307182 | 83 |
| 153 | 3300006880 | Ga0075429_100915621 | Ga0075429_1009156212 | 83 |
| 154 | 3300006914 | Ga0075436_100076736 | Ga0075436_1000767365 | 83 |
| 155 | 3300006931 | Ga0097620_100020652 | Ga0097620_1000206524 | 83 |
| 156 | 3300009011 | Ga0105251_10584041 | Ga0105251_105840411 | 83 |
| 157 | 3300009094 | Ga0111539_10135507 | Ga0111539_101355073 | 83 |
| 158 | 3300009094 | Ga0111539_11823367 | Ga0111539_118233671 | 83 |
| 159 | 3300009101 | Ga0105247_10067681 | Ga0105247_100676811 | 83 |
| 160 | 3300009147 | Ga0114129_10286259 | Ga0114129_102862593 | 83 |
| 161 | 3300009177 | Ga0105248_11249236 | Ga0105248_112492362 | 83 |
| 162 | 3300009551 | Ga0105238_11899325 | Ga0105238_118993251 | 83 |
| 163 | 3300010159 | Ga0099796_10098434 | Ga0099796_100984342 | 83 |
| 164 | 3300010375 | Ga0105239_10480476 | Ga0105239_104804763 | 83 |
| 165 | 3300013306 | Ga0163162_10141339 | Ga0163162_101413392 | 83 |
| 166 | 3300013306 | Ga0163162_11803815 | Ga0163162_118038151 | 83 |
| 167 | 3300013307 | Ga0157372_12051327 | Ga0157372_120513271 | 83 |
| 168 | 3300013308 | Ga0157375_13422600 | Ga0157375_134226002 | 83 |
| 169 | 3300014325 | Ga0163163_10005152 | Ga0163163_100051528 | 83 |
| 170 | 3300014325 | Ga0163163_12706937 | Ga0163163_127069371 | 83 |
| 171 | 3300014745 | Ga0157377_10685333 | Ga0157377_106853332 | 83 |
| 172 | 3300014968 | Ga0157379_10845444 | Ga0157379_108454442 | 83 |
| 173 | 3300014969 | Ga0157376_10860888 | Ga0157376_108608881 | 83 |
| 174 | 3300020069 | Ga0197907_11016605 | Ga0197907_110166052 | 83 |
| 175 | 3300020070 | Ga0206356_10411573 | Ga0206356_104115732 | 83 |
| 176 | 3300020070 | Ga0206356_11814740 | Ga0206356_118147401 | 83 |
| 177 | 3300020075 | Ga0206349_1016521 | Ga0206349_10165211 | 83 |
| 178 | 3300020076 | Ga0206355_1343971 | Ga0206355_13439712 | 83 |
| 179 | 3300020080 | Ga0206350_10040517 | Ga0206350_100405171 | 83 |
| 180 | 3300020080 | Ga0206350_10334234 | Ga0206350_103342342 | 83 |
| 181 | 3300020081 | Ga0206354_10179687 | Ga0206354_101796872 | 83 |
| 182 | 3300020082 | Ga0206353_10516499 | Ga0206353_105164992 | 83 |
| 183 | 3300020610 | Ga0154015_1531012 | Ga0154015_15310122 | 83 |
| 184 | 3300021377 | Ga0213874_10394913 | Ga0213874_103949132 | 83 |
| 185 | 3300022467 | Ga0224712_10133169 | Ga0224712_101331692 | 83 |
| 186 | 3300022467 | Ga0224712_10167677 | Ga0224712_101676772 | 83 |
| 187 | 3300025904 | Ga0207647_10552367 | Ga0207647_105523672 | 83 |
| 188 | 3300025909 | Ga0207705_10023688 | Ga0207705_100236882 | 83 |
| 189 | 3300025909 | Ga0207705_10548592 | Ga0207705_105485922 | 83 |
| 190 | 3300025913 | Ga0207695_10000196 | Ga0207695_10000196138 | 83 |
| 191 | 3300025914 | Ga0207671_10005939 | Ga0207671_100059395 | 83 |
| 192 | 3300025918 | Ga0207662_10207334 | Ga0207662_102073342 | 83 |
| 193 | 3300025919 | Ga0207657_10053672 | Ga0207657_100536723 | 83 |
| 194 | 3300025922 | Ga0207646_10000386 | Ga0207646_1000038616 | 83 |
| 195 | 3300025922 | Ga0207646_11061744 | Ga0207646_110617442 | 83 |
