F396079
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 203 | 277 | 426 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0000237|Ga0495650_0000237_18096_19475 |
| Length | 459 |
| Sequence | MIEPSLTSPERSLGPGFRRDERKWGLCENRMTDALAYQSGFGNHFSTEAVPGALPVGQNSPQKPPFGLYAEQLSGTAFTAPRHENRRSWLYRLRPSAGHGPYAPYAQDRLKSGPFDAAAPTPNRLRWNPLEVPTEPTDFVDGLVTIGGNGDVATQAGMAAHLYLANRSMVDRVFQNADGELLIVPQQGELHLVTEFGRLDVAPGEIVVIPRGVRFRVEIAGPSRGYVCESYGAAFRLPDLGPIGSNGLANSRDFLAPVAAFEDLERPTEVIQKFQGGLWTGTWDHSPLDVVAWHGNLAPYKYDLARFNTINTVSFDHPDPSIFTVLTAPSEIPGTANVDFVIFPPRWMVAEHTFRPPWFHRNVMSEFMGLVHGAYDAKAGGFSPGGASLHNAMSDHGPDVASHKGATQAELKPHKIDGTMAFMFESRWVIRPTKYALETSALQADYDACWTGFPKARLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 11 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 12 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 13 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 14 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 15 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 16 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 17 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 18 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 19 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 20 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 21 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 22 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 23 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 24 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 30 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 143 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 144 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 184 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 186 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 187 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 188 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 190 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 192 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 193 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 194 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 195 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 196 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 198 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 199 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 202 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 203 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.03 |
| Metatranscriptomes | 0 |
| Isolates | 7.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.28 |
| Nodule | 0 |
| Rhizoplane | 1.33 |
| Rhizosphere | 74.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10032025 | 3300001989 | Bacteria | 1813 |
| 2 | JGI24737J22298_10001394 | 3300001990 | Bacteria | 8581 |
| 3 | JGI24737J22298_10031197 | 3300001990 | Bacteria | 1665 |
| 4 | JGI24743J22301_10007123 | 3300001991 | Bacteria | 1930 |
| 5 | JGI24735J21928_10004863 | 3300002067 | Bacteria | 4480 |
| 6 | JGI24735J21928_10012201 | 3300002067 | Bacteria | 2717 |
| 7 | JGI24738J21930_10009827 | 3300002075 | Bacteria | 2144 |
| 8 | JGI24742J22300_10006099 | 3300002244 | Bacteria | 1988 |
| 9 | JGI25153J46596_10023692 | 3300003215 | Bacteria | 2231 |
| 10 | JGI25153J46596_10027134 | 3300003215 | Bacteria | 2012 |
| 11 | JGI25153J46596_10027359 | 3300003215 | Bacteria | 1999 |
| 12 | Ga0055536_1001430 | 3300003781 | Bacteria | 14396 |
| 13 | Ga0055536_1002563 | 3300003781 | Bacteria | 10140 |
| 14 | Ga0055530_10002385 | 3300003791 | Bacteria | 12178 |
| 15 | Ga0055530_10003953 | 3300003791 | Bacteria | 8016 |
| 16 | Ga0055531_10002101 | 3300003794 | Bacteria | 13686 |
| 17 | Ga0055531_10011261 | 3300003794 | Bacteria | 4339 |
| 18 | Ga0055531_10021566 | 3300003794 | Bacteria | 2492 |
| 19 | Ga0065165_1001046 | 3300005262 | Bacteria | 33350 |
| 20 | Ga0065715_10101376 | 3300005293 | Bacteria | 3212 |
| 21 | Ga0065707_10022177 | 3300005295 | Bacteria | 2433 |
| 22 | Ga0070658_10007119 | 3300005327 | Bacteria | 9030 |
| 23 | Ga0070658_10008508 | 3300005327 | Bacteria | 8250 |
| 24 | Ga0070658_10015987 | 3300005327 | Bacteria | 6003 |
| 25 | Ga0070658_10022356 | 3300005327 | Bacteria | 5073 |
| 26 | Ga0070676_10001978 | 3300005328 | Bacteria | 10413 |
| 27 | Ga0070670_100003136 | 3300005331 | Bacteria | 13672 |
| 28 | Ga0070670_100024917 | 3300005331 | Bacteria | 5147 |
| 29 | Ga0070677_10000802 | 3300005333 | Bacteria | 10440 |
| 30 | Ga0068869_100001291 | 3300005334 | Bacteria | 14827 |
| 31 | Ga0070680_100008084 | 3300005336 | Bacteria | 8031 |
| 32 | Ga0068868_100003545 | 3300005338 | Bacteria | 10880 |
| 33 | Ga0070660_100004523 | 3300005339 | Bacteria | 9611 |
| 34 | Ga0070661_100001045 | 3300005344 | Bacteria | 19570 |
| 35 | Ga0070668_100003514 | 3300005347 | Bacteria | 11553 |
| 36 | Ga0070669_100000194 | 3300005353 | Bacteria | 53799 |
| 37 | Ga0070675_100000491 | 3300005354 | Bacteria | 27031 |
| 38 | Ga0070671_100003500 | 3300005355 | Bacteria | 12262 |
| 39 | Ga0070673_100000003 | 3300005364 | Bacteria | 216759 |
| 40 | Ga0070673_100001863 | 3300005364 | Bacteria | 12603 |
| 41 | Ga0070659_100001175 | 3300005366 | Bacteria | 19097 |
| 42 | Ga0070663_100068186 | 3300005455 | Bacteria | 2582 |
| 43 | Ga0070678_100001853 | 3300005456 | Bacteria | 11401 |
| 44 | Ga0070678_100060463 | 3300005456 | Bacteria | 2789 |
| 45 | Ga0070678_100068300 | 3300005456 | Bacteria | 2649 |
| 46 | Ga0070662_100000100 | 3300005457 | Bacteria | 47285 |
| 47 | Ga0070662_100003069 | 3300005457 | Bacteria | 10368 |
| 48 | Ga0070662_100004016 | 3300005457 | Bacteria | 9228 |
| 49 | Ga0070681_10008378 | 3300005458 | Bacteria | 10127 |
| 50 | Ga0070681_10047545 | 3300005458 | Bacteria | 4289 |
| 51 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 52 | Ga0068867_100019488 | 3300005459 | Bacteria | 4833 |
| 53 | Ga0070679_100010936 | 3300005530 | Bacteria | 8624 |
| 54 | Ga0070679_100010945 | 3300005530 | Bacteria | 8621 |
| 55 | Ga0070679_100082375 | 3300005530 | Bacteria | 3207 |
| 56 | Ga0070679_100090076 | 3300005530 | Bacteria | 3055 |
| 57 | Ga0068853_100005601 | 3300005539 | Bacteria | 9861 |
| 58 | Ga0068853_100169082 | 3300005539 | Bacteria | 1977 |
| 59 | Ga0070672_100032986 | 3300005543 | Bacteria | 3916 |
| 60 | Ga0070672_100068960 | 3300005543 | Bacteria | 2806 |
| 61 | Ga0070704_100204254 | 3300005549 | Bacteria | 1597 |
| 62 | Ga0068855_100119601 | 3300005563 | Bacteria | 3016 |
| 63 | Ga0070664_100011740 | 3300005564 | Bacteria | 7110 |
| 64 | Ga0068857_100037962 | 3300005577 | Bacteria | 4267 |
| 65 | Ga0068857_100266991 | 3300005577 | Bacteria | 1572 |
| 66 | Ga0068856_100017911 | 3300005614 | Bacteria | 6869 |
| 67 | Ga0068856_100029115 | 3300005614 | Bacteria | 5395 |
| 68 | Ga0068859_100010530 | 3300005617 | Bacteria | 9307 |
| 69 | Ga0068859_100158621 | 3300005617 | Bacteria | 2341 |
| 70 | Ga0068861_100045024 | 3300005719 | Bacteria | 3321 |
| 71 | Ga0075369_10010528 | 3300006186 | Bacteria | 3618 |
| 72 | Ga0068865_100000306 | 3300006881 | Bacteria | 27093 |
| 73 | Ga0097620_100010531 | 3300006931 | Bacteria | 9307 |
| 74 | Ga0097620_100158617 | 3300006931 | Bacteria | 2341 |
| 75 | Ga0105245_10000074 | 3300009098 | Bacteria | 103733 |
| 76 | Ga0105245_10002236 | 3300009098 | Bacteria | 17525 |
| 77 | Ga0105243_10000042 | 3300009148 | Bacteria | 159276 |
| 78 | Ga0105238_10148419 | 3300009551 | Bacteria | 2321 |
| 79 | Ga0105249_10005055 | 3300009553 | Bacteria | 11362 |
| 80 | Ga0105148_100545 | 3300009978 | Bacteria | 3238 |
| 81 | Ga0105239_10214644 | 3300010375 | Bacteria | 2157 |
| 82 | Ga0105246_10000491 | 3300011119 | Bacteria | 21441 |
| 83 | Ga0105246_10008547 | 3300011119 | Bacteria | 6297 |
| 84 | Ga0157373_10025071 | 3300013100 | Bacteria | 4317 |
| 85 | Ga0157373_10043725 | 3300013100 | Bacteria | 3199 |
| 86 | Ga0157371_10000519 | 3300013102 | Bacteria | 46108 |
| 87 | Ga0157371_10020987 | 3300013102 | Bacteria | 4802 |
| 88 | Ga0157371_10110047 | 3300013102 | Bacteria | 1956 |
| 89 | Ga0157370_10006529 | 3300013104 | Bacteria | 12845 |
| 90 | Ga0157369_10000446 | 3300013105 | Bacteria | 54687 |
| 91 | Ga0157369_10103977 | 3300013105 | Bacteria | 3025 |
| 92 | Ga0157374_10014130 | 3300013296 | Bacteria | 6979 |
| 93 | Ga0157378_10011556 | 3300013297 | Bacteria | 7731 |
| 94 | Ga0157372_10001430 | 3300013307 | Bacteria | 25787 |
| 95 | Ga0157372_10054586 | 3300013307 | Bacteria | 4458 |
| 96 | Ga0157372_10094385 | 3300013307 | Bacteria | 3406 |
| 97 | Ga0157375_10001871 | 3300013308 | Bacteria | 18131 |
| 98 | Ga0157380_10001238 | 3300014326 | Bacteria | 16566 |
| 99 | Ga0157380_10002116 | 3300014326 | Bacteria | 13314 |
| 100 | Ga0157376_10000072 | 3300014969 | Bacteria | 77631 |
| 101 | Ga0157376_10006256 | 3300014969 | Bacteria | 8395 |
| 102 | Ga0209565_1000118 | 3300025263 | Bacteria | 113196 |
| 103 | Ga0209455_1000772 | 3300025272 | Bacteria | 17958 |
| 104 | Ga0209673_1012955 | 3300025273 | Bacteria | 3320 |
| 105 | Ga0209675_1002824 | 3300025291 | Bacteria | 8660 |
| 106 | Ga0209676_1000128 | 3300025292 | Bacteria | 188099 |
| 107 | Ga0209676_1000151 | 3300025292 | Bacteria | 167307 |
| 108 | Ga0209564_1004400 | 3300025295 | Bacteria | 8636 |
| 109 | Ga0209758_1002847 | 3300025297 | Bacteria | 16797 |
| 110 | Ga0209758_1005117 | 3300025297 | Bacteria | 10364 |
| 111 | Ga0209050_1000817 | 3300025298 | Bacteria | 43485 |
| 112 | Ga0209050_1001306 | 3300025298 | Bacteria | 28018 |
| 113 | Ga0209256_1004048 | 3300025299 | Bacteria | 9537 |
| 114 | Ga0209256_1006244 | 3300025299 | Bacteria | 6412 |
| 115 | Ga0209051_1001480 | 3300025303 | Bacteria | 19758 |
| 116 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 117 | Ga0209257_1006971 | 3300025304 | Bacteria | 7038 |
| 118 | Ga0207697_10004815 | 3300025315 | Bacteria | 6375 |
| 119 | Ga0207682_10001035 | 3300025893 | Bacteria | 12855 |
| 120 | Ga0207647_10000788 | 3300025904 | Bacteria | 24607 |
| 121 | Ga0207647_10001451 | 3300025904 | Bacteria | 18199 |
| 122 | Ga0207645_10000454 | 3300025907 | Bacteria | 34064 |
| 123 | Ga0207645_10001213 | 3300025907 | Bacteria | 21266 |
| 124 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 125 | Ga0207705_10001411 | 3300025909 | Bacteria | 19126 |
| 126 | Ga0207705_10002705 | 3300025909 | Bacteria | 13560 |
| 127 | Ga0207705_10030202 | 3300025909 | Bacteria | 3866 |
| 128 | Ga0207707_10009586 | 3300025912 | Bacteria | 8400 |
| 129 | Ga0207693_10055863 | 3300025915 | Bacteria | 3097 |
| 130 | Ga0207657_10000420 | 3300025919 | Bacteria | 45042 |
| 131 | Ga0207657_10062129 | 3300025919 | Bacteria | 3199 |
| 132 | Ga0207652_10001588 | 3300025921 | Bacteria | 20009 |
| 133 | Ga0207652_10005210 | 3300025921 | Bacteria | 10563 |
| 134 | Ga0207652_10028019 | 3300025921 | Bacteria | 4697 |
| 135 | Ga0207681_10001014 | 3300025923 | Bacteria | 18328 |
| 136 | Ga0207650_10001051 | 3300025925 | Bacteria | 20526 |
| 137 | Ga0207650_10039030 | 3300025925 | Bacteria | 3470 |
| 138 | Ga0207687_10000139 | 3300025927 | Bacteria | 48406 |
| 139 | Ga0207687_10007684 | 3300025927 | Bacteria | 7082 |
| 140 | Ga0207644_10063332 | 3300025931 | Bacteria | 2685 |
| 141 | Ga0207690_10000043 | 3300025932 | Bacteria | 119547 |
| 142 | Ga0207690_10110425 | 3300025932 | Bacteria | 1980 |
| 143 | Ga0207690_10131127 | 3300025932 | Bacteria | 1835 |
| 144 | Ga0207706_10000181 | 3300025933 | Bacteria | 70177 |
| 145 | Ga0207706_10000468 | 3300025933 | Bacteria | 43144 |
| 146 | Ga0207706_10002787 | 3300025933 | Bacteria | 16978 |
| 147 | Ga0207706_10012358 | 3300025933 | Bacteria | 7778 |
| 148 | Ga0207709_10000547 | 3300025935 | Bacteria | 32231 |
| 149 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 150 | Ga0207691_10002938 | 3300025940 | Bacteria | 16634 |
| 151 | Ga0207691_10021769 | 3300025940 | Bacteria | 6051 |
| 152 | Ga0207689_10001948 | 3300025942 | Bacteria | 19544 |
| 153 | Ga0207661_10377861 | 3300025944 | Bacteria | 1282 |
| 154 | Ga0207679_10014653 | 3300025945 | Bacteria | 5160 |
| 155 | Ga0207679_10036618 | 3300025945 | Bacteria | 3481 |
| 156 | Ga0207667_10002321 | 3300025949 | Bacteria | 23823 |
| 157 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 158 | Ga0207651_10004678 | 3300025960 | Bacteria | 6938 |
| 159 | Ga0207712_10009481 | 3300025961 | Bacteria | 6159 |
| 160 | Ga0207639_10000148 | 3300026041 | Bacteria | 52602 |
| 161 | Ga0207678_10042883 | 3300026067 | Bacteria | 3916 |
| 162 | Ga0207678_10071461 | 3300026067 | Bacteria | 2976 |
| 163 | Ga0207708_10034402 | 3300026075 | Bacteria | 3854 |
| 164 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 165 | Ga0207648_10007764 | 3300026089 | Bacteria | 10479 |
| 166 | Ga0207676_10049850 | 3300026095 | Bacteria | 3261 |
| 167 | Ga0207676_10283231 | 3300026095 | Bacteria | 1506 |
| 168 | Ga0207674_10066438 | 3300026116 | Bacteria | 3633 |
| 169 | Ga0207674_10074135 | 3300026116 | Bacteria | 3416 |
| 170 | Ga0207674_10220569 | 3300026116 | Bacteria | 1844 |
| 171 | Ga0207674_10264568 | 3300026116 | Bacteria | 1667 |
| 172 | Ga0207675_100007895 | 3300026118 | Bacteria | 10034 |
| 173 | Ga0207683_10004035 | 3300026121 | Bacteria | 12696 |
| 174 | Ga0207683_10095454 | 3300026121 | Bacteria | 2651 |
| 175 | Ga0209974_10005373 | 3300027876 | Bacteria | 4512 |
| 176 | Ga0268266_10116510 | 3300028379 | Bacteria | 2373 |
| 177 | Ga0268264_10069896 | 3300028381 | Bacteria | 2971 |
| 178 | Ga0307515_10036427 | 3300028794 | Bacteria | 7958 |
| 179 | Ga0307515_10043362 | 3300028794 | Bacteria | 6995 |
| 180 | Ga0307515_10077216 | 3300028794 | Bacteria | 4402 |
| 181 | Ga0265338_10090118 | 3300028800 | Bacteria | 2539 |
| 182 | Ga0265324_10000040 | 3300029957 | Bacteria | 116473 |
| 183 | Ga0307509_10024629 | 3300031507 | Bacteria | 6736 |
| 184 | Ga0265314_10004731 | 3300031711 | Bacteria | 12487 |
| 185 | Ga0395899_0111005 | 3300037312 | Bacteria | 1972 |
| 186 | Ga0395900_0061112 | 3300037418 | Bacteria | 3875 |
| 187 | Ga0395901_0060569 | 3300038443 | Bacteria | 3939 |
| 188 | Ga0436361_0788043 | 3300039447 | Bacteria | 3270 |
| 189 | Ga0439448_0005980 | 3300042005 | Bacteria | 3485 |
| 190 | Ga0439455_0004535 | 3300042012 | Bacteria | 2758 |
| 191 | Ga0439455_0016824 | 3300042012 | Bacteria | 1695 |
| 192 | Ga0466966_0072881 | 3300044684 | Bacteria | 2149 |
| 193 | Ga0466961_0056009 | 3300044693 | Bacteria | 2512 |
| 194 | Ga0466961_0073406 | 3300044693 | Bacteria | 2170 |
| 195 | Ga0466963_0073619 | 3300044694 | Bacteria | 2303 |
| 196 | Ga0466971_0004254 | 3300044719 | Bacteria | 6172 |
| 197 | Ga0466970_0009257 | 3300044765 | Bacteria | 4972 |
| 198 | Ga0466960_0006225 | 3300044901 | Bacteria | 4778 |
| 199 | Ga0466960_0031442 | 3300044901 | Bacteria | 2450 |
| 200 | Ga0466959_0003043 | 3300045049 | Bacteria | 10842 |
| 201 | Ga0466958_0002489 | 3300045836 | Bacteria | 9279 |
| 202 | Ga0466967_0193638 | 3300045976 | Bacteria | 1922 |
| 203 | Ga0495627_001065 | 3300046453 | Bacteria | 18144 |
| 204 | Ga0495590_0002574 | 3300046457 | Bacteria | 7496 |
| 205 | Ga0495638_0000481 | 3300046460 | Bacteria | 47890 |
| 206 | Ga0495638_0000892 | 3300046460 | Bacteria | 30611 |
| 207 | Ga0495638_0001021 | 3300046460 | Bacteria | 27811 |
| 208 | Ga0495638_0005532 | 3300046460 | Bacteria | 9374 |
| 209 | Ga0495638_0020226 | 3300046460 | Bacteria | 4397 |
| 210 | Ga0495638_0116136 | 3300046460 | Bacteria | 1585 |
| 211 | Ga0495650_0000237 | 3300046471 | Bacteria | 110872 |
| 212 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 213 | Ga0495583_0000840 | 3300046506 | Bacteria | 37393 |
| 214 | Ga0495606_0003584 | 3300046507 | Bacteria | 16361 |
| 215 | Ga0495606_0005233 | 3300046507 | Bacteria | 12524 |
| 216 | Ga0495606_0125407 | 3300046507 | Bacteria | 1532 |
| 217 | Ga0495610_0000407 | 3300046512 | Bacteria | 44093 |
| 218 | Ga0495610_0005272 | 3300046512 | Bacteria | 9247 |
| 219 | Ga0495610_0015088 | 3300046512 | Bacteria | 4506 |
| 220 | Ga0495616_0000109 | 3300046513 | Bacteria | 71495 |
| 221 | Ga0495631_0010841 | 3300046518 | Bacteria | 4503 |
| 222 | Ga0495632_0008096 | 3300046519 | Bacteria | 6507 |
| 223 | Ga0495637_0007202 | 3300046520 | Bacteria | 5537 |
| 224 | Ga0495648_0001837 | 3300046524 | Bacteria | 20381 |
| 225 | Ga0495648_0046181 | 3300046524 | Bacteria | 2702 |
| 226 | Ga0495663_0015357 | 3300046525 | Bacteria | 2157 |
| 227 | Ga0495654_0000249 | 3300046530 | Bacteria | 49711 |
| 228 | Ga0495621_0000842 | 3300046539 | Bacteria | 7811 |
| 229 | Ga0495668_0000037 | 3300046616 | Bacteria | 233981 |
| 230 | Ga0495668_0012870 | 3300046616 | Bacteria | 4953 |
| 231 | Ga0495625_0000143 | 3300046660 | Bacteria | 110121 |
| 232 | Ga0495625_0007323 | 3300046660 | Bacteria | 9636 |
| 233 | Ga0495625_0032106 | 3300046660 | Bacteria | 3898 |
| 234 | Ga0495672_0001838 | 3300047320 | Bacteria | 20264 |
| 235 | Ga0495677_0018602 | 3300047445 | Bacteria | 2518 |
| 236 | Ga0495673_0000139 | 3300047469 | Bacteria | 130652 |
| 237 | Ga0495673_0000156 | 3300047469 | Bacteria | 118831 |
| 238 | Ga0495673_0003688 | 3300047469 | Bacteria | 9981 |
| 239 | Ga0495686_0008083 | 3300047472 | Bacteria | 7783 |
| 240 | Ga0495686_0057209 | 3300047472 | Bacteria | 2434 |
| 241 | Ga0496106_0116389 | 3300048909 | Bacteria | 2085 |
| 242 | Ga0496107_0004682 | 3300048910 | Bacteria | 9288 |
| 243 | Ga0496111_0008505 | 3300048914 | Bacteria | 6798 |
| 244 | Ga0496115_0027075 | 3300048918 | Bacteria | 4481 |
| 245 | Ga0496118_0007932 | 3300048921 | Bacteria | 11108 |
| 246 | Ga0496121_0031936 | 3300048924 | Bacteria | 4799 |
| 247 | Ga0496121_0083427 | 3300048924 | Bacteria | 2523 |
| 248 | Ga0496122_0000989 | 3300048925 | Bacteria | 50786 |
| 249 | Ga0496123_0030827 | 3300048926 | Bacteria | 3916 |
| 250 | Ga0496124_0007621 | 3300048927 | Bacteria | 11470 |
| 251 | Ga0496124_0010185 | 3300048927 | Bacteria | 9561 |
| 252 | Ga0495678_003643 | 3300049459 | Bacteria | 9359 |
| 253 | Ga0501223_000029 | 3300049663 | Bacteria | 51244 |
| 254 | Ga0501257_000038 | 3300049686 | Bacteria | 37260 |
| 255 | Ga0501225_0000118 | 3300049705 | Bacteria | 24573 |
| 256 | nmdc:mga0sz30_51653_c1 | 3300050516 | Bacteria | 1744 |
| 257 | Ga0500578_0000023 | 3300053086 | Bacteria | 153470 |
| 258 | Ga0500644_0000174 | 3300053088 | Bacteria | 41140 |
| 259 | Ga0500554_019917 | 3300053102 | Bacteria | 1836 |
| 260 | Ga0500555_001428 | 3300053103 | Bacteria | 7329 |
| 261 | Ga0500556_0001361 | 3300053104 | Bacteria | 10781 |
| 262 | Ga0500593_000146 | 3300053117 | Bacteria | 28072 |
| 263 | Ga0500608_000276 | 3300053122 | Bacteria | 19915 |
| 264 | Ga0500618_000305 | 3300053125 | Bacteria | 36613 |
| 265 | Ga0500658_0001269 | 3300053134 | Bacteria | 10240 |
| 266 | Ga0500658_0006949 | 3300053134 | Bacteria | 4189 |
| 267 | Ga0500559_0000007 | 3300053136 | Bacteria | 226236 |
| 268 | Ga0500559_0000031 | 3300053136 | Bacteria | 114782 |
| 269 | Ga0500559_0001140 | 3300053136 | Bacteria | 16025 |
| 270 | Ga0500559_0004363 | 3300053136 | Bacteria | 6740 |
| 271 | Ga0500559_0005418 | 3300053136 | Bacteria | 5874 |
| 272 | Ga0500564_005036 | 3300053138 | Bacteria | 5363 |
| 273 | Ga0500616_0042387 | 3300053153 | Bacteria | 2437 |
| 274 | Ga0500622_0003664 | 3300053156 | Bacteria | 10092 |
| 275 | Ga0500622_0019208 | 3300053156 | Bacteria | 3630 |
| 276 | Ga0500609_000555 | 3300053731 | Bacteria | 5643 |
| 277 | Ga0466962_0000985 | 3300061719 | Bacteria | 12977 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025944 | Ga0207661_10377861 | Ga0207661_103778611 | 361 |
| 2 | 3300047445 | Ga0495677_0018602 | Ga0495677_0018602_1369_2472 | 365 |
| 3 | 3300001990 | JGI24737J22298_10001394 | JGI24737J22298_1000139412 | 392 |
| 4 | 3300044765 | Ga0466970_0009257 | Ga0466970_0009257_2327_3616 | 396 |
| 5 | 3300003781 | Ga0055536_1001430 | Ga0055536_10014308 | 399 |
| 6 | 3300003791 | Ga0055530_10002385 | Ga0055530_100023858 | 399 |
| 7 | 3300025292 | Ga0209676_1000128 | Ga0209676_100012869 | 399 |
| 8 | 3300025298 | Ga0209050_1000817 | Ga0209050_100081718 | 399 |
| 9 | 3300025303 | Ga0209051_1001480 | Ga0209051_100148013 | 399 |
| 10 | 3300046518 | Ga0495631_0010841 | Ga0495631_0010841_394_1674 | 403 |
| 11 | 3300047472 | Ga0495686_0008083 | Ga0495686_0008083_3069_4349 | 403 |
| 12 | 3300042012 | Ga0439455_0016824 | Ga0439455_0016824_18_1235 | 405 |
| 13 | 3300044901 | Ga0466960_0006225 | Ga0466960_0006225_3340_4629 | 405 |
| 14 | 3300005327 | Ga0070658_10007119 | Ga0070658_100071194 | 407 |
| 15 | 3300005339 | Ga0070660_100004523 | Ga0070660_1000045232 | 407 |
| 16 | 3300005455 | Ga0070663_100068186 | Ga0070663_1000681862 | 407 |
| 17 | 3300005530 | Ga0070679_100082375 | Ga0070679_1000823753 | 407 |
| 18 | 3300025909 | Ga0207705_10030202 | Ga0207705_100302021 | 407 |
| 19 | 3300025919 | Ga0207657_10062129 | Ga0207657_100621292 | 407 |
| 20 | 3300025921 | Ga0207652_10028019 | Ga0207652_100280192 | 407 |
| 21 | 3300026067 | Ga0207678_10071461 | Ga0207678_100714612 | 407 |
| 22 | 3300048924 | Ga0496121_0083427 | Ga0496121_0083427_1274_2497 | 407 |
| 23 | 3300039447 | Ga0436361_0788043 | Ga0436361_0788043_1440_2759 | 408 |
| 24 | 3300005530 | Ga0070679_100010936 | Ga0070679_1000109363 | 410 |
| 25 | 3300025921 | Ga0207652_10001588 | Ga0207652_100015884 | 410 |
| 26 | 3300028794 | Ga0307515_10077216 | Ga0307515_100772163 | 410 |
| 27 | 3300044693 | Ga0466961_0073406 | Ga0466961_0073406_205_1488 | 410 |
| 28 | 3300044694 | Ga0466963_0073619 | Ga0466963_0073619_837_2120 | 410 |
| 29 | 3300044719 | Ga0466971_0004254 | Ga0466971_0004254_4677_5960 | 410 |
| 30 | 3300045836 | Ga0466958_0002489 | Ga0466958_0002489_7784_9067 | 410 |
| 31 | 3300045976 | Ga0466967_0193638 | Ga0466967_0193638_443_1726 | 410 |
| 32 | 3300046512 | Ga0495610_0015088 | Ga0495610_0015088_2963_4243 | 410 |
| 33 | 3300046524 | Ga0495648_0001837 | Ga0495648_0001837_18518_19801 | 410 |
| 34 | 3300049459 | Ga0495678_003643 | Ga0495678_003643_5040_6320 | 410 |
| 35 | 3300053088 | Ga0500644_0000174 | Ga0500644_0000174_6906_8219 | 410 |
| 36 | 3300053138 | Ga0500564_005036 | Ga0500564_005036_936_2249 | 410 |
| 37 | 3300053156 | Ga0500622_0003664 | Ga0500622_0003664_5786_7066 | 410 |
| 38 | 3300061719 | Ga0466962_0000985 | Ga0466962_0000985_114_1397 | 410 |
| 39 | 3300046457 | Ga0495590_0002574 | Ga0495590_0002574_3130_4410 | 411 |
| 40 | 3300046460 | Ga0495638_0000892 | Ga0495638_0000892_16115_17395 | 411 |
| 41 | 3300046519 | Ga0495632_0008096 | Ga0495632_0008096_2462_3745 | 411 |
| 42 | 3300053086 | Ga0500578_0000023 | Ga0500578_0000023_138820_140100 | 411 |
| 43 | 3300053136 | Ga0500559_0005418 | Ga0500559_0005418_681_1961 | 411 |
| 44 | 3300046460 | Ga0495638_0020226 | Ga0495638_0020226_2883_4166 | 412 |
| 45 | 3300046460 | Ga0495638_0005532 | Ga0495638_0005532_2496_3779 | 413 |
| 46 | 3300046513 | Ga0495616_0000109 | Ga0495616_0000109_3343_4626 | 413 |
| 47 | 3300047469 | Ga0495673_0000139 | Ga0495673_0000139_120971_122284 | 413 |
| 48 | 3300053731 | Ga0500609_000555 | Ga0500609_000555_4217_5500 | 413 |
| 49 | 3300046506 | Ga0495583_0000840 | Ga0495583_0000840_14386_15672 | 414 |
| 50 | 3300048921 | Ga0496118_0007932 | Ga0496118_0007932_5319_6563 | 414 |
| 51 | 3300053103 | Ga0500555_001428 | Ga0500555_001428_4172_5545 | 414 |
| 52 | 3300046507 | Ga0495606_0003584 | Ga0495606_0003584_10967_12319 | 416 |
| 53 | 3300028794 | Ga0307515_10043362 | Ga0307515_100433623 | 420 |
| 54 | iso_pu_bacteria | 2791355048 | 2792458810 | 421 |
| 55 | iso_pu_bacteria | 2843744320 | 2843747040 | 421 |
| 56 | iso_pu_bacteria | 2849560528 | 2849565446 | 421 |
| 57 | iso_pu_bacteria | 2849573788 | 2849575398 | 421 |
| 58 | iso_pu_bacteria | 2851153111 | 2851154837 | 421 |
| 59 | iso_pu_bacteria | 2884960567 | 2884960811 | 421 |
| 60 | iso_pu_bacteria | 2898329390 | 2898333088 | 421 |
| 61 | 3300025915 | Ga0207693_10055863 | Ga0207693_100558632 | 422 |
| 62 | iso_pu_bacteria | 2582581279 | 2585147394 | 422 |
| 63 | iso_pu_bacteria | 2857504554 | 2857507499 | 422 |
| 64 | iso_pu_bacteria | 2928531327 | 2928532969 | 422 |
| 65 | 3300003781 | Ga0055536_1002563 | Ga0055536_10025636 | 423 |
| 66 | 3300003791 | Ga0055530_10003953 | Ga0055530_100039535 | 423 |
| 67 | 3300003794 | Ga0055531_10002101 | Ga0055531_100021018 | 423 |
| 68 | 3300025292 | Ga0209676_1000151 | Ga0209676_100015181 | 423 |
| 69 | 3300025298 | Ga0209050_1001306 | Ga0209050_10013068 | 423 |
| 70 | 3300025304 | Ga0209257_1000140 | Ga0209257_1000140194 | 423 |
| 71 | 3300046616 | Ga0495668_0000037 | Ga0495668_0000037_141162_142439 | 423 |
| 72 | 3300050516 | nmdc:mga0sz30_51653_c1 | nmdc:mga0sz30_51653_c1_31_1377 | 423 |
| 73 | iso_pu_bacteria | 2510917020 | 2511121175 | 423 |
| 74 | iso_pu_bacteria | 2643221545 | 2643748010 | 423 |
| 75 | iso_pu_bacteria | 2643221583 | 2643923666 | 423 |
| 76 | iso_pu_bacteria | 2643221691 | 2644508053 | 423 |
| 77 | iso_pu_bacteria | 2818991435 | 2819540405 | 423 |
| 78 | iso_pu_bacteria | 2818991454 | 2819649533 | 423 |
| 79 | 3300005293 | Ga0065715_10101376 | Ga0065715_101013762 | 424 |
| 80 | 3300005327 | Ga0070658_10015987 | Ga0070658_100159876 | 424 |
| 81 | 3300005328 | Ga0070676_10001978 | Ga0070676_100019787 | 424 |
| 82 | 3300005331 | Ga0070670_100003136 | Ga0070670_1000031367 | 424 |
| 83 | 3300005331 | Ga0070670_100024917 | Ga0070670_1000249173 | 424 |
| 84 | 3300005333 | Ga0070677_10000802 | Ga0070677_1000080210 | 424 |
| 85 | 3300005336 | Ga0070680_100008084 | Ga0070680_1000080846 | 424 |
| 86 | 3300005344 | Ga0070661_100001045 | Ga0070661_1000010453 | 424 |
| 87 | 3300005347 | Ga0070668_100003514 | Ga0070668_1000035143 | 424 |
| 88 | 3300005353 | Ga0070669_100000194 | Ga0070669_10000019410 | 424 |
| 89 | 3300005354 | Ga0070675_100000491 | Ga0070675_10000049115 | 424 |
| 90 | 3300005355 | Ga0070671_100003500 | Ga0070671_1000035006 | 424 |
| 91 | 3300005364 | Ga0070673_100001863 | Ga0070673_1000018634 | 424 |
| 92 | 3300005366 | Ga0070659_100001175 | Ga0070659_10000117518 | 424 |
| 93 | 3300005456 | Ga0070678_100001853 | Ga0070678_1000018532 | 424 |
| 94 | 3300005456 | Ga0070678_100060463 | Ga0070678_1000604632 | 424 |
| 95 | 3300005456 | Ga0070678_100068300 | Ga0070678_1000683002 | 424 |
| 96 | 3300005457 | Ga0070662_100000100 | Ga0070662_10000010027 | 424 |
| 97 | 3300005457 | Ga0070662_100003069 | Ga0070662_1000030698 | 424 |
| 98 | 3300005457 | Ga0070662_100004016 | Ga0070662_1000040167 | 424 |
| 99 | 3300005458 | Ga0070681_10047545 | Ga0070681_100475451 | 424 |
| 100 | 3300005459 | Ga0068867_100019488 | Ga0068867_1000194886 | 424 |
| 101 | 3300005530 | Ga0070679_100090076 | Ga0070679_1000900763 | 424 |
| 102 | 3300005539 | Ga0068853_100005601 | Ga0068853_1000056017 | 424 |
| 103 | 3300005543 | Ga0070672_100032986 | Ga0070672_1000329863 | 424 |
| 104 | 3300005543 | Ga0070672_100068960 | Ga0070672_1000689602 | 424 |
| 105 | 3300005549 | Ga0070704_100204254 | Ga0070704_1002042542 | 424 |
| 106 | 3300005563 | Ga0068855_100119601 | Ga0068855_1001196012 | 424 |
| 107 | 3300005564 | Ga0070664_100011740 | Ga0070664_1000117402 | 424 |
| 108 | 3300005577 | Ga0068857_100037962 | Ga0068857_1000379622 | 424 |
| 109 | 3300005617 | Ga0068859_100010530 | Ga0068859_1000105305 | 424 |
| 110 | 3300005719 | Ga0068861_100045024 | Ga0068861_1000450242 | 424 |
| 111 | 3300006186 | Ga0075369_10010528 | Ga0075369_100105282 | 424 |
| 112 | 3300006931 | Ga0097620_100010531 | Ga0097620_1000105315 | 424 |
| 113 | 3300009551 | Ga0105238_10148419 | Ga0105238_101484191 | 424 |
| 114 | 3300009553 | Ga0105249_10005055 | Ga0105249_1000505513 | 424 |
| 115 | 3300011119 | Ga0105246_10000491 | Ga0105246_100004914 | 424 |
| 116 | 3300013100 | Ga0157373_10025071 | Ga0157373_100250712 | 424 |
| 117 | 3300013102 | Ga0157371_10000519 | Ga0157371_1000051925 | 424 |
| 118 | 3300013102 | Ga0157371_10020987 | Ga0157371_100209872 | 424 |
| 119 | 3300013104 | Ga0157370_10006529 | Ga0157370_100065297 | 424 |
| 120 | 3300013105 | Ga0157369_10000446 | Ga0157369_1000044626 | 424 |
| 121 | 3300013307 | Ga0157372_10001430 | Ga0157372_1000143019 | 424 |
| 122 | 3300014326 | Ga0157380_10001238 | Ga0157380_100012385 | 424 |
| 123 | 3300014326 | Ga0157380_10002116 | Ga0157380_100021167 | 424 |
| 124 | 3300025299 | Ga0209256_1004048 | Ga0209256_10040487 | 424 |
| 125 | 3300025315 | Ga0207697_10004815 | Ga0207697_100048156 | 424 |
| 126 | 3300025893 | Ga0207682_10001035 | Ga0207682_100010358 | 424 |
| 127 | 3300025907 | Ga0207645_10001213 | Ga0207645_1000121318 | 424 |
| 128 | 3300025909 | Ga0207705_10001411 | Ga0207705_1000141118 | 424 |
| 129 | 3300025912 | Ga0207707_10009586 | Ga0207707_100095865 | 424 |
| 130 | 3300025919 | Ga0207657_10000420 | Ga0207657_1000042036 | 424 |
| 131 | 3300025921 | Ga0207652_10005210 | Ga0207652_100052107 | 424 |
| 132 | 3300025923 | Ga0207681_10001014 | Ga0207681_100010144 | 424 |
| 133 | 3300025925 | Ga0207650_10001051 | Ga0207650_1000105110 | 424 |
| 134 | 3300025925 | Ga0207650_10039030 | Ga0207650_100390302 | 424 |
| 135 | 3300025932 | Ga0207690_10000043 | Ga0207690_1000004342 | 424 |
| 136 | 3300025933 | Ga0207706_10000181 | Ga0207706_1000018128 | 424 |
| 137 | 3300025933 | Ga0207706_10000468 | Ga0207706_1000046840 | 424 |
| 138 | 3300025933 | Ga0207706_10002787 | Ga0207706_1000278711 | 424 |
| 139 | 3300025933 | Ga0207706_10012358 | Ga0207706_100123583 | 424 |
| 140 | 3300025940 | Ga0207691_10002938 | Ga0207691_100029383 | 424 |
| 141 | 3300025940 | Ga0207691_10021769 | Ga0207691_100217694 | 424 |
| 142 | 3300025945 | Ga0207679_10014653 | Ga0207679_100146535 | 424 |
| 143 | 3300025945 | Ga0207679_10036618 | Ga0207679_100366182 | 424 |
| 144 | 3300025949 | Ga0207667_10002321 | Ga0207667_100023215 | 424 |
| 145 | 3300025960 | Ga0207651_10004678 | Ga0207651_100046786 | 424 |
| 146 | 3300025961 | Ga0207712_10009481 | Ga0207712_100094816 | 424 |
| 147 | 3300026041 | Ga0207639_10000148 | Ga0207639_1000014822 | 424 |
| 148 | 3300026067 | Ga0207678_10042883 | Ga0207678_100428832 | 424 |
| 149 | 3300026075 | Ga0207708_10034402 | Ga0207708_100344023 | 424 |
| 150 | 3300026089 | Ga0207648_10007764 | Ga0207648_1000776410 | 424 |
| 151 | 3300026095 | Ga0207676_10049850 | Ga0207676_100498503 | 424 |
| 152 | 3300026116 | Ga0207674_10066438 | Ga0207674_100664382 | 424 |
| 153 | 3300026116 | Ga0207674_10074135 | Ga0207674_100741354 | 424 |
| 154 | 3300026118 | Ga0207675_100007895 | Ga0207675_1000078957 | 424 |
| 155 | 3300026121 | Ga0207683_10004035 | Ga0207683_1000403513 | 424 |
| 156 | 3300026121 | Ga0207683_10095454 | Ga0207683_100954542 | 424 |
| 157 | 3300028381 | Ga0268264_10069896 | Ga0268264_100698963 | 424 |
| 158 | 3300044901 | Ga0466960_0031442 | Ga0466960_0031442_46_1335 | 424 |
| 159 | 3300046460 | Ga0495638_0000481 | Ga0495638_0000481_27508_28791 | 424 |
| 160 | 3300046460 | Ga0495638_0001021 | Ga0495638_0001021_1045_2325 | 424 |
| 161 | 3300046507 | Ga0495606_0125407 | Ga0495606_0125407_91_1374 | 424 |
| 162 | 3300046539 | Ga0495621_0000842 | Ga0495621_0000842_911_2203 | 424 |
| 163 | 3300046616 | Ga0495668_0012870 | Ga0495668_0012870_3380_4660 | 424 |
| 164 | 3300048927 | Ga0496124_0007621 | Ga0496124_0007621_9261_10550 | 424 |
| 165 | 3300053134 | Ga0500658_0001269 | Ga0500658_0001269_246_1529 | 424 |
| 166 | 3300053136 | Ga0500559_0000007 | Ga0500559_0000007_55963_57243 | 424 |
| 167 | 3300053136 | Ga0500559_0004363 | Ga0500559_0004363_938_2218 | 424 |
| 168 | 3300053156 | Ga0500622_0019208 | Ga0500622_0019208_1713_3002 | 424 |
| 169 | iso_pu_bacteria | 2585428106 | 2587919279 | 424 |
| 170 | iso_pu_bacteria | 2643221640 | 2644225107 | 424 |
| 171 | iso_pu_bacteria | 2643221642 | 2644232415 | 424 |
| 172 | 3300003215 | JGI25153J46596_10023692 | JGI25153J46596_100236922 | 425 |
| 173 | 3300003215 | JGI25153J46596_10027134 | JGI25153J46596_100271341 | 425 |
| 174 | 3300003215 | JGI25153J46596_10027359 | JGI25153J46596_100273591 | 425 |
| 175 | 3300003794 | Ga0055531_10011261 | Ga0055531_100112613 | 425 |
| 176 | 3300003794 | Ga0055531_10021566 | Ga0055531_100215662 | 425 |
| 177 | 3300005262 | Ga0065165_1001046 | Ga0065165_10010463 | 425 |
| 178 | 3300005530 | Ga0070679_100010945 | Ga0070679_1000109454 | 425 |
| 179 | 3300005614 | Ga0068856_100017911 | Ga0068856_1000179113 | 425 |
| 180 | 3300009098 | Ga0105245_10000074 | Ga0105245_1000007490 | 425 |
| 181 | 3300014969 | Ga0157376_10006256 | Ga0157376_100062563 | 425 |
| 182 | 3300025263 | Ga0209565_1000118 | Ga0209565_100011850 | 425 |
| 183 | 3300025273 | Ga0209673_1012955 | Ga0209673_10129552 | 425 |
| 184 | 3300025291 | Ga0209675_1002824 | Ga0209675_10028243 | 425 |
| 185 | 3300025295 | Ga0209564_1004400 | Ga0209564_10044002 | 425 |
| 186 | 3300025297 | Ga0209758_1002847 | Ga0209758_10028473 | 425 |
| 187 | 3300025297 | Ga0209758_1005117 | Ga0209758_10051176 | 425 |
| 188 | 3300025299 | Ga0209256_1006244 | Ga0209256_10062446 | 425 |
| 189 | 3300025304 | Ga0209257_1006971 | Ga0209257_10069716 | 425 |
| 190 | 3300025927 | Ga0207687_10000139 | Ga0207687_1000013925 | 425 |
| 191 | 3300026095 | Ga0207676_10283231 | Ga0207676_102832311 | 425 |
| 192 | 3300026116 | Ga0207674_10220569 | Ga0207674_102205692 | 425 |
| 193 | 3300028794 | Ga0307515_10036427 | Ga0307515_100364273 | 425 |
| 194 | 3300031507 | Ga0307509_10024629 | Ga0307509_100246292 | 425 |
| 195 | 3300046453 | Ga0495627_001065 | Ga0495627_001065_13380_14663 | 425 |
| 196 | 3300046506 | Ga0495583_0000001 | Ga0495583_0000001_725534_726823 | 425 |
| 197 | 3300046507 | Ga0495606_0005233 | Ga0495606_0005233_3512_4795 | 425 |
| 198 | 3300046524 | Ga0495648_0046181 | Ga0495648_0046181_78_1361 | 425 |
| 199 | 3300047320 | Ga0495672_0001838 | Ga0495672_0001838_2754_4037 | 425 |
| 200 | 3300047469 | Ga0495673_0000156 | Ga0495673_0000156_21016_22299 | 425 |
| 201 | 3300047469 | Ga0495673_0003688 | Ga0495673_0003688_2722_4005 | 425 |
| 202 | 3300047472 | Ga0495686_0057209 | Ga0495686_0057209_837_2120 | 425 |
| 203 | 3300048909 | Ga0496106_0116389 | Ga0496106_0116389_779_2065 | 425 |
| 204 | 3300048910 | Ga0496107_0004682 | Ga0496107_0004682_2769_4124 | 425 |
| 205 | 3300048924 | Ga0496121_0031936 | Ga0496121_0031936_3208_4563 | 425 |
| 206 | 3300053102 | Ga0500554_019917 | Ga0500554_019917_214_1497 | 425 |
| 207 | 3300053122 | Ga0500608_000276 | Ga0500608_000276_6765_8057 | 425 |
| 208 | 3300053125 | Ga0500618_000305 | Ga0500618_000305_21736_23019 | 425 |
| 209 | 3300053136 | Ga0500559_0000031 | Ga0500559_0000031_30861_32168 | 425 |
| 210 | iso_pu_bacteria | 2582581280 | 2585155318 | 425 |
| 211 | iso_pu_bacteria | 2582581293 | 2585198881 | 425 |
| 212 | iso_pu_bacteria | 2643221552 | 2643779117 | 425 |
| 213 | iso_pu_bacteria | 2643221584 | 2643927682 | 425 |
| 214 | 3300005458 | Ga0070681_10008378 | Ga0070681_100083782 | 426 |
| 215 | 3300010375 | Ga0105239_10214644 | Ga0105239_102146442 | 426 |
| 216 | 3300029957 | Ga0265324_10000040 | Ga0265324_1000004027 | 426 |
| 217 | 3300031711 | Ga0265314_10004731 | Ga0265314_100047312 | 426 |
| 218 | 3300046460 | Ga0495638_0116136 | Ga0495638_0116136_14_1372 | 426 |
| 219 | 3300046471 | Ga0495650_0000237 | Ga0495650_0000237_18096_19475 | 426 |
| 220 | 3300046512 | Ga0495610_0000407 | Ga0495610_0000407_22782_24140 | 426 |
| 221 | 3300046512 | Ga0495610_0005272 | Ga0495610_0005272_3492_4781 | 426 |
| 222 | 3300046520 | Ga0495637_0007202 | Ga0495637_0007202_3030_4352 | 426 |
| 223 | 3300046525 | Ga0495663_0015357 | Ga0495663_0015357_29_1318 | 426 |
| 224 | 3300046530 | Ga0495654_0000249 | Ga0495654_0000249_31452_32831 | 426 |
| 225 | 3300046660 | Ga0495625_0000143 | Ga0495625_0000143_99773_101062 | 426 |
| 226 | 3300046660 | Ga0495625_0007323 | Ga0495625_0007323_2739_4061 | 426 |
| 227 | 3300046660 | Ga0495625_0032106 | Ga0495625_0032106_413_1792 | 426 |
| 228 | 3300048914 | Ga0496111_0008505 | Ga0496111_0008505_3495_4775 | 426 |
| 229 | 3300048918 | Ga0496115_0027075 | Ga0496115_0027075_2587_3876 | 426 |
| 230 | 3300048925 | Ga0496122_0000989 | Ga0496122_0000989_47385_48665 | 426 |
| 231 | 3300048926 | Ga0496123_0030827 | Ga0496123_0030827_2596_3876 | 426 |
| 232 | 3300048927 | Ga0496124_0010185 | Ga0496124_0010185_3395_4675 | 426 |
| 233 | 3300053104 | Ga0500556_0001361 | Ga0500556_0001361_6972_8294 | 426 |
| 234 | 3300053134 | Ga0500658_0006949 | Ga0500658_0006949_25_1383 | 426 |
| 235 | 3300053136 | Ga0500559_0001140 | Ga0500559_0001140_197_1555 | 426 |
| 236 | 3300053153 | Ga0500616_0042387 | Ga0500616_0042387_1090_2379 | 426 |
| 237 | 3300001990 | JGI24737J22298_10031197 | JGI24737J22298_100311971 | 427 |
| 238 | 3300001991 | JGI24743J22301_10007123 | JGI24743J22301_100071231 | 427 |
| 239 | 3300002067 | JGI24735J21928_10004863 | JGI24735J21928_100048635 | 427 |
| 240 | 3300002067 | JGI24735J21928_10012201 | JGI24735J21928_100122012 | 427 |
| 241 | 3300002075 | JGI24738J21930_10009827 | JGI24738J21930_100098271 | 427 |
| 242 | 3300005295 | Ga0065707_10022177 | Ga0065707_100221771 | 427 |
| 243 | 3300005327 | Ga0070658_10008508 | Ga0070658_100085089 | 427 |
| 244 | 3300005327 | Ga0070658_10022356 | Ga0070658_100223565 | 427 |
| 245 | 3300005334 | Ga0068869_100001291 | Ga0068869_1000012914 | 427 |
| 246 | 3300005338 | Ga0068868_100003545 | Ga0068868_1000035459 | 427 |
| 247 | 3300005364 | Ga0070673_100000003 | Ga0070673_10000000368 | 427 |
| 248 | 3300005459 | Ga0068867_100000001 | Ga0068867_10000000194 | 427 |
| 249 | 3300005539 | Ga0068853_100169082 | Ga0068853_1001690821 | 427 |
| 250 | 3300005577 | Ga0068857_100266991 | Ga0068857_1002669912 | 427 |
| 251 | 3300005614 | Ga0068856_100029115 | Ga0068856_1000291152 | 427 |
| 252 | 3300005617 | Ga0068859_100158621 | Ga0068859_1001586212 | 427 |
| 253 | 3300006881 | Ga0068865_100000306 | Ga0068865_1000003068 | 427 |
| 254 | 3300006931 | Ga0097620_100158617 | Ga0097620_1001586172 | 427 |
| 255 | 3300009098 | Ga0105245_10002236 | Ga0105245_1000223616 | 427 |
| 256 | 3300009148 | Ga0105243_10000042 | Ga0105243_1000004297 | 427 |
| 257 | 3300009978 | Ga0105148_100545 | Ga0105148_1005453 | 427 |
| 258 | 3300011119 | Ga0105246_10008547 | Ga0105246_100085475 | 427 |
| 259 | 3300013100 | Ga0157373_10043725 | Ga0157373_100437252 | 427 |
| 260 | 3300013102 | Ga0157371_10110047 | Ga0157371_101100472 | 427 |
| 261 | 3300013105 | Ga0157369_10103977 | Ga0157369_101039772 | 427 |
| 262 | 3300013296 | Ga0157374_10014130 | Ga0157374_100141304 | 427 |
| 263 | 3300013297 | Ga0157378_10011556 | Ga0157378_100115568 | 427 |
| 264 | 3300013307 | Ga0157372_10054586 | Ga0157372_100545862 | 427 |
| 265 | 3300013307 | Ga0157372_10094385 | Ga0157372_100943853 | 427 |
| 266 | 3300013308 | Ga0157375_10001871 | Ga0157375_100018711 | 427 |
| 267 | 3300014969 | Ga0157376_10000072 | Ga0157376_1000007234 | 427 |
| 268 | 3300025272 | Ga0209455_1000772 | Ga0209455_100077222 | 427 |
| 269 | 3300025904 | Ga0207647_10000788 | Ga0207647_1000078820 | 427 |
| 270 | 3300025904 | Ga0207647_10001451 | Ga0207647_1000145120 | 427 |
| 271 | 3300025907 | Ga0207645_10000454 | Ga0207645_1000045428 | 427 |
| 272 | 3300025909 | Ga0207705_10000027 | Ga0207705_1000002744 | 427 |
| 273 | 3300025909 | Ga0207705_10002705 | Ga0207705_100027055 | 427 |
| 274 | 3300025927 | Ga0207687_10007684 | Ga0207687_100076844 | 427 |
| 275 | 3300025931 | Ga0207644_10063332 | Ga0207644_100633322 | 427 |
| 276 | 3300025932 | Ga0207690_10110425 | Ga0207690_101104251 | 427 |
| 277 | 3300025935 | Ga0207709_10000547 | Ga0207709_1000054721 | 427 |
| 278 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001687 | 427 |
| 279 | 3300025942 | Ga0207689_10001948 | Ga0207689_1000194814 | 427 |
| 280 | 3300025960 | Ga0207651_10000002 | Ga0207651_10000002356 | 427 |
| 281 | 3300026089 | Ga0207648_10000001 | Ga0207648_10000001356 | 427 |
| 282 | 3300026116 | Ga0207674_10264568 | Ga0207674_102645681 | 427 |
| 283 | 3300027876 | Ga0209974_10005373 | Ga0209974_100053733 | 427 |
| 284 | 3300028379 | Ga0268266_10116510 | Ga0268266_101165102 | 427 |
| 285 | 3300028800 | Ga0265338_10090118 | Ga0265338_100901182 | 427 |
| 286 | 3300037312 | Ga0395899_0111005 | Ga0395899_0111005_119_1447 | 427 |
| 287 | 3300037418 | Ga0395900_0061112 | Ga0395900_0061112_591_1874 | 427 |
| 288 | 3300038443 | Ga0395901_0060569 | Ga0395901_0060569_2600_3883 | 427 |
| 289 | 3300042005 | Ga0439448_0005980 | Ga0439448_0005980_1547_2830 | 427 |
| 290 | 3300042012 | Ga0439455_0004535 | Ga0439455_0004535_1315_2598 | 427 |
| 291 | 3300044684 | Ga0466966_0072881 | Ga0466966_0072881_816_2099 | 427 |
| 292 | 3300044693 | Ga0466961_0056009 | Ga0466961_0056009_246_1529 | 427 |
| 293 | 3300045049 | Ga0466959_0003043 | Ga0466959_0003043_7215_8498 | 427 |
| 294 | 3300049663 | Ga0501223_000029 | Ga0501223_000029_11073_12362 | 427 |
| 295 | 3300049686 | Ga0501257_000038 | Ga0501257_000038_11845_13134 | 427 |
| 296 | 3300049705 | Ga0501225_0000118 | Ga0501225_0000118_11460_12749 | 427 |
| 297 | 3300053117 | Ga0500593_000146 | Ga0500593_000146_2145_3443 | 427 |
| 298 | iso_pu_bacteria | 2643221598 | 2644001180 | 427 |
| 299 | 3300001989 | JGI24739J22299_10032025 | JGI24739J22299_100320252 | 429 |
| 300 | 3300002244 | JGI24742J22300_10006099 | JGI24742J22300_100060991 | 429 |
| 301 | 3300025932 | Ga0207690_10131127 | Ga0207690_101311272 | 429 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4aq6-assembly2.cif.gz_K | substrate bound homogentisate 1,2-dioxygenase | 0.9586 | 1 | 429 |
| 4aq2-assembly2.cif.gz_L | resting state of homogentisate 1,2-dioxygenase | 0.9551 | 3 | 429 |
| 4aq2-assembly2.cif.gz_H | resting state of homogentisate 1,2-dioxygenase | 0.9529 | 1 | 429 |
| 4aq2-assembly2.cif.gz_G | resting state of homogentisate 1,2-dioxygenase | 0.952 | 1 | 429 |
| 4aq6-assembly2.cif.gz_K | substrate bound homogentisate 1,2-dioxygenase | 0.9498 | 1 | 429 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9ZRA2_1_273_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9557 | 2 | 261 | 2.60.120.10 |
| af_A0A1D6NXP1_1_243_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9516 | 29 | 261 | 2.60.120.10 |
| af_G3V6C2_268_404_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9128 | 272 | 398 | 2.60.120.10 |
| af_A0A1D6NXP1_1_243_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9098 | 29 | 261 | 2.60.120.10 |
| af_Q9ZRA2_1_273_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9078 | 2 | 261 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K3HLB9-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9883 | 119 | 202 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A1A8QU75-F1-model_v4 | Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Homogentisate oxygenase) (Homogentisic acid oxidase) (Homogentisicase) | 0.9817 | 86 | 191 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A5S3YVJ4-F1-model_v4 | Homogentisate 1,2-dioxygenase (EC 1.13.11.5) | 0.9739 | 95 | 261 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A7K3DF39-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9726 | 1 | 266 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A4Y6CK88-F1-model_v4 | deleted | 0.9719 | 5 | 429 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar