F396079

General Info

Members Datasets Scaffolds Average Seq Length
301 203 277 426

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000237|Ga0495650_0000237_18096_19475
Length 459
Sequence MIEPSLTSPERSLGPGFRRDERKWGLCENRMTDALAYQSGFGNHFSTEAVPGALPVGQNSPQKPPFGLYAEQLSGTAFTAPRHENRRSWLYRLRPSAGHGPYAPYAQDRLKSGPFDAAAPTPNRLRWNPLEVPTEPTDFVDGLVTIGGNGDVATQAGMAAHLYLANRSMVDRVFQNADGELLIVPQQGELHLVTEFGRLDVAPGEIVVIPRGVRFRVEIAGPSRGYVCESYGAAFRLPDLGPIGSNGLANSRDFLAPVAAFEDLERPTEVIQKFQGGLWTGTWDHSPLDVVAWHGNLAPYKYDLARFNTINTVSFDHPDPSIFTVLTAPSEIPGTANVDFVIFPPRWMVAEHTFRPPWFHRNVMSEFMGLVHGAYDAKAGGFSPGGASLHNAMSDHGPDVASHKGATQAELKPHKIDGTMAFMFESRWVIRPTKYALETSALQADYDACWTGFPKARLP

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
15 2818991435 Caulobacter henricii 536 Isolate Unclassified
16 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
17 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
22 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
23 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
24 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
186 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.03
Metatranscriptomes 0
Isolates 7.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.28
Nodule 0
Rhizoplane 1.33
Rhizosphere 74.09
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10032025 3300001989 Bacteria 1813
2 JGI24737J22298_10001394 3300001990 Bacteria 8581
3 JGI24737J22298_10031197 3300001990 Bacteria 1665
4 JGI24743J22301_10007123 3300001991 Bacteria 1930
5 JGI24735J21928_10004863 3300002067 Bacteria 4480
6 JGI24735J21928_10012201 3300002067 Bacteria 2717
7 JGI24738J21930_10009827 3300002075 Bacteria 2144
8 JGI24742J22300_10006099 3300002244 Bacteria 1988
9 JGI25153J46596_10023692 3300003215 Bacteria 2231
10 JGI25153J46596_10027134 3300003215 Bacteria 2012
11 JGI25153J46596_10027359 3300003215 Bacteria 1999
12 Ga0055536_1001430 3300003781 Bacteria 14396
13 Ga0055536_1002563 3300003781 Bacteria 10140
14 Ga0055530_10002385 3300003791 Bacteria 12178
15 Ga0055530_10003953 3300003791 Bacteria 8016
16 Ga0055531_10002101 3300003794 Bacteria 13686
17 Ga0055531_10011261 3300003794 Bacteria 4339
18 Ga0055531_10021566 3300003794 Bacteria 2492
19 Ga0065165_1001046 3300005262 Bacteria 33350
20 Ga0065715_10101376 3300005293 Bacteria 3212
21 Ga0065707_10022177 3300005295 Bacteria 2433
22 Ga0070658_10007119 3300005327 Bacteria 9030
23 Ga0070658_10008508 3300005327 Bacteria 8250
24 Ga0070658_10015987 3300005327 Bacteria 6003
25 Ga0070658_10022356 3300005327 Bacteria 5073
26 Ga0070676_10001978 3300005328 Bacteria 10413
27 Ga0070670_100003136 3300005331 Bacteria 13672
28 Ga0070670_100024917 3300005331 Bacteria 5147
29 Ga0070677_10000802 3300005333 Bacteria 10440
30 Ga0068869_100001291 3300005334 Bacteria 14827
31 Ga0070680_100008084 3300005336 Bacteria 8031
32 Ga0068868_100003545 3300005338 Bacteria 10880
33 Ga0070660_100004523 3300005339 Bacteria 9611
34 Ga0070661_100001045 3300005344 Bacteria 19570
35 Ga0070668_100003514 3300005347 Bacteria 11553
36 Ga0070669_100000194 3300005353 Bacteria 53799
37 Ga0070675_100000491 3300005354 Bacteria 27031
38 Ga0070671_100003500 3300005355 Bacteria 12262
39 Ga0070673_100000003 3300005364 Bacteria 216759
40 Ga0070673_100001863 3300005364 Bacteria 12603
41 Ga0070659_100001175 3300005366 Bacteria 19097
42 Ga0070663_100068186 3300005455 Bacteria 2582
43 Ga0070678_100001853 3300005456 Bacteria 11401
44 Ga0070678_100060463 3300005456 Bacteria 2789
45 Ga0070678_100068300 3300005456 Bacteria 2649
46 Ga0070662_100000100 3300005457 Bacteria 47285
47 Ga0070662_100003069 3300005457 Bacteria 10368
48 Ga0070662_100004016 3300005457 Bacteria 9228
49 Ga0070681_10008378 3300005458 Bacteria 10127
50 Ga0070681_10047545 3300005458 Bacteria 4289
51 Ga0068867_100000001 3300005459 Bacteria 427563
52 Ga0068867_100019488 3300005459 Bacteria 4833
53 Ga0070679_100010936 3300005530 Bacteria 8624
54 Ga0070679_100010945 3300005530 Bacteria 8621
55 Ga0070679_100082375 3300005530 Bacteria 3207
56 Ga0070679_100090076 3300005530 Bacteria 3055
57 Ga0068853_100005601 3300005539 Bacteria 9861
58 Ga0068853_100169082 3300005539 Bacteria 1977
59 Ga0070672_100032986 3300005543 Bacteria 3916
60 Ga0070672_100068960 3300005543 Bacteria 2806
61 Ga0070704_100204254 3300005549 Bacteria 1597
62 Ga0068855_100119601 3300005563 Bacteria 3016
63 Ga0070664_100011740 3300005564 Bacteria 7110
64 Ga0068857_100037962 3300005577 Bacteria 4267
65 Ga0068857_100266991 3300005577 Bacteria 1572
66 Ga0068856_100017911 3300005614 Bacteria 6869
67 Ga0068856_100029115 3300005614 Bacteria 5395
68 Ga0068859_100010530 3300005617 Bacteria 9307
69 Ga0068859_100158621 3300005617 Bacteria 2341
70 Ga0068861_100045024 3300005719 Bacteria 3321
71 Ga0075369_10010528 3300006186 Bacteria 3618
72 Ga0068865_100000306 3300006881 Bacteria 27093
73 Ga0097620_100010531 3300006931 Bacteria 9307
74 Ga0097620_100158617 3300006931 Bacteria 2341
75 Ga0105245_10000074 3300009098 Bacteria 103733
76 Ga0105245_10002236 3300009098 Bacteria 17525
77 Ga0105243_10000042 3300009148 Bacteria 159276
78 Ga0105238_10148419 3300009551 Bacteria 2321
79 Ga0105249_10005055 3300009553 Bacteria 11362
80 Ga0105148_100545 3300009978 Bacteria 3238
81 Ga0105239_10214644 3300010375 Bacteria 2157
82 Ga0105246_10000491 3300011119 Bacteria 21441
83 Ga0105246_10008547 3300011119 Bacteria 6297
84 Ga0157373_10025071 3300013100 Bacteria 4317
85 Ga0157373_10043725 3300013100 Bacteria 3199
86 Ga0157371_10000519 3300013102 Bacteria 46108
87 Ga0157371_10020987 3300013102 Bacteria 4802
88 Ga0157371_10110047 3300013102 Bacteria 1956
89 Ga0157370_10006529 3300013104 Bacteria 12845
90 Ga0157369_10000446 3300013105 Bacteria 54687
91 Ga0157369_10103977 3300013105 Bacteria 3025
92 Ga0157374_10014130 3300013296 Bacteria 6979
93 Ga0157378_10011556 3300013297 Bacteria 7731
94 Ga0157372_10001430 3300013307 Bacteria 25787
95 Ga0157372_10054586 3300013307 Bacteria 4458
96 Ga0157372_10094385 3300013307 Bacteria 3406
97 Ga0157375_10001871 3300013308 Bacteria 18131
98 Ga0157380_10001238 3300014326 Bacteria 16566
99 Ga0157380_10002116 3300014326 Bacteria 13314
100 Ga0157376_10000072 3300014969 Bacteria 77631
101 Ga0157376_10006256 3300014969 Bacteria 8395
102 Ga0209565_1000118 3300025263 Bacteria 113196
103 Ga0209455_1000772 3300025272 Bacteria 17958
104 Ga0209673_1012955 3300025273 Bacteria 3320
105 Ga0209675_1002824 3300025291 Bacteria 8660
106 Ga0209676_1000128 3300025292 Bacteria 188099
107 Ga0209676_1000151 3300025292 Bacteria 167307
108 Ga0209564_1004400 3300025295 Bacteria 8636
109 Ga0209758_1002847 3300025297 Bacteria 16797
110 Ga0209758_1005117 3300025297 Bacteria 10364
111 Ga0209050_1000817 3300025298 Bacteria 43485
112 Ga0209050_1001306 3300025298 Bacteria 28018
113 Ga0209256_1004048 3300025299 Bacteria 9537
114 Ga0209256_1006244 3300025299 Bacteria 6412
115 Ga0209051_1001480 3300025303 Bacteria 19758
116 Ga0209257_1000140 3300025304 Bacteria 201515
117 Ga0209257_1006971 3300025304 Bacteria 7038
118 Ga0207697_10004815 3300025315 Bacteria 6375
119 Ga0207682_10001035 3300025893 Bacteria 12855
120 Ga0207647_10000788 3300025904 Bacteria 24607
121 Ga0207647_10001451 3300025904 Bacteria 18199
122 Ga0207645_10000454 3300025907 Bacteria 34064
123 Ga0207645_10001213 3300025907 Bacteria 21266
124 Ga0207705_10000027 3300025909 Bacteria 248863
125 Ga0207705_10001411 3300025909 Bacteria 19126
126 Ga0207705_10002705 3300025909 Bacteria 13560
127 Ga0207705_10030202 3300025909 Bacteria 3866
128 Ga0207707_10009586 3300025912 Bacteria 8400
129 Ga0207693_10055863 3300025915 Bacteria 3097
130 Ga0207657_10000420 3300025919 Bacteria 45042
131 Ga0207657_10062129 3300025919 Bacteria 3199
132 Ga0207652_10001588 3300025921 Bacteria 20009
133 Ga0207652_10005210 3300025921 Bacteria 10563
134 Ga0207652_10028019 3300025921 Bacteria 4697
135 Ga0207681_10001014 3300025923 Bacteria 18328
136 Ga0207650_10001051 3300025925 Bacteria 20526
137 Ga0207650_10039030 3300025925 Bacteria 3470
138 Ga0207687_10000139 3300025927 Bacteria 48406
139 Ga0207687_10007684 3300025927 Bacteria 7082
140 Ga0207644_10063332 3300025931 Bacteria 2685
141 Ga0207690_10000043 3300025932 Bacteria 119547
142 Ga0207690_10110425 3300025932 Bacteria 1980
143 Ga0207690_10131127 3300025932 Bacteria 1835
144 Ga0207706_10000181 3300025933 Bacteria 70177
145 Ga0207706_10000468 3300025933 Bacteria 43144
146 Ga0207706_10002787 3300025933 Bacteria 16978
147 Ga0207706_10012358 3300025933 Bacteria 7778
148 Ga0207709_10000547 3300025935 Bacteria 32231
149 Ga0207704_10000001 3300025938 Bacteria 716296
150 Ga0207691_10002938 3300025940 Bacteria 16634
151 Ga0207691_10021769 3300025940 Bacteria 6051
152 Ga0207689_10001948 3300025942 Bacteria 19544
153 Ga0207661_10377861 3300025944 Bacteria 1282
154 Ga0207679_10014653 3300025945 Bacteria 5160
155 Ga0207679_10036618 3300025945 Bacteria 3481
156 Ga0207667_10002321 3300025949 Bacteria 23823
157 Ga0207651_10000002 3300025960 Bacteria 427663
158 Ga0207651_10004678 3300025960 Bacteria 6938
159 Ga0207712_10009481 3300025961 Bacteria 6159
160 Ga0207639_10000148 3300026041 Bacteria 52602
161 Ga0207678_10042883 3300026067 Bacteria 3916
162 Ga0207678_10071461 3300026067 Bacteria 2976
163 Ga0207708_10034402 3300026075 Bacteria 3854
164 Ga0207648_10000001 3300026089 Bacteria 427499
165 Ga0207648_10007764 3300026089 Bacteria 10479
166 Ga0207676_10049850 3300026095 Bacteria 3261
167 Ga0207676_10283231 3300026095 Bacteria 1506
168 Ga0207674_10066438 3300026116 Bacteria 3633
169 Ga0207674_10074135 3300026116 Bacteria 3416
170 Ga0207674_10220569 3300026116 Bacteria 1844
171 Ga0207674_10264568 3300026116 Bacteria 1667
172 Ga0207675_100007895 3300026118 Bacteria 10034
173 Ga0207683_10004035 3300026121 Bacteria 12696
174 Ga0207683_10095454 3300026121 Bacteria 2651
175 Ga0209974_10005373 3300027876 Bacteria 4512
176 Ga0268266_10116510 3300028379 Bacteria 2373
177 Ga0268264_10069896 3300028381 Bacteria 2971
178 Ga0307515_10036427 3300028794 Bacteria 7958
179 Ga0307515_10043362 3300028794 Bacteria 6995
180 Ga0307515_10077216 3300028794 Bacteria 4402
181 Ga0265338_10090118 3300028800 Bacteria 2539
182 Ga0265324_10000040 3300029957 Bacteria 116473
183 Ga0307509_10024629 3300031507 Bacteria 6736
184 Ga0265314_10004731 3300031711 Bacteria 12487
185 Ga0395899_0111005 3300037312 Bacteria 1972
186 Ga0395900_0061112 3300037418 Bacteria 3875
187 Ga0395901_0060569 3300038443 Bacteria 3939
188 Ga0436361_0788043 3300039447 Bacteria 3270
189 Ga0439448_0005980 3300042005 Bacteria 3485
190 Ga0439455_0004535 3300042012 Bacteria 2758
191 Ga0439455_0016824 3300042012 Bacteria 1695
192 Ga0466966_0072881 3300044684 Bacteria 2149
193 Ga0466961_0056009 3300044693 Bacteria 2512
194 Ga0466961_0073406 3300044693 Bacteria 2170
195 Ga0466963_0073619 3300044694 Bacteria 2303
196 Ga0466971_0004254 3300044719 Bacteria 6172
197 Ga0466970_0009257 3300044765 Bacteria 4972
198 Ga0466960_0006225 3300044901 Bacteria 4778
199 Ga0466960_0031442 3300044901 Bacteria 2450
200 Ga0466959_0003043 3300045049 Bacteria 10842
201 Ga0466958_0002489 3300045836 Bacteria 9279
202 Ga0466967_0193638 3300045976 Bacteria 1922
203 Ga0495627_001065 3300046453 Bacteria 18144
204 Ga0495590_0002574 3300046457 Bacteria 7496
205 Ga0495638_0000481 3300046460 Bacteria 47890
206 Ga0495638_0000892 3300046460 Bacteria 30611
207 Ga0495638_0001021 3300046460 Bacteria 27811
208 Ga0495638_0005532 3300046460 Bacteria 9374
209 Ga0495638_0020226 3300046460 Bacteria 4397
210 Ga0495638_0116136 3300046460 Bacteria 1585
211 Ga0495650_0000237 3300046471 Bacteria 110872
212 Ga0495583_0000001 3300046506 Bacteria 811973
213 Ga0495583_0000840 3300046506 Bacteria 37393
214 Ga0495606_0003584 3300046507 Bacteria 16361
215 Ga0495606_0005233 3300046507 Bacteria 12524
216 Ga0495606_0125407 3300046507 Bacteria 1532
217 Ga0495610_0000407 3300046512 Bacteria 44093
218 Ga0495610_0005272 3300046512 Bacteria 9247
219 Ga0495610_0015088 3300046512 Bacteria 4506
220 Ga0495616_0000109 3300046513 Bacteria 71495
221 Ga0495631_0010841 3300046518 Bacteria 4503
222 Ga0495632_0008096 3300046519 Bacteria 6507
223 Ga0495637_0007202 3300046520 Bacteria 5537
224 Ga0495648_0001837 3300046524 Bacteria 20381
225 Ga0495648_0046181 3300046524 Bacteria 2702
226 Ga0495663_0015357 3300046525 Bacteria 2157
227 Ga0495654_0000249 3300046530 Bacteria 49711
228 Ga0495621_0000842 3300046539 Bacteria 7811
229 Ga0495668_0000037 3300046616 Bacteria 233981
230 Ga0495668_0012870 3300046616 Bacteria 4953
231 Ga0495625_0000143 3300046660 Bacteria 110121
232 Ga0495625_0007323 3300046660 Bacteria 9636
233 Ga0495625_0032106 3300046660 Bacteria 3898
234 Ga0495672_0001838 3300047320 Bacteria 20264
235 Ga0495677_0018602 3300047445 Bacteria 2518
236 Ga0495673_0000139 3300047469 Bacteria 130652
237 Ga0495673_0000156 3300047469 Bacteria 118831
238 Ga0495673_0003688 3300047469 Bacteria 9981
239 Ga0495686_0008083 3300047472 Bacteria 7783
240 Ga0495686_0057209 3300047472 Bacteria 2434
241 Ga0496106_0116389 3300048909 Bacteria 2085
242 Ga0496107_0004682 3300048910 Bacteria 9288
243 Ga0496111_0008505 3300048914 Bacteria 6798
244 Ga0496115_0027075 3300048918 Bacteria 4481
245 Ga0496118_0007932 3300048921 Bacteria 11108
246 Ga0496121_0031936 3300048924 Bacteria 4799
247 Ga0496121_0083427 3300048924 Bacteria 2523
248 Ga0496122_0000989 3300048925 Bacteria 50786
249 Ga0496123_0030827 3300048926 Bacteria 3916
250 Ga0496124_0007621 3300048927 Bacteria 11470
251 Ga0496124_0010185 3300048927 Bacteria 9561
252 Ga0495678_003643 3300049459 Bacteria 9359
253 Ga0501223_000029 3300049663 Bacteria 51244
254 Ga0501257_000038 3300049686 Bacteria 37260
255 Ga0501225_0000118 3300049705 Bacteria 24573
256 nmdc:mga0sz30_51653_c1 3300050516 Bacteria 1744
257 Ga0500578_0000023 3300053086 Bacteria 153470
258 Ga0500644_0000174 3300053088 Bacteria 41140
259 Ga0500554_019917 3300053102 Bacteria 1836
260 Ga0500555_001428 3300053103 Bacteria 7329
261 Ga0500556_0001361 3300053104 Bacteria 10781
262 Ga0500593_000146 3300053117 Bacteria 28072
263 Ga0500608_000276 3300053122 Bacteria 19915
264 Ga0500618_000305 3300053125 Bacteria 36613
265 Ga0500658_0001269 3300053134 Bacteria 10240
266 Ga0500658_0006949 3300053134 Bacteria 4189
267 Ga0500559_0000007 3300053136 Bacteria 226236
268 Ga0500559_0000031 3300053136 Bacteria 114782
269 Ga0500559_0001140 3300053136 Bacteria 16025
270 Ga0500559_0004363 3300053136 Bacteria 6740
271 Ga0500559_0005418 3300053136 Bacteria 5874
272 Ga0500564_005036 3300053138 Bacteria 5363
273 Ga0500616_0042387 3300053153 Bacteria 2437
274 Ga0500622_0003664 3300053156 Bacteria 10092
275 Ga0500622_0019208 3300053156 Bacteria 3630
276 Ga0500609_000555 3300053731 Bacteria 5643
277 Ga0466962_0000985 3300061719 Bacteria 12977

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10377861 Ga0207661_103778611 361
2 3300047445 Ga0495677_0018602 Ga0495677_0018602_1369_2472 365
3 3300001990 JGI24737J22298_10001394 JGI24737J22298_1000139412 392
4 3300044765 Ga0466970_0009257 Ga0466970_0009257_2327_3616 396
5 3300003781 Ga0055536_1001430 Ga0055536_10014308 399
6 3300003791 Ga0055530_10002385 Ga0055530_100023858 399
7 3300025292 Ga0209676_1000128 Ga0209676_100012869 399
8 3300025298 Ga0209050_1000817 Ga0209050_100081718 399
9 3300025303 Ga0209051_1001480 Ga0209051_100148013 399
10 3300046518 Ga0495631_0010841 Ga0495631_0010841_394_1674 403
11 3300047472 Ga0495686_0008083 Ga0495686_0008083_3069_4349 403
12 3300042012 Ga0439455_0016824 Ga0439455_0016824_18_1235 405
13 3300044901 Ga0466960_0006225 Ga0466960_0006225_3340_4629 405
14 3300005327 Ga0070658_10007119 Ga0070658_100071194 407
15 3300005339 Ga0070660_100004523 Ga0070660_1000045232 407
16 3300005455 Ga0070663_100068186 Ga0070663_1000681862 407
17 3300005530 Ga0070679_100082375 Ga0070679_1000823753 407
18 3300025909 Ga0207705_10030202 Ga0207705_100302021 407
19 3300025919 Ga0207657_10062129 Ga0207657_100621292 407
20 3300025921 Ga0207652_10028019 Ga0207652_100280192 407
21 3300026067 Ga0207678_10071461 Ga0207678_100714612 407
22 3300048924 Ga0496121_0083427 Ga0496121_0083427_1274_2497 407
23 3300039447 Ga0436361_0788043 Ga0436361_0788043_1440_2759 408
24 3300005530 Ga0070679_100010936 Ga0070679_1000109363 410
25 3300025921 Ga0207652_10001588 Ga0207652_100015884 410
26 3300028794 Ga0307515_10077216 Ga0307515_100772163 410
27 3300044693 Ga0466961_0073406 Ga0466961_0073406_205_1488 410
28 3300044694 Ga0466963_0073619 Ga0466963_0073619_837_2120 410
29 3300044719 Ga0466971_0004254 Ga0466971_0004254_4677_5960 410
30 3300045836 Ga0466958_0002489 Ga0466958_0002489_7784_9067 410
31 3300045976 Ga0466967_0193638 Ga0466967_0193638_443_1726 410
32 3300046512 Ga0495610_0015088 Ga0495610_0015088_2963_4243 410
33 3300046524 Ga0495648_0001837 Ga0495648_0001837_18518_19801 410
34 3300049459 Ga0495678_003643 Ga0495678_003643_5040_6320 410
35 3300053088 Ga0500644_0000174 Ga0500644_0000174_6906_8219 410
36 3300053138 Ga0500564_005036 Ga0500564_005036_936_2249 410
37 3300053156 Ga0500622_0003664 Ga0500622_0003664_5786_7066 410
38 3300061719 Ga0466962_0000985 Ga0466962_0000985_114_1397 410
39 3300046457 Ga0495590_0002574 Ga0495590_0002574_3130_4410 411
40 3300046460 Ga0495638_0000892 Ga0495638_0000892_16115_17395 411
41 3300046519 Ga0495632_0008096 Ga0495632_0008096_2462_3745 411
42 3300053086 Ga0500578_0000023 Ga0500578_0000023_138820_140100 411
43 3300053136 Ga0500559_0005418 Ga0500559_0005418_681_1961 411
44 3300046460 Ga0495638_0020226 Ga0495638_0020226_2883_4166 412
45 3300046460 Ga0495638_0005532 Ga0495638_0005532_2496_3779 413
46 3300046513 Ga0495616_0000109 Ga0495616_0000109_3343_4626 413
47 3300047469 Ga0495673_0000139 Ga0495673_0000139_120971_122284 413
48 3300053731 Ga0500609_000555 Ga0500609_000555_4217_5500 413
49 3300046506 Ga0495583_0000840 Ga0495583_0000840_14386_15672 414
50 3300048921 Ga0496118_0007932 Ga0496118_0007932_5319_6563 414
51 3300053103 Ga0500555_001428 Ga0500555_001428_4172_5545 414
52 3300046507 Ga0495606_0003584 Ga0495606_0003584_10967_12319 416
53 3300028794 Ga0307515_10043362 Ga0307515_100433623 420
54 iso_pu_bacteria 2791355048 2792458810 421
55 iso_pu_bacteria 2843744320 2843747040 421
56 iso_pu_bacteria 2849560528 2849565446 421
57 iso_pu_bacteria 2849573788 2849575398 421
58 iso_pu_bacteria 2851153111 2851154837 421
59 iso_pu_bacteria 2884960567 2884960811 421
60 iso_pu_bacteria 2898329390 2898333088 421
61 3300025915 Ga0207693_10055863 Ga0207693_100558632 422
62 iso_pu_bacteria 2582581279 2585147394 422
63 iso_pu_bacteria 2857504554 2857507499 422
64 iso_pu_bacteria 2928531327 2928532969 422
65 3300003781 Ga0055536_1002563 Ga0055536_10025636 423
66 3300003791 Ga0055530_10003953 Ga0055530_100039535 423
67 3300003794 Ga0055531_10002101 Ga0055531_100021018 423
68 3300025292 Ga0209676_1000151 Ga0209676_100015181 423
69 3300025298 Ga0209050_1001306 Ga0209050_10013068 423
70 3300025304 Ga0209257_1000140 Ga0209257_1000140194 423
71 3300046616 Ga0495668_0000037 Ga0495668_0000037_141162_142439 423
72 3300050516 nmdc:mga0sz30_51653_c1 nmdc:mga0sz30_51653_c1_31_1377 423
73 iso_pu_bacteria 2510917020 2511121175 423
74 iso_pu_bacteria 2643221545 2643748010 423
75 iso_pu_bacteria 2643221583 2643923666 423
76 iso_pu_bacteria 2643221691 2644508053 423
77 iso_pu_bacteria 2818991435 2819540405 423
78 iso_pu_bacteria 2818991454 2819649533 423
79 3300005293 Ga0065715_10101376 Ga0065715_101013762 424
80 3300005327 Ga0070658_10015987 Ga0070658_100159876 424
81 3300005328 Ga0070676_10001978 Ga0070676_100019787 424
82 3300005331 Ga0070670_100003136 Ga0070670_1000031367 424
83 3300005331 Ga0070670_100024917 Ga0070670_1000249173 424
84 3300005333 Ga0070677_10000802 Ga0070677_1000080210 424
85 3300005336 Ga0070680_100008084 Ga0070680_1000080846 424
86 3300005344 Ga0070661_100001045 Ga0070661_1000010453 424
87 3300005347 Ga0070668_100003514 Ga0070668_1000035143 424
88 3300005353 Ga0070669_100000194 Ga0070669_10000019410 424
89 3300005354 Ga0070675_100000491 Ga0070675_10000049115 424
90 3300005355 Ga0070671_100003500 Ga0070671_1000035006 424
91 3300005364 Ga0070673_100001863 Ga0070673_1000018634 424
92 3300005366 Ga0070659_100001175 Ga0070659_10000117518 424
93 3300005456 Ga0070678_100001853 Ga0070678_1000018532 424
94 3300005456 Ga0070678_100060463 Ga0070678_1000604632 424
95 3300005456 Ga0070678_100068300 Ga0070678_1000683002 424
96 3300005457 Ga0070662_100000100 Ga0070662_10000010027 424
97 3300005457 Ga0070662_100003069 Ga0070662_1000030698 424
98 3300005457 Ga0070662_100004016 Ga0070662_1000040167 424
99 3300005458 Ga0070681_10047545 Ga0070681_100475451 424
100 3300005459 Ga0068867_100019488 Ga0068867_1000194886 424
101 3300005530 Ga0070679_100090076 Ga0070679_1000900763 424
102 3300005539 Ga0068853_100005601 Ga0068853_1000056017 424
103 3300005543 Ga0070672_100032986 Ga0070672_1000329863 424
104 3300005543 Ga0070672_100068960 Ga0070672_1000689602 424
105 3300005549 Ga0070704_100204254 Ga0070704_1002042542 424
106 3300005563 Ga0068855_100119601 Ga0068855_1001196012 424
107 3300005564 Ga0070664_100011740 Ga0070664_1000117402 424
108 3300005577 Ga0068857_100037962 Ga0068857_1000379622 424
109 3300005617 Ga0068859_100010530 Ga0068859_1000105305 424
110 3300005719 Ga0068861_100045024 Ga0068861_1000450242 424
111 3300006186 Ga0075369_10010528 Ga0075369_100105282 424
112 3300006931 Ga0097620_100010531 Ga0097620_1000105315 424
113 3300009551 Ga0105238_10148419 Ga0105238_101484191 424
114 3300009553 Ga0105249_10005055 Ga0105249_1000505513 424
115 3300011119 Ga0105246_10000491 Ga0105246_100004914 424
116 3300013100 Ga0157373_10025071 Ga0157373_100250712 424
117 3300013102 Ga0157371_10000519 Ga0157371_1000051925 424
118 3300013102 Ga0157371_10020987 Ga0157371_100209872 424
119 3300013104 Ga0157370_10006529 Ga0157370_100065297 424
120 3300013105 Ga0157369_10000446 Ga0157369_1000044626 424
121 3300013307 Ga0157372_10001430 Ga0157372_1000143019 424
122 3300014326 Ga0157380_10001238 Ga0157380_100012385 424
123 3300014326 Ga0157380_10002116 Ga0157380_100021167 424
124 3300025299 Ga0209256_1004048 Ga0209256_10040487 424
125 3300025315 Ga0207697_10004815 Ga0207697_100048156 424
126 3300025893 Ga0207682_10001035 Ga0207682_100010358 424
127 3300025907 Ga0207645_10001213 Ga0207645_1000121318 424
128 3300025909 Ga0207705_10001411 Ga0207705_1000141118 424
129 3300025912 Ga0207707_10009586 Ga0207707_100095865 424
130 3300025919 Ga0207657_10000420 Ga0207657_1000042036 424
131 3300025921 Ga0207652_10005210 Ga0207652_100052107 424
132 3300025923 Ga0207681_10001014 Ga0207681_100010144 424
133 3300025925 Ga0207650_10001051 Ga0207650_1000105110 424
134 3300025925 Ga0207650_10039030 Ga0207650_100390302 424
135 3300025932 Ga0207690_10000043 Ga0207690_1000004342 424
136 3300025933 Ga0207706_10000181 Ga0207706_1000018128 424
137 3300025933 Ga0207706_10000468 Ga0207706_1000046840 424
138 3300025933 Ga0207706_10002787 Ga0207706_1000278711 424
139 3300025933 Ga0207706_10012358 Ga0207706_100123583 424
140 3300025940 Ga0207691_10002938 Ga0207691_100029383 424
141 3300025940 Ga0207691_10021769 Ga0207691_100217694 424
142 3300025945 Ga0207679_10014653 Ga0207679_100146535 424
143 3300025945 Ga0207679_10036618 Ga0207679_100366182 424
144 3300025949 Ga0207667_10002321 Ga0207667_100023215 424
145 3300025960 Ga0207651_10004678 Ga0207651_100046786 424
146 3300025961 Ga0207712_10009481 Ga0207712_100094816 424
147 3300026041 Ga0207639_10000148 Ga0207639_1000014822 424
148 3300026067 Ga0207678_10042883 Ga0207678_100428832 424
149 3300026075 Ga0207708_10034402 Ga0207708_100344023 424
150 3300026089 Ga0207648_10007764 Ga0207648_1000776410 424
151 3300026095 Ga0207676_10049850 Ga0207676_100498503 424
152 3300026116 Ga0207674_10066438 Ga0207674_100664382 424
153 3300026116 Ga0207674_10074135 Ga0207674_100741354 424
154 3300026118 Ga0207675_100007895 Ga0207675_1000078957 424
155 3300026121 Ga0207683_10004035 Ga0207683_1000403513 424
156 3300026121 Ga0207683_10095454 Ga0207683_100954542 424
157 3300028381 Ga0268264_10069896 Ga0268264_100698963 424
158 3300044901 Ga0466960_0031442 Ga0466960_0031442_46_1335 424
159 3300046460 Ga0495638_0000481 Ga0495638_0000481_27508_28791 424
160 3300046460 Ga0495638_0001021 Ga0495638_0001021_1045_2325 424
161 3300046507 Ga0495606_0125407 Ga0495606_0125407_91_1374 424
162 3300046539 Ga0495621_0000842 Ga0495621_0000842_911_2203 424
163 3300046616 Ga0495668_0012870 Ga0495668_0012870_3380_4660 424
164 3300048927 Ga0496124_0007621 Ga0496124_0007621_9261_10550 424
165 3300053134 Ga0500658_0001269 Ga0500658_0001269_246_1529 424
166 3300053136 Ga0500559_0000007 Ga0500559_0000007_55963_57243 424
167 3300053136 Ga0500559_0004363 Ga0500559_0004363_938_2218 424
168 3300053156 Ga0500622_0019208 Ga0500622_0019208_1713_3002 424
169 iso_pu_bacteria 2585428106 2587919279 424
170 iso_pu_bacteria 2643221640 2644225107 424
171 iso_pu_bacteria 2643221642 2644232415 424
172 3300003215 JGI25153J46596_10023692 JGI25153J46596_100236922 425
173 3300003215 JGI25153J46596_10027134 JGI25153J46596_100271341 425
174 3300003215 JGI25153J46596_10027359 JGI25153J46596_100273591 425
175 3300003794 Ga0055531_10011261 Ga0055531_100112613 425
176 3300003794 Ga0055531_10021566 Ga0055531_100215662 425
177 3300005262 Ga0065165_1001046 Ga0065165_10010463 425
178 3300005530 Ga0070679_100010945 Ga0070679_1000109454 425
179 3300005614 Ga0068856_100017911 Ga0068856_1000179113 425
180 3300009098 Ga0105245_10000074 Ga0105245_1000007490 425
181 3300014969 Ga0157376_10006256 Ga0157376_100062563 425
182 3300025263 Ga0209565_1000118 Ga0209565_100011850 425
183 3300025273 Ga0209673_1012955 Ga0209673_10129552 425
184 3300025291 Ga0209675_1002824 Ga0209675_10028243 425
185 3300025295 Ga0209564_1004400 Ga0209564_10044002 425
186 3300025297 Ga0209758_1002847 Ga0209758_10028473 425
187 3300025297 Ga0209758_1005117 Ga0209758_10051176 425
188 3300025299 Ga0209256_1006244 Ga0209256_10062446 425
189 3300025304 Ga0209257_1006971 Ga0209257_10069716 425
190 3300025927 Ga0207687_10000139 Ga0207687_1000013925 425
191 3300026095 Ga0207676_10283231 Ga0207676_102832311 425
192 3300026116 Ga0207674_10220569 Ga0207674_102205692 425
193 3300028794 Ga0307515_10036427 Ga0307515_100364273 425
194 3300031507 Ga0307509_10024629 Ga0307509_100246292 425
195 3300046453 Ga0495627_001065 Ga0495627_001065_13380_14663 425
196 3300046506 Ga0495583_0000001 Ga0495583_0000001_725534_726823 425
197 3300046507 Ga0495606_0005233 Ga0495606_0005233_3512_4795 425
198 3300046524 Ga0495648_0046181 Ga0495648_0046181_78_1361 425
199 3300047320 Ga0495672_0001838 Ga0495672_0001838_2754_4037 425
200 3300047469 Ga0495673_0000156 Ga0495673_0000156_21016_22299 425
201 3300047469 Ga0495673_0003688 Ga0495673_0003688_2722_4005 425
202 3300047472 Ga0495686_0057209 Ga0495686_0057209_837_2120 425
203 3300048909 Ga0496106_0116389 Ga0496106_0116389_779_2065 425
204 3300048910 Ga0496107_0004682 Ga0496107_0004682_2769_4124 425
205 3300048924 Ga0496121_0031936 Ga0496121_0031936_3208_4563 425
206 3300053102 Ga0500554_019917 Ga0500554_019917_214_1497 425
207 3300053122 Ga0500608_000276 Ga0500608_000276_6765_8057 425
208 3300053125 Ga0500618_000305 Ga0500618_000305_21736_23019 425
209 3300053136 Ga0500559_0000031 Ga0500559_0000031_30861_32168 425
210 iso_pu_bacteria 2582581280 2585155318 425
211 iso_pu_bacteria 2582581293 2585198881 425
212 iso_pu_bacteria 2643221552 2643779117 425
213 iso_pu_bacteria 2643221584 2643927682 425
214 3300005458 Ga0070681_10008378 Ga0070681_100083782 426
215 3300010375 Ga0105239_10214644 Ga0105239_102146442 426
216 3300029957 Ga0265324_10000040 Ga0265324_1000004027 426
217 3300031711 Ga0265314_10004731 Ga0265314_100047312 426
218 3300046460 Ga0495638_0116136 Ga0495638_0116136_14_1372 426
219 3300046471 Ga0495650_0000237 Ga0495650_0000237_18096_19475 426
220 3300046512 Ga0495610_0000407 Ga0495610_0000407_22782_24140 426
221 3300046512 Ga0495610_0005272 Ga0495610_0005272_3492_4781 426
222 3300046520 Ga0495637_0007202 Ga0495637_0007202_3030_4352 426
223 3300046525 Ga0495663_0015357 Ga0495663_0015357_29_1318 426
224 3300046530 Ga0495654_0000249 Ga0495654_0000249_31452_32831 426
225 3300046660 Ga0495625_0000143 Ga0495625_0000143_99773_101062 426
226 3300046660 Ga0495625_0007323 Ga0495625_0007323_2739_4061 426
227 3300046660 Ga0495625_0032106 Ga0495625_0032106_413_1792 426
228 3300048914 Ga0496111_0008505 Ga0496111_0008505_3495_4775 426
229 3300048918 Ga0496115_0027075 Ga0496115_0027075_2587_3876 426
230 3300048925 Ga0496122_0000989 Ga0496122_0000989_47385_48665 426
231 3300048926 Ga0496123_0030827 Ga0496123_0030827_2596_3876 426
232 3300048927 Ga0496124_0010185 Ga0496124_0010185_3395_4675 426
233 3300053104 Ga0500556_0001361 Ga0500556_0001361_6972_8294 426
234 3300053134 Ga0500658_0006949 Ga0500658_0006949_25_1383 426
235 3300053136 Ga0500559_0001140 Ga0500559_0001140_197_1555 426
236 3300053153 Ga0500616_0042387 Ga0500616_0042387_1090_2379 426
237 3300001990 JGI24737J22298_10031197 JGI24737J22298_100311971 427
238 3300001991 JGI24743J22301_10007123 JGI24743J22301_100071231 427
239 3300002067 JGI24735J21928_10004863 JGI24735J21928_100048635 427
240 3300002067 JGI24735J21928_10012201 JGI24735J21928_100122012 427
241 3300002075 JGI24738J21930_10009827 JGI24738J21930_100098271 427
242 3300005295 Ga0065707_10022177 Ga0065707_100221771 427
243 3300005327 Ga0070658_10008508 Ga0070658_100085089 427
244 3300005327 Ga0070658_10022356 Ga0070658_100223565 427
245 3300005334 Ga0068869_100001291 Ga0068869_1000012914 427
246 3300005338 Ga0068868_100003545 Ga0068868_1000035459 427
247 3300005364 Ga0070673_100000003 Ga0070673_10000000368 427
248 3300005459 Ga0068867_100000001 Ga0068867_10000000194 427
249 3300005539 Ga0068853_100169082 Ga0068853_1001690821 427
250 3300005577 Ga0068857_100266991 Ga0068857_1002669912 427
251 3300005614 Ga0068856_100029115 Ga0068856_1000291152 427
252 3300005617 Ga0068859_100158621 Ga0068859_1001586212 427
253 3300006881 Ga0068865_100000306 Ga0068865_1000003068 427
254 3300006931 Ga0097620_100158617 Ga0097620_1001586172 427
255 3300009098 Ga0105245_10002236 Ga0105245_1000223616 427
256 3300009148 Ga0105243_10000042 Ga0105243_1000004297 427
257 3300009978 Ga0105148_100545 Ga0105148_1005453 427
258 3300011119 Ga0105246_10008547 Ga0105246_100085475 427
259 3300013100 Ga0157373_10043725 Ga0157373_100437252 427
260 3300013102 Ga0157371_10110047 Ga0157371_101100472 427
261 3300013105 Ga0157369_10103977 Ga0157369_101039772 427
262 3300013296 Ga0157374_10014130 Ga0157374_100141304 427
263 3300013297 Ga0157378_10011556 Ga0157378_100115568 427
264 3300013307 Ga0157372_10054586 Ga0157372_100545862 427
265 3300013307 Ga0157372_10094385 Ga0157372_100943853 427
266 3300013308 Ga0157375_10001871 Ga0157375_100018711 427
267 3300014969 Ga0157376_10000072 Ga0157376_1000007234 427
268 3300025272 Ga0209455_1000772 Ga0209455_100077222 427
269 3300025904 Ga0207647_10000788 Ga0207647_1000078820 427
270 3300025904 Ga0207647_10001451 Ga0207647_1000145120 427
271 3300025907 Ga0207645_10000454 Ga0207645_1000045428 427
272 3300025909 Ga0207705_10000027 Ga0207705_1000002744 427
273 3300025909 Ga0207705_10002705 Ga0207705_100027055 427
274 3300025927 Ga0207687_10007684 Ga0207687_100076844 427
275 3300025931 Ga0207644_10063332 Ga0207644_100633322 427
276 3300025932 Ga0207690_10110425 Ga0207690_101104251 427
277 3300025935 Ga0207709_10000547 Ga0207709_1000054721 427
278 3300025938 Ga0207704_10000001 Ga0207704_10000001687 427
279 3300025942 Ga0207689_10001948 Ga0207689_1000194814 427
280 3300025960 Ga0207651_10000002 Ga0207651_10000002356 427
281 3300026089 Ga0207648_10000001 Ga0207648_10000001356 427
282 3300026116 Ga0207674_10264568 Ga0207674_102645681 427
283 3300027876 Ga0209974_10005373 Ga0209974_100053733 427
284 3300028379 Ga0268266_10116510 Ga0268266_101165102 427
285 3300028800 Ga0265338_10090118 Ga0265338_100901182 427
286 3300037312 Ga0395899_0111005 Ga0395899_0111005_119_1447 427
287 3300037418 Ga0395900_0061112 Ga0395900_0061112_591_1874 427
288 3300038443 Ga0395901_0060569 Ga0395901_0060569_2600_3883 427
289 3300042005 Ga0439448_0005980 Ga0439448_0005980_1547_2830 427
290 3300042012 Ga0439455_0004535 Ga0439455_0004535_1315_2598 427
291 3300044684 Ga0466966_0072881 Ga0466966_0072881_816_2099 427
292 3300044693 Ga0466961_0056009 Ga0466961_0056009_246_1529 427
293 3300045049 Ga0466959_0003043 Ga0466959_0003043_7215_8498 427
294 3300049663 Ga0501223_000029 Ga0501223_000029_11073_12362 427
295 3300049686 Ga0501257_000038 Ga0501257_000038_11845_13134 427
296 3300049705 Ga0501225_0000118 Ga0501225_0000118_11460_12749 427
297 3300053117 Ga0500593_000146 Ga0500593_000146_2145_3443 427
298 iso_pu_bacteria 2643221598 2644001180 427
299 3300001989 JGI24739J22299_10032025 JGI24739J22299_100320252 429
300 3300002244 JGI24742J22300_10006099 JGI24742J22300_100060991 429
301 3300025932 Ga0207690_10131127 Ga0207690_101311272 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04209

HgmA_C

Homogentisate 1,2-dioxygenase C-terminal

305

457

0.99

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

36

304

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.9586 1 429
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.9551 3 429
4aq2-assembly2.cif.gz_H resting state of homogentisate 1,2-dioxygenase 0.9529 1 429
4aq2-assembly2.cif.gz_G resting state of homogentisate 1,2-dioxygenase 0.952 1 429
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.9498 1 429
ID Description Score Start End Superfamily
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9557 2 261 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9516 29 261 2.60.120.10
af_G3V6C2_268_404_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9128 272 398 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9098 29 261 2.60.120.10
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9078 2 261 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7K3HLB9-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9883 119 202 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A1A8QU75-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Homogentisate oxygenase) (Homogentisic acid oxidase) (Homogentisicase) 0.9817 86 191 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A5S3YVJ4-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) 0.9739 95 261 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A7K3DF39-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9726 1 266 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A4Y6CK88-F1-model_v4 deleted 0.9719 5 429

Feature Viewer

pLDDT pTM Quality
89.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map