F395730

General Info

Members Datasets Scaffolds Average Seq Length
301 206 602 139

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100056854|Ga0070661_1000568544
Length 158
Sequence MRGGWRSRRPSLIASSMAAIGEPGFEAIAVGSVSSPLTDLAAAPKQGDEGAPEATIVFADGFVAALEGIAAGDAVLVLTWLDRADRDVLHVHPRGDESRPETGVFATRSPDRPNPIGLHRVEVVAIEGATMTVRDLEAVDGTPVLDVKPVLGSAVGER

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
199 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
200 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
201 2858868258 Micromonospora sp. MH33 Isolate Unclassified
202 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
203 2902582711 Micromonospora sp. AP08 Isolate Unclassified
204 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
205 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
206 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0.33
Rhizoplane 4.32
Rhizosphere 87.38
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100056854 3300005344 Bacteria 2866
2 JGI24740J21852_10011685 3300001979 Bacteria 3336
3 JGI24744J21845_10073036 3300002077 Bacteria 626
4 JGI25407J50210_10031963 3300003373 Bacteria 1361
5 Ga0070658_10057766 3300005327 Bacteria 3157
6 Ga0070683_100016131 3300005329 Bacteria 6577
7 Ga0070683_100200822 3300005329 Bacteria 1893
8 Ga0070680_100488901 3300005336 Bacteria 1052
9 Ga0070682_100061957 3300005337 Bacteria 2369
10 Ga0070682_100249252 3300005337 Bacteria 1279
11 Ga0068868_100226932 3300005338 Bacteria 1565
12 Ga0068868_100385405 3300005338 Bacteria 1207
13 Ga0070660_100061385 3300005339 Bacteria 2918
14 Ga0070689_100769104 3300005340 Bacteria 845
15 Ga0070691_10101553 3300005341 Bacteria 1429
16 Ga0070691_10175752 3300005341 Bacteria 1112
17 Ga0070692_10000238 3300005345 Bacteria 15103
18 Ga0070692_10344725 3300005345 Unclassified 924
19 Ga0070668_100029246 3300005347 Bacteria 4184
20 Ga0070668_100444528 3300005347 Bacteria 1113
21 Ga0070668_101082250 3300005347 Bacteria 723
22 Ga0070675_100002960 3300005354 Bacteria 12818
23 Ga0070674_100139663 3300005356 Bacteria 1817
24 Ga0070674_100451991 3300005356 Bacteria 1061
25 Ga0070659_100031926 3300005366 Bacteria 4082
26 Ga0070701_10210468 3300005438 Bacteria 1154
27 Ga0070700_100031895 3300005441 Bacteria 3162
28 Ga0070700_100646618 3300005441 Bacteria 834
29 Ga0070663_100004469 3300005455 Bacteria 8233
30 Ga0070663_100825865 3300005455 Bacteria 796
31 Ga0070681_10284306 3300005458 Bacteria 1565
32 Ga0068867_100187333 3300005459 Bacteria 1649
33 Ga0070685_10106105 3300005466 Bacteria 1723
34 Ga0070699_101675973 3300005518 Bacteria 582
35 Ga0070684_100007375 3300005535 Bacteria 8550
36 Ga0070684_100190327 3300005535 Bacteria 1867
37 Ga0070684_100244372 3300005535 Bacteria 1640
38 Ga0070684_100654887 3300005535 Bacteria 978
39 Ga0070684_100966605 3300005535 Bacteria 799
40 Ga0070672_100002036 3300005543 Bacteria 12721
41 Ga0070672_100505535 3300005543 Bacteria 1046
42 Ga0070686_100065865 3300005544 Bacteria 2354
43 Ga0070695_100176500 3300005545 Bacteria 1511
44 Ga0070695_101623387 3300005545 Bacteria 540
45 Ga0070693_100170774 3300005547 Bacteria 1392
46 Ga0070665_100045764 3300005548 Bacteria 4394
47 Ga0070664_100009172 3300005564 Bacteria 8031
48 Ga0070664_101401555 3300005564 Bacteria 661
49 Ga0068857_100174730 3300005577 Bacteria 1953
50 Ga0068854_100097536 3300005578 Bacteria 2198
51 Ga0068854_101749614 3300005578 Bacteria 569
52 Ga0068856_100137148 3300005614 Bacteria 2452
53 Ga0070702_100072767 3300005615 Bacteria 2034
54 Ga0068852_100044850 3300005616 Bacteria 3759
55 Ga0068859_100895398 3300005617 Bacteria 972
56 Ga0068866_10492771 3300005718 Bacteria 809
57 Ga0068861_100172012 3300005719 Unclassified 1796
58 Ga0068861_100362429 3300005719 Bacteria 1275
59 Ga0068861_100515411 3300005719 Bacteria 1084
60 Ga0068851_10059579 3300005834 Bacteria 1953
61 Ga0068870_10188784 3300005840 Bacteria 1242
62 Ga0068870_10210284 3300005840 Bacteria 1185
63 Ga0068858_100062603 3300005842 Bacteria 3441
64 Ga0068862_100118913 3300005844 Bacteria 2327
65 Ga0081538_10000329 3300005981 Bacteria 54226
66 Ga0081540_1019676 3300005983 Bacteria 4091
67 Ga0081539_10007871 3300005985 Bacteria 9510
68 Ga0075365_10013327 3300006038 Bacteria 4911
69 Ga0075365_10907821 3300006038 Bacteria 621
70 Ga0075363_100017993 3300006048 Bacteria 3513
71 Ga0075363_100052319 3300006048 Bacteria 2179
72 Ga0075363_100169837 3300006048 Bacteria 1238
73 Ga0075364_10153596 3300006051 Bacteria 1552
74 Ga0075364_10164494 3300006051 Bacteria 1498
75 Ga0075364_10520629 3300006051 Bacteria 813
76 Ga0075367_10103545 3300006178 Bacteria 1742
77 Ga0075428_100041029 3300006844 Bacteria 5090
78 Ga0075430_100397354 3300006846 Bacteria 1138
79 Ga0075431_100327983 3300006847 Bacteria 1542
80 Ga0075433_10562699 3300006852 Bacteria 1002
81 Ga0075429_100253090 3300006880 Bacteria 1542
82 Ga0097620_100895367 3300006931 Bacteria 972
83 Ga0111539_10360721 3300009094 Bacteria 1691
84 Ga0105245_10019200 3300009098 Bacteria 5986
85 Ga0105245_10445343 3300009098 Bacteria 1303
86 Ga0114129_10003801 3300009147 Bacteria 21276
87 Ga0105243_10007183 3300009148 Bacteria 8559
88 Ga0105243_10134084 3300009148 Bacteria 2105
89 Ga0105242_10022501 3300009176 Bacteria 4958
90 Ga0105238_10151656 3300009551 Bacteria 2293
91 Ga0105249_10108650 3300009553 Bacteria 2619
92 Ga0105249_10580191 3300009553 Bacteria 1174
93 Ga0105239_10012430 3300010375 Bacteria 9481
94 Ga0105246_10185942 3300011119 Bacteria 1604
95 Ga0105246_10315145 3300011119 Bacteria 1269
96 Ga0157371_10300538 3300013102 Bacteria 1162
97 Ga0157369_11584405 3300013105 Bacteria 666
98 Ga0157374_10666094 3300013296 Bacteria 1053
99 Ga0157378_10095049 3300013297 Bacteria 2714
100 Ga0163162_10690211 3300013306 Bacteria 1143
101 Ga0157372_10101657 3300013307 Bacteria 3282
102 Ga0157375_10173827 3300013308 Bacteria 2302
103 Ga0157380_10010979 3300014326 Bacteria 6532
104 Ga0157380_10025510 3300014326 Bacteria 4482
105 Ga0157380_10492526 3300014326 Bacteria 1188
106 Ga0157377_10002007 3300014745 Bacteria 8916
107 Ga0157377_10042398 3300014745 Bacteria 2527
108 Ga0157377_10324899 3300014745 Bacteria 1023
109 Ga0157377_10412719 3300014745 Bacteria 922
110 Ga0157379_10187138 3300014968 Bacteria 1871
111 Ga0207656_10666674 3300025321 Bacteria 532
112 Ga0207642_10090508 3300025899 Bacteria 1510
113 Ga0207642_11078063 3300025899 Bacteria 519
114 Ga0207688_10003648 3300025901 Bacteria 8409
115 Ga0207645_10335025 3300025907 Bacteria 1011
116 Ga0207645_10842405 3300025907 Bacteria 623
117 Ga0207643_10057537 3300025908 Bacteria 2214
118 Ga0207705_10044211 3300025909 Bacteria 3201
119 Ga0207684_10223247 3300025910 Bacteria 1626
120 Ga0207660_10231582 3300025917 Bacteria 1453
121 Ga0207657_10010919 3300025919 Bacteria 9037
122 Ga0207649_10283498 3300025920 Bacteria 1205
123 Ga0207652_10168353 3300025921 Bacteria 1966
124 Ga0207681_10710673 3300025923 Bacteria 836
125 Ga0207650_10188727 3300025925 Bacteria 1646
126 Ga0207659_10006155 3300025926 Bacteria 7336
127 Ga0207687_10587357 3300025927 Bacteria 938
128 Ga0207700_10097149 3300025928 Bacteria 2341
129 Ga0207690_10078792 3300025932 Bacteria 2294
130 Ga0207690_10310112 3300025932 Bacteria 1237
131 Ga0207690_10434945 3300025932 Bacteria 1052
132 Ga0207706_10029004 3300025933 Bacteria 4940
133 Ga0207669_10093772 3300025937 Bacteria 1963
134 Ga0207669_10471937 3300025937 Bacteria 998
135 Ga0207704_10252221 3300025938 Bacteria 1325
136 Ga0207704_11497174 3300025938 Bacteria 579
137 Ga0207691_10064755 3300025940 Bacteria 3311
138 Ga0207661_10017215 3300025944 Bacteria 5345
139 Ga0207661_10551216 3300025944 Bacteria 1056
140 Ga0207661_11517137 3300025944 Bacteria 614
141 Ga0207679_10152975 3300025945 Bacteria 1880
142 Ga0207679_10271116 3300025945 Bacteria 1451
143 Ga0207679_10817862 3300025945 Bacteria 850
144 Ga0207651_10047601 3300025960 Bacteria 2893
145 Ga0207712_10009968 3300025961 Bacteria 6021
146 Ga0207668_10000643 3300025972 Bacteria 21516
147 Ga0207668_10010122 3300025972 Bacteria 5685
148 Ga0207668_10632543 3300025972 Bacteria 935
149 Ga0207640_10420080 3300025981 Bacteria 1094
150 Ga0207640_10676636 3300025981 Bacteria 882
151 Ga0207640_11179317 3300025981 Bacteria 680
152 Ga0207677_10032040 3300026023 Bacteria 3375
153 Ga0207703_10060064 3300026035 Bacteria 3107
154 Ga0207678_10010127 3300026067 Bacteria 8273
155 Ga0207678_10577288 3300026067 Bacteria 985
156 Ga0207708_10004291 3300026075 Bacteria 10493
157 Ga0207708_10020962 3300026075 Bacteria 4931
158 Ga0207648_10035385 3300026089 Bacteria 4399
159 Ga0207648_10204151 3300026089 Bacteria 1754
160 Ga0207674_10368339 3300026116 Bacteria 1389
161 Ga0207674_10961914 3300026116 Bacteria 823
162 Ga0207675_100107689 3300026118 Bacteria 2628
163 Ga0207675_100189028 3300026118 Bacteria 1975
164 Ga0207675_100224886 3300026118 Unclassified 1809
165 Ga0207698_10008971 3300026142 Bacteria 6346
166 Ga0268266_10231941 3300028379 Bacteria 1700
167 Ga0268265_10146856 3300028380 Bacteria 1983
168 Ga0268265_11257091 3300028380 Bacteria 739
169 Ga0307405_10100840 3300031731 Bacteria 1936
170 Ga0307413_10784528 3300031824 Bacteria 799
171 Ga0307413_10799925 3300031824 Bacteria 792
172 Ga0307410_10126459 3300031852 Bacteria 1872
173 Ga0307410_10958446 3300031852 Bacteria 736
174 Ga0307410_11627410 3300031852 Bacteria 571
175 Ga0307407_10140866 3300031903 Bacteria 1556
176 Ga0307412_10261264 3300031911 Bacteria 1350
177 Ga0307412_10524004 3300031911 Unclassified 991
178 Ga0307409_100116306 3300031995 Bacteria 2254
179 Ga0307409_100328130 3300031995 Bacteria 1435
180 Ga0307409_100391140 3300031995 Bacteria 1325
181 Ga0307409_101447242 3300031995 Bacteria 714
182 Ga0307416_100082186 3300032002 Bacteria 2728
183 Ga0307416_100643774 3300032002 Bacteria 1144
184 Ga0307416_100738262 3300032002 Bacteria 1076
185 Ga0307416_100940581 3300032002 Bacteria 966
186 Ga0307416_100996519 3300032002 Unclassified 941
187 Ga0307416_101207827 3300032002 Bacteria 862
188 Ga0307416_103154815 3300032002 Bacteria 551
189 Ga0307414_12134241 3300032004 Bacteria 523
190 Ga0307411_10806628 3300032005 Bacteria 827
191 Ga0307415_100077891 3300032126 Bacteria 2356
192 Ga0307415_101690299 3300032126 Bacteria 610
193 Ga0307415_101816635 3300032126 Bacteria 590
194 Ga0395901_1369909 3300038443 Unclassified 667
195 Ga0451853_0164447 3300041512 Bacteria 1653
196 Ga0451853_0636701 3300041512 Bacteria 586
197 Ga0439448_0101517 3300042005 Bacteria 978
198 Ga0439454_000429 3300042011 Bacteria 3325
199 Ga0439455_0096697 3300042012 Bacteria 813
200 Ga0450917_019126 3300042120 Bacteria 601
201 Ga0450923_082781 3300042125 Unclassified 724
202 Ga0450900_015326 3300042136 Bacteria 1030
203 Ga0450916_021263 3300042530 Bacteria 892
204 Ga0439440_0053868 3300042993 Bacteria 1012
205 Ga0466972_0057324 3300044658 Bacteria 1871
206 Ga0466965_0650372 3300044683 Bacteria 602
207 Ga0466961_0360230 3300044693 Bacteria 885
208 Ga0466961_0391732 3300044693 Unclassified 843
209 Ga0466957_0070636 3300044842 Bacteria 2158
210 Ga0466967_0293721 3300045976 Bacteria 1562
211 Ga0495662_0015273 3300046476 Bacteria 3731
212 Ga0495584_0306915 3300046491 Bacteria 806
213 Ga0495594_0036192 3300046499 Bacteria 2691
214 Ga0495640_0485992 3300046533 Bacteria 752
215 Ga0495625_0001003 3300046660 Bacteria 37293
216 Ga0496101_0235428 3300048904 Bacteria 1424
217 Ga0496104_0000010 3300048907 Bacteria 475255
218 Ga0496105_0000005 3300048908 Bacteria 475797
219 Ga0496105_0279773 3300048908 Bacteria 1346
220 Ga0496105_0754355 3300048908 Bacteria 743
221 Ga0496106_0078636 3300048909 Bacteria 2531
222 Ga0496107_0281042 3300048910 Bacteria 1239
223 Ga0496108_0005244 3300048911 Bacteria 10466
224 Ga0496109_0004208 3300048912 Bacteria 12003
225 Ga0496110_0170593 3300048913 Bacteria 1974
226 Ga0496110_0406745 3300048913 Bacteria 1241
227 Ga0496114_0695515 3300048917 Bacteria 892
228 Ga0496114_0949308 3300048917 Bacteria 742
229 Ga0496119_0014028 3300048922 Bacteria 6312
230 Ga0501031_0044963 3300049568 Bacteria 2881
231 Ga0501032_0048859 3300049569 Bacteria 2856
232 Ga0501033_0077376 3300049570 Bacteria 2441
233 Ga0501036_0036181 3300049572 Bacteria 4177
234 Ga0501036_1313804 3300049572 Bacteria 588
235 Ga0501037_0073739 3300049573 Bacteria 2481
236 Ga0501039_0071915 3300049575 Bacteria 2687
237 Ga0501039_1340074 3300049575 Bacteria 552
238 Ga0501040_0060606 3300049576 Bacteria 2600
239 Ga0501040_0077739 3300049576 Bacteria 2296
240 Ga0501041_0001853 3300049577 Bacteria 11851
241 Ga0501041_0252899 3300049577 Bacteria 1108
242 Ga0501042_0013127 3300049578 Bacteria 5636
243 Ga0501043_0506412 3300049579 Bacteria 901
244 Ga0501046_0029995 3300049580 Bacteria 4418
245 Ga0501047_0313329 3300049581 Bacteria 1409
246 Ga0501048_0018140 3300049582 Bacteria 5177
247 Ga0501067_0084112 3300049583 Bacteria 1765
248 Ga0501068_0091092 3300049584 Bacteria 1881
249 Ga0501069_0022608 3300049585 Bacteria 3423
250 Ga0501070_0018157 3300049586 Bacteria 5900
251 Ga0501071_0024582 3300049587 Bacteria 4214
252 Ga0501072_0046314 3300049588 Bacteria 3422
253 Ga0501073_0197308 3300049589 Bacteria 1392
254 Ga0501074_0020798 3300049590 Bacteria 4767
255 Ga0501075_0000756 3300049591 Bacteria 20175
256 Ga0501076_0026916 3300049592 Bacteria 4458
257 Ga0501076_1362314 3300049592 Bacteria 583
258 Ga0501076_1734582 3300049592 Bacteria 512
259 Ga0501077_0017511 3300049593 Bacteria 4523
260 Ga0501077_0419790 3300049593 Bacteria 856
261 Ga0501079_0038520 3300049741 Bacteria 3686
262 Ga0501079_0410668 3300049741 Bacteria 1062
263 Ga0501080_0153122 3300049742 Bacteria 2130
264 Ga0501080_0420502 3300049742 Bacteria 1201
265 Ga0501081_0011978 3300049743 Bacteria 5683
266 Ga0501083_0095191 3300049744 Bacteria 1965
267 Ga0501035_0004450 3300049822 Bacteria 13298
268 Ga0501044_0609420 3300049823 Bacteria 984
269 Ga0501045_0007759 3300049824 Bacteria 7465
270 Ga0501045_0340708 3300049824 Bacteria 1116
271 Ga0501045_0804526 3300049824 Bacteria 692
272 nmdc:mga03n38_410354_c1 3300050490 Bacteria 747
273 nmdc:mga03n38_6052_c1 3300050490 Bacteria 3807
274 nmdc:mga00v17_29094_c2 3300050491 Bacteria 1477
275 nmdc:mga00v17_322243_c1 3300050491 Bacteria 1004
276 nmdc:mga0yw44_100313_c1 3300050492 Bacteria 1843
277 nmdc:mga0yw44_30905_c1 3300050492 Bacteria 3110
278 nmdc:mga06z11_447326_c1 3300050494 Bacteria 780
279 nmdc:mga05p37_839304_c1 3300050507 Bacteria 999
280 nmdc:mga09592_55_c1 3300050508 Bacteria 62203
281 nmdc:mga0qj67_1_c2 3300050509 Bacteria 129768
282 nmdc:mga06r32_107_c1 3300050510 Bacteria 58634
283 nmdc:mga06r32_369718_c1 3300050510 Bacteria 1417
284 nmdc:mga08y16_1627076_c1 3300050511 Bacteria 603
285 Ga0495619_0000041 3300053085 Bacteria 112824
286 Ga0495619_1163134 3300053085 Bacteria 512
287 Ga0500641_0297858 3300053096 Bacteria 663
288 Ga0501084_0008738 3300054114 Bacteria 8377
289 Ga0501084_1018356 3300054114 Bacteria 696
290 Ga0466962_0561012 3300061719 Unclassified 580
291 Ga0530510_0017741 3300061734 Bacteria 5044
292 Ga0530510_0172146 3300061734 Bacteria 1604
293 2623589415 2622736626 Bacteria 7181580
294 2676478115 2675903058 Bacteria 6822861
295 2827629444 2827628540 Bacteria 6858585
296 2858873270 2858868258 Bacteria 7683772
297 2867307881 2867302475 Bacteria 7087181
298 2902586096 2902582711 Bacteria 6187705
299 2996224226 2996221748 Bacteria 6799777
300 8003831445 8003830390 Bacteria 6541657
301 8054706133 8054704163 Bacteria 7247792
302 Ga0070661_100056854
303 JGI24740J21852_10011685
304 JGI24744J21845_10073036
305 JGI25407J50210_10031963
306 Ga0070658_10057766
307 Ga0070683_100016131
308 Ga0070683_100200822
309 Ga0070680_100488901
310 Ga0070682_100061957
311 Ga0070682_100249252
312 Ga0068868_100226932
313 Ga0068868_100385405
314 Ga0070660_100061385
315 Ga0070689_100769104
316 Ga0070691_10101553
317 Ga0070691_10175752
318 Ga0070692_10000238
319 Ga0070692_10344725
320 Ga0070668_100029246
321 Ga0070668_100444528
322 Ga0070668_101082250
323 Ga0070675_100002960
324 Ga0070674_100139663
325 Ga0070674_100451991
326 Ga0070659_100031926
327 Ga0070701_10210468
328 Ga0070700_100031895
329 Ga0070700_100646618
330 Ga0070663_100004469
331 Ga0070663_100825865
332 Ga0070681_10284306
333 Ga0068867_100187333
334 Ga0070685_10106105
335 Ga0070699_101675973
336 Ga0070684_100007375
337 Ga0070684_100190327
338 Ga0070684_100244372
339 Ga0070684_100654887
340 Ga0070684_100966605
341 Ga0070672_100002036
342 Ga0070672_100505535
343 Ga0070686_100065865
344 Ga0070695_100176500
345 Ga0070695_101623387
346 Ga0070693_100170774
347 Ga0070665_100045764
348 Ga0070664_100009172
349 Ga0070664_101401555
350 Ga0068857_100174730
351 Ga0068854_100097536
352 Ga0068854_101749614
353 Ga0068856_100137148
354 Ga0070702_100072767
355 Ga0068852_100044850
356 Ga0068859_100895398
357 Ga0068866_10492771
358 Ga0068861_100172012
359 Ga0068861_100362429
360 Ga0068861_100515411
361 Ga0068851_10059579
362 Ga0068870_10188784
363 Ga0068870_10210284
364 Ga0068858_100062603
365 Ga0068862_100118913
366 Ga0081538_10000329
367 Ga0081540_1019676
368 Ga0081539_10007871
369 Ga0075365_10013327
370 Ga0075365_10907821
371 Ga0075363_100017993
372 Ga0075363_100052319
373 Ga0075363_100169837
374 Ga0075364_10153596
375 Ga0075364_10164494
376 Ga0075364_10520629
377 Ga0075367_10103545
378 Ga0075428_100041029
379 Ga0075430_100397354
380 Ga0075431_100327983
381 Ga0075433_10562699
382 Ga0075429_100253090
383 Ga0097620_100895367
384 Ga0111539_10360721
385 Ga0105245_10019200
386 Ga0105245_10445343
387 Ga0114129_10003801
388 Ga0105243_10007183
389 Ga0105243_10134084
390 Ga0105242_10022501
391 Ga0105238_10151656
392 Ga0105249_10108650
393 Ga0105249_10580191
394 Ga0105239_10012430
395 Ga0105246_10185942
396 Ga0105246_10315145
397 Ga0157371_10300538
398 Ga0157369_11584405
399 Ga0157374_10666094
400 Ga0157378_10095049
401 Ga0163162_10690211
402 Ga0157372_10101657
403 Ga0157375_10173827
404 Ga0157380_10010979
405 Ga0157380_10025510
406 Ga0157380_10492526
407 Ga0157377_10002007
408 Ga0157377_10042398
409 Ga0157377_10324899
410 Ga0157377_10412719
411 Ga0157379_10187138
412 Ga0207656_10666674
413 Ga0207642_10090508
414 Ga0207642_11078063
415 Ga0207688_10003648
416 Ga0207645_10335025
417 Ga0207645_10842405
418 Ga0207643_10057537
419 Ga0207705_10044211
420 Ga0207684_10223247
421 Ga0207660_10231582
422 Ga0207657_10010919
423 Ga0207649_10283498
424 Ga0207652_10168353
425 Ga0207681_10710673
426 Ga0207650_10188727
427 Ga0207659_10006155
428 Ga0207687_10587357
429 Ga0207700_10097149
430 Ga0207690_10078792
431 Ga0207690_10310112
432 Ga0207690_10434945
433 Ga0207706_10029004
434 Ga0207669_10093772
435 Ga0207669_10471937
436 Ga0207704_10252221
437 Ga0207704_11497174
438 Ga0207691_10064755
439 Ga0207661_10017215
440 Ga0207661_10551216
441 Ga0207661_11517137
442 Ga0207679_10152975
443 Ga0207679_10271116
444 Ga0207679_10817862
445 Ga0207651_10047601
446 Ga0207712_10009968
447 Ga0207668_10000643
448 Ga0207668_10010122
449 Ga0207668_10632543
450 Ga0207640_10420080
451 Ga0207640_10676636
452 Ga0207640_11179317
453 Ga0207677_10032040
454 Ga0207703_10060064
455 Ga0207678_10010127
456 Ga0207678_10577288
457 Ga0207708_10004291
458 Ga0207708_10020962
459 Ga0207648_10035385
460 Ga0207648_10204151
461 Ga0207674_10368339
462 Ga0207674_10961914
463 Ga0207675_100107689
464 Ga0207675_100189028
465 Ga0207675_100224886
466 Ga0207698_10008971
467 Ga0268266_10231941
468 Ga0268265_10146856
469 Ga0268265_11257091
470 Ga0307405_10100840
471 Ga0307413_10784528
472 Ga0307413_10799925
473 Ga0307410_10126459
474 Ga0307410_10958446
475 Ga0307410_11627410
476 Ga0307407_10140866
477 Ga0307412_10261264
478 Ga0307412_10524004
479 Ga0307409_100116306
480 Ga0307409_100328130
481 Ga0307409_100391140
482 Ga0307409_101447242
483 Ga0307416_100082186
484 Ga0307416_100643774
485 Ga0307416_100738262
486 Ga0307416_100940581
487 Ga0307416_100996519
488 Ga0307416_101207827
489 Ga0307416_103154815
490 Ga0307414_12134241
491 Ga0307411_10806628
492 Ga0307415_100077891
493 Ga0307415_101690299
494 Ga0307415_101816635
495 Ga0395901_1369909
496 Ga0451853_0164447
497 Ga0451853_0636701
498 Ga0439448_0101517
499 Ga0439454_000429
500 Ga0439455_0096697
501 Ga0450917_019126
502 Ga0450923_082781
503 Ga0450900_015326
504 Ga0450916_021263
505 Ga0439440_0053868
506 Ga0466972_0057324
507 Ga0466965_0650372
508 Ga0466961_0360230
509 Ga0466961_0391732
510 Ga0466957_0070636
511 Ga0466967_0293721
512 Ga0495662_0015273
513 Ga0495584_0306915
514 Ga0495594_0036192
515 Ga0495640_0485992
516 Ga0495625_0001003
517 Ga0496101_0235428
518 Ga0496104_0000010
519 Ga0496105_0000005
520 Ga0496105_0279773
521 Ga0496105_0754355
522 Ga0496106_0078636
523 Ga0496107_0281042
524 Ga0496108_0005244
525 Ga0496109_0004208
526 Ga0496110_0170593
527 Ga0496110_0406745
528 Ga0496114_0695515
529 Ga0496114_0949308
530 Ga0496119_0014028
531 Ga0501031_0044963
532 Ga0501032_0048859
533 Ga0501033_0077376
534 Ga0501036_0036181
535 Ga0501036_1313804
536 Ga0501037_0073739
537 Ga0501039_0071915
538 Ga0501039_1340074
539 Ga0501040_0060606
540 Ga0501040_0077739
541 Ga0501041_0001853
542 Ga0501041_0252899
543 Ga0501042_0013127
544 Ga0501043_0506412
545 Ga0501046_0029995
546 Ga0501047_0313329
547 Ga0501048_0018140
548 Ga0501067_0084112
549 Ga0501068_0091092
550 Ga0501069_0022608
551 Ga0501070_0018157
552 Ga0501071_0024582
553 Ga0501072_0046314
554 Ga0501073_0197308
555 Ga0501074_0020798
556 Ga0501075_0000756
557 Ga0501076_0026916
558 Ga0501076_1362314
559 Ga0501076_1734582
560 Ga0501077_0017511
561 Ga0501077_0419790
562 Ga0501079_0038520
563 Ga0501079_0410668
564 Ga0501080_0153122
565 Ga0501080_0420502
566 Ga0501081_0011978
567 Ga0501083_0095191
568 Ga0501035_0004450
569 Ga0501044_0609420
570 Ga0501045_0007759
571 Ga0501045_0340708
572 Ga0501045_0804526
573 nmdc:mga03n38_410354_c1
574 nmdc:mga03n38_6052_c1
575 nmdc:mga00v17_29094_c2
576 nmdc:mga00v17_322243_c1
577 nmdc:mga0yw44_100313_c1
578 nmdc:mga0yw44_30905_c1
579 nmdc:mga06z11_447326_c1
580 nmdc:mga05p37_839304_c1
581 nmdc:mga09592_55_c1
582 nmdc:mga0qj67_1_c2
583 nmdc:mga06r32_107_c1
584 nmdc:mga06r32_369718_c1
585 nmdc:mga08y16_1627076_c1
586 Ga0495619_0000041
587 Ga0495619_1163134
588 Ga0500641_0297858
589 Ga0501084_0008738
590 Ga0501084_1018356
591 Ga0466962_0561012
592 Ga0530510_0017741
593 Ga0530510_0172146
594 2623589415
595 2676478115
596 2827629444
597 2858873270
598 2867307881
599 2902586096
600 2996224226
601 8003831445
602 8054706133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

42

154

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9282 1 126
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9085 1 126
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.9046 1 131
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8617 1 126
7btz-assembly1.cif.gz_B crystal structure of trmo 0.8294 1 127
ID Description Score Start End Superfamily
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9036 1 132 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9032 2 131 2.40.30.70
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8797 3 131 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8777 2 127 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8706 2 131 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A0B1TZC9-F1-model_v4 TsaA-like domain-containing protein 0.977 48 130
AF-A0A372JAW0-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9733 1 128 GO:0008168
GO:0032259
AF-A0A0B8NEV9-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9711 1 133 GO:0008738
AF-A0A525C6B3-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9698 1 128 GO:0005829
GO:0008168
GO:0016832
GO:0019323
GO:0032259
AF-A0A2T0N5Y1-F1-model_v4 tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA 0.9675 1 128 GO:0008168
GO:0032259

Map