| 196 | 3300025926 | Ga0207659_10240495 | Ga0207659_102404954 | 83 |
| 197 | 3300025933 | Ga0207706_10448097 | Ga0207706_104480973 | 83 |
| 198 | 3300025936 | Ga0207670_10182148 | Ga0207670_101821481 | 83 |
| 199 | 3300025939 | Ga0207665_11669772 | Ga0207665_116697722 | 83 |
| 200 | 3300025949 | Ga0207667_11063758 | Ga0207667_110637582 | 83 |
| 201 | 3300025960 | Ga0207651_11003872 | Ga0207651_110038721 | 83 |
| 202 | 3300025972 | Ga0207668_10217210 | Ga0207668_102172102 | 83 |
| 203 | 3300025981 | Ga0207640_10513086 | Ga0207640_105130862 | 83 |
| 204 | 3300025986 | Ga0207658_12114793 | Ga0207658_121147931 | 83 |
| 205 | 3300026035 | Ga0207703_10023862 | Ga0207703_100238626 | 83 |
| 206 | 3300026035 | Ga0207703_10125715 | Ga0207703_101257152 | 83 |
| 207 | 3300026075 | Ga0207708_10098236 | Ga0207708_100982363 | 83 |
| 208 | 3300026088 | Ga0207641_11032059 | Ga0207641_110320591 | 83 |
| 209 | 3300026116 | Ga0207674_10461648 | Ga0207674_104616482 | 83 |
| 210 | 3300026118 | Ga0207675_100033806 | Ga0207675_1000338065 | 83 |
| 211 | 3300026118 | Ga0207675_100588563 | Ga0207675_1005885631 | 83 |
| 212 | 3300026142 | Ga0207698_12366820 | Ga0207698_123668202 | 83 |
| 213 | 3300027552 | Ga0209982_1057461 | Ga0209982_10574612 | 83 |
| 214 | 3300027907 | Ga0207428_10116024 | Ga0207428_101160243 | 83 |
| 215 | 3300028380 | Ga0268265_10147347 | Ga0268265_101473472 | 83 |
| 216 | 3300028380 | Ga0268265_11417124 | Ga0268265_114171242 | 83 |
| 217 | 3300031507 | Ga0307509_10102591 | Ga0307509_101025914 | 83 |
| 218 | 3300031691 | Ga0316579_10432159 | Ga0316579_104321592 | 83 |
| 219 | 3300031731 | Ga0307405_10191339 | Ga0307405_101913392 | 83 |
| 220 | 3300031733 | Ga0316577_10795785 | Ga0316577_107957852 | 83 |
| 221 | 3300031852 | Ga0307410_10001921 | Ga0307410_100019217 | 83 |
| 222 | 3300031852 | Ga0307410_10111297 | Ga0307410_101112973 | 83 |
| 223 | 3300031903 | Ga0307407_10132612 | Ga0307407_101326122 | 83 |
| 224 | 3300031903 | Ga0307407_10187927 | Ga0307407_101879272 | 83 |
| 225 | 3300031903 | Ga0307407_11176413 | Ga0307407_111764131 | 83 |
| 226 | 3300031903 | Ga0307407_11701144 | Ga0307407_117011442 | 83 |
| 227 | 3300031911 | Ga0307412_10269731 | Ga0307412_102697311 | 83 |
| 228 | 3300031995 | Ga0307409_100020322 | Ga0307409_1000203223 | 83 |
| 229 | 3300031995 | Ga0307409_100103730 | Ga0307409_1001037303 | 83 |
| 230 | 3300031995 | Ga0307409_100125976 | Ga0307409_1001259761 | 83 |
| 231 | 3300031995 | Ga0307409_100207681 | Ga0307409_1002076813 | 83 |
| 232 | 3300032002 | Ga0307416_100001374 | Ga0307416_1000013743 | 83 |
| 233 | 3300032002 | Ga0307416_100045974 | Ga0307416_1000459742 | 83 |
| 234 | 3300032002 | Ga0307416_101394520 | Ga0307416_1013945202 | 83 |
| 235 | 3300032004 | Ga0307414_10019404 | Ga0307414_100194044 | 83 |
| 236 | 3300032004 | Ga0307414_10438174 | Ga0307414_104381742 | 83 |
| 237 | 3300032005 | Ga0307411_10006107 | Ga0307411_100061076 | 83 |
| 238 | 3300032005 | Ga0307411_10033989 | Ga0307411_100339893 | 83 |
| 239 | 3300032126 | Ga0307415_100001757 | Ga0307415_1000017572 | 83 |
| 240 | 3300032126 | Ga0307415_100648482 | Ga0307415_1006484822 | 83 |
| 241 | 3300032168 | Ga0316593_10026401 | Ga0316593_100264015 | 83 |
| 242 | 3300032168 | Ga0316593_10069862 | Ga0316593_100698623 | 83 |
| 243 | 3300032168 | Ga0316593_10076961 | Ga0316593_100769612 | 83 |
| 244 | 3300032168 | Ga0316593_10083586 | Ga0316593_100835863 | 83 |
| 245 | 3300032168 | Ga0316593_10163580 | Ga0316593_101635802 | 83 |
| 246 | 3300032168 | Ga0316593_10225805 | Ga0316593_102258052 | 83 |
| 247 | 3300033180 | Ga0307510_10543758 | Ga0307510_105437582 | 83 |
| 248 | 3300033524 | Ga0316592_1089174 | Ga0316592_10891741 | 83 |
| 249 | 3300033528 | Ga0316588_1126440 | Ga0316588_11264402 | 83 |
| 250 | 3300033541 | Ga0316596_1045813 | Ga0316596_10458132 | 83 |
| 251 | 3300033541 | Ga0316596_1115489 | Ga0316596_11154892 | 83 |
| 252 | 3300036647 | Ga0316582_0132590 | Ga0316582_0132590_440_700 | 83 |
| 253 | 3300036647 | Ga0316582_0967881 | Ga0316582_0967881_217_477 | 83 |
| 254 | 3300037418 | Ga0395900_0279246 | Ga0395900_0279246_686_943 | 83 |
| 255 | 3300039437 | Ga0436365_1720911 | Ga0436365_1720911_93_404 | 83 |
| 256 | 3300039450 | Ga0436363_0116612 | Ga0436363_0116612_156_410 | 83 |
| 257 | 3300039450 | Ga0436363_0184799 | Ga0436363_0184799_79_339 | 83 |
| 258 | 3300039453 | Ga0436362_1143591 | Ga0436362_1143591_60_371 | 83 |
| 259 | 3300041453 | Ga0451797_1027803 | Ga0451797_1027803_807_1076 | 83 |
| 260 | 3300041486 | Ga0451807_1762608 | Ga0451807_1762608_405_674 | 83 |
| 261 | 3300041494 | Ga0451837_1159923 | Ga0451837_1159923_178_447 | 83 |
| 262 | 3300041512 | Ga0451853_1066520 | Ga0451853_1066520_39_308 | 83 |
| 263 | 3300042005 | Ga0439448_0134758 | Ga0439448_0134758_314_571 | 83 |
| 264 | 3300044658 | Ga0466972_0035879 | Ga0466972_0035879_388_660 | 83 |
| 265 | 3300044673 | Ga0453683_0264601 | Ga0453683_0264601_469_738 | 83 |
| 266 | 3300044693 | Ga0466961_0879469 | Ga0466961_0879469_179_451 | 83 |
| 267 | 3300044765 | Ga0466970_0001420 | Ga0466970_0001420_6115_6387 | 83 |
| 268 | 3300045049 | Ga0466959_0963148 | Ga0466959_0963148_119_427 | 83 |
| 269 | 3300045976 | Ga0466967_1248514 | Ga0466967_1248514_385_696 | 83 |
| 270 | 3300046537 | Ga0495598_0124081 | Ga0495598_0124081_113_379 | 83 |
| 271 | 3300048909 | Ga0496106_1563723 | Ga0496106_1563723_111_392 | 83 |
| 272 | 3300048913 | Ga0496110_1800399 | Ga0496110_1800399_214_495 | 83 |
| 273 | 3300048918 | Ga0496115_1267275 | Ga0496115_1267275_55_333 | 83 |
| 274 | 3300048924 | Ga0496121_0216404 | Ga0496121_0216404_191_451 | 83 |
| 275 | 3300049127 | Ga0501306_049350 | Ga0501306_049350_14_319 | 83 |
| 276 | 3300049129 | Ga0501309_045884 | Ga0501309_045884_350_640 | 83 |
| 277 | 3300049130 | Ga0501310_047916 | Ga0501310_047916_14_319 | 83 |
| 278 | 3300049162 | Ga0501307_077559 | Ga0501307_077559_215_520 | 83 |
| 279 | 3300049162 | Ga0501307_091434 | Ga0501307_091434_215_478 | 83 |
| 280 | 3300049528 | Ga0501312_059348 | Ga0501312_059348_17_310 | 83 |
| 281 | 3300049531 | Ga0501315_044570 | Ga0501315_044570_12_326 | 83 |
| 282 | 3300049531 | Ga0501315_048695 | Ga0501315_048695_348_641 | 83 |
| 283 | 3300049537 | Ga0501321_041053 | Ga0501321_041053_324_614 | 83 |
| 284 | 3300049539 | Ga0501323_078751 | Ga0501323_078751_223_519 | 83 |
| 285 | 3300049556 | Ga0501340_010805 | Ga0501340_010805_343_648 | 83 |
| 286 | 3300049571 | Ga0501034_0179279 | Ga0501034_0179279_381_647 | 83 |
| 287 | 3300049581 | Ga0501047_0853437 | Ga0501047_0853437_302_568 | 83 |
| 288 | 3300049586 | Ga0501070_0290447 | Ga0501070_0290447_203_469 | 83 |
| 289 | 3300049674 | Ga0501242_032787 | Ga0501242_032787_28_333 | 83 |
| 290 | 3300049677 | Ga0501247_063684 | Ga0501247_063684_62_358 | 83 |
| 291 | 3300049679 | Ga0501249_087286 | Ga0501249_087286_391_681 | 83 |
| 292 | 3300049742 | Ga0501080_0078938 | Ga0501080_0078938_1937_2191 | 83 |
| 293 | 3300049823 | Ga0501044_0607639 | Ga0501044_0607639_442_708 | 83 |
| 294 | 3300050508 | nmdc:mga09592_1471569_c1 | nmdc:mga09592_1471569_c1_218_484 | 83 |
| 295 | 3300050511 | nmdc:mga08y16_928591_c1 | nmdc:mga08y16_928591_c1_211_492 | 83 |
| 296 | 3300050514 | nmdc:mga08x19_151279_c1 | nmdc:mga08x19_151279_c1_37_291 | 83 |
| 297 | 3300053093 | Ga0500651_0002611 | Ga0500651_0002611_1519_1785 | 83 |
| 298 | 3300053153 | Ga0500616_0015451 | Ga0500616_0015451_477_731 | 83 |
| 299 | 3300053156 | Ga0500622_0172702 | Ga0500622_0172702_488_748 | 83 |
| 300 | 3300059654 | Ga0587110_018926 | Ga0587110_018926_269_535 | 83 |
| 301 | 3300061719 | Ga0466962_0426887 | Ga0466962_0426887_189_500 | 83 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9426 | 20 | 81 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9338 | 20 | 82 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9029 | 18 | 81 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.8963 | 15 | 79 |
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.8866 | 14 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9338 | 20 | 82 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8803 | 20 | 82 | 2.40.50.100 |
| 2ba1A01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8308 | 30 | 83 | 2.40.50.100 |
| af_Q9U0I4_44_103_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8239 | 28 | 83 | 2.40.50.100 |
| af_Q9ZVX0_51_147_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8192 | 8 | 81 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2WZY0-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9432 | 18 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A4Q2WZY0-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9295 | 18 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A351MV09-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.8834 | 13 | 82 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A0G0UDD9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.8819 | 15 | 80 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A351MV09-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.8713 | 13 | 82 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar