F395718

General Info

Members Datasets Scaffolds Average Seq Length
301 198 602 153

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100720374|Ga0068869_1007203742
Length 181
Sequence VRIAIGSDHAGYELKTHLAKGLADAGHQVLDVGTDSEESVDYPAFCAAVGRAVVRGDADRGIVLGGSGQGEQLAANKVHGVRAALCNELYTARMGRLHNDANVLSMGARVVGTGLADDIVETFLTTPFEGGRHQRRVDQLTGIEEVAADEAALDAHLDSLVAGITARAAGTNQPLGPKETA

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
137 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.62
Nodule 0
Rhizoplane 6.64
Rhizosphere 77.08
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100720374 3300005334 Bacteria 852
2 JGI25407J50210_10045973 3300003373 Bacteria 1112
3 JGI25407J50210_10084718 3300003373 Bacteria 786
4 Ga0065712_10093084 3300005290 Bacteria 2307
5 Ga0065715_10135803 3300005293 Bacteria 1932
6 Ga0070677_10016685 3300005333 Bacteria 2618
7 Ga0068869_100035041 3300005334 Bacteria 3555
8 Ga0070666_10125653 3300005335 Bacteria 1780
9 Ga0070682_100574865 3300005337 Bacteria 886
10 Ga0068868_100313921 3300005338 Bacteria 1334
11 Ga0070689_100044447 3300005340 Bacteria 3417
12 Ga0070689_100087949 3300005340 Bacteria 2445
13 Ga0070691_10032102 3300005341 Bacteria 2466
14 Ga0070661_100237813 3300005344 Bacteria 1401
15 Ga0070661_100317223 3300005344 Bacteria 1217
16 Ga0070669_100233899 3300005353 Bacteria 1457
17 Ga0070669_101707963 3300005353 Bacteria 549
18 Ga0070675_100014101 3300005354 Bacteria 6296
19 Ga0070675_100169994 3300005354 Bacteria 1879
20 Ga0070671_100090054 3300005355 Bacteria 2568
21 Ga0070674_100960178 3300005356 Bacteria 748
22 Ga0070688_100272144 3300005365 Bacteria 1214
23 Ga0070714_100839168 3300005435 Bacteria 891
24 Ga0070701_11148633 3300005438 Bacteria 549
25 Ga0070705_100376495 3300005440 Bacteria 1043
26 Ga0070700_100164723 3300005441 Bacteria 1530
27 Ga0070700_100434030 3300005441 Bacteria 995
28 Ga0070663_100716143 3300005455 Bacteria 852
29 Ga0068867_100615802 3300005459 Bacteria 949
30 Ga0068867_101027437 3300005459 Bacteria 749
31 Ga0070706_100442264 3300005467 Bacteria 1210
32 Ga0070672_101357422 3300005543 Bacteria 635
33 Ga0070686_100013829 3300005544 Bacteria 4632
34 Ga0070686_100681559 3300005544 Bacteria 818
35 Ga0070696_100004267 3300005546 Bacteria 9528
36 Ga0070704_100198687 3300005549 Bacteria 1617
37 Ga0070704_100847289 3300005549 Bacteria 819
38 Ga0068855_101554696 3300005563 Bacteria 678
39 Ga0070664_100043133 3300005564 Bacteria 3806
40 Ga0068854_100158927 3300005578 Bacteria 1748
41 Ga0068852_100345430 3300005616 Bacteria 1451
42 Ga0068859_100209184 3300005617 Bacteria 2037
43 Ga0068859_101305808 3300005617 Bacteria 800
44 Ga0068866_10537561 3300005718 Bacteria 779
45 Ga0068861_100675256 3300005719 Bacteria 957
46 Ga0068870_10405368 3300005840 Bacteria 888
47 Ga0068860_100209702 3300005843 Bacteria 1889
48 Ga0068862_100025790 3300005844 Bacteria 4936
49 Ga0081455_10008722 3300005937 Bacteria 10501
50 Ga0081455_10010551 3300005937 Bacteria 9361
51 Ga0081455_10012996 3300005937 Bacteria 8254
52 Ga0081455_10080909 3300005937 Bacteria 2662
53 Ga0081455_10434086 3300005937 Bacteria 902
54 Ga0081538_10028032 3300005981 Bacteria 3886
55 Ga0081538_10096890 3300005981 Bacteria 1501
56 Ga0075365_10010708 3300006038 Bacteria 5356
57 Ga0075365_10113429 3300006038 Bacteria 1864
58 Ga0075365_10209211 3300006038 Bacteria 1367
59 Ga0075368_10062704 3300006042 Bacteria 1490
60 Ga0075363_100027841 3300006048 Bacteria 2902
61 Ga0075363_100056000 3300006048 Bacteria 2113
62 Ga0075364_10002178 3300006051 Bacteria 10972
63 Ga0075364_10013128 3300006051 Bacteria 5084
64 Ga0075364_10131553 3300006051 Bacteria 1679
65 Ga0075364_10170435 3300006051 Bacteria 1471
66 Ga0075364_10502759 3300006051 Bacteria 828
67 Ga0070715_10421402 3300006163 Bacteria 747
68 Ga0075362_10010104 3300006177 Bacteria 3675
69 Ga0075362_10037207 3300006177 Bacteria 2132
70 Ga0075362_10087733 3300006177 Bacteria 1441
71 Ga0075367_10064125 3300006178 Bacteria 2197
72 Ga0075367_10082833 3300006178 Bacteria 1942
73 Ga0075367_10136059 3300006178 Bacteria 1520
74 Ga0075367_10509766 3300006178 Bacteria 763
75 Ga0075369_10144241 3300006186 Bacteria 1087
76 Ga0075366_10076512 3300006195 Bacteria 1997
77 Ga0075370_10075863 3300006353 Bacteria 1927
78 Ga0075428_100058009 3300006844 Bacteria 4238
79 Ga0075428_100947937 3300006844 Bacteria 912
80 Ga0075430_100009095 3300006846 Bacteria 8392
81 Ga0075430_100356688 3300006846 Bacteria 1207
82 Ga0075430_100463644 3300006846 Bacteria 1045
83 Ga0075430_100525251 3300006846 Bacteria 976
84 Ga0075431_100047041 3300006847 Bacteria 4448
85 Ga0075431_100309641 3300006847 Bacteria 1594
86 Ga0075431_100343170 3300006847 Bacteria 1502
87 Ga0075434_100142407 3300006871 Bacteria 2418
88 Ga0075429_100154752 3300006880 Bacteria 2008
89 Ga0075429_100445022 3300006880 Bacteria 1135
90 Ga0068865_100753367 3300006881 Bacteria 837
91 Ga0097620_100209194 3300006931 Bacteria 2037
92 Ga0097620_101305829 3300006931 Bacteria 800
93 Ga0075435_100002800 3300007076 Bacteria 11658
94 Ga0111539_10184368 3300009094 Bacteria 2438
95 Ga0111539_10785050 3300009094 Bacteria 1108
96 Ga0111539_11076791 3300009094 Bacteria 934
97 Ga0105247_10427600 3300009101 Bacteria 950
98 Ga0114129_10035103 3300009147 Bacteria 7085
99 Ga0114129_10125330 3300009147 Bacteria 3532
100 Ga0114129_10308683 3300009147 Bacteria 2106
101 Ga0105243_10139855 3300009148 Bacteria 2064
102 Ga0105243_10191891 3300009148 Bacteria 1785
103 Ga0105242_10057674 3300009176 Bacteria 3181
104 Ga0105242_10058549 3300009176 Bacteria 3159
105 Ga0105248_10808470 3300009177 Bacteria 1058
106 Ga0105249_10821828 3300009553 Bacteria 994
107 Ga0105249_12691965 3300009553 Bacteria 569
108 Ga0105239_11457656 3300010375 Bacteria 791
109 Ga0157378_10001154 3300013297 Bacteria 24017
110 Ga0157378_10917549 3300013297 Bacteria 907
111 Ga0157375_10306537 3300013308 Bacteria 1752
112 Ga0157375_11001928 3300013308 Bacteria 975
113 Ga0163163_10985748 3300014325 Bacteria 906
114 Ga0163163_12131047 3300014325 Bacteria 620
115 Ga0157377_10419812 3300014745 Bacteria 916
116 Ga0157379_10028625 3300014968 Bacteria 4955
117 Ga0157376_10840002 3300014969 Bacteria 933
118 Ga0213871_10091068 3300021441 Bacteria 884
119 Ga0207697_10069717 3300025315 Bacteria 1472
120 Ga0207682_10080418 3300025893 Bacteria 1396
121 Ga0207642_10382140 3300025899 Bacteria 838
122 Ga0207642_10545193 3300025899 Bacteria 716
123 Ga0207710_10539581 3300025900 Bacteria 607
124 Ga0207688_10038984 3300025901 Bacteria 2639
125 Ga0207688_10847727 3300025901 Bacteria 579
126 Ga0207645_10010643 3300025907 Bacteria 6311
127 Ga0207649_10149563 3300025920 Bacteria 1607
128 Ga0207649_10285020 3300025920 Bacteria 1202
129 Ga0207681_10041697 3300025923 Bacteria 3062
130 Ga0207650_11173724 3300025925 Bacteria 654
131 Ga0207650_11797654 3300025925 Bacteria 518
132 Ga0207659_10027561 3300025926 Bacteria 3849
133 Ga0207659_10160432 3300025926 Bacteria 1765
134 Ga0207687_10516132 3300025927 Bacteria 999
135 Ga0207644_10070080 3300025931 Bacteria 2561
136 Ga0207644_10096900 3300025931 Bacteria 2209
137 Ga0207686_10295319 3300025934 Bacteria 1201
138 Ga0207709_10047384 3300025935 Bacteria 2613
139 Ga0207709_10073305 3300025935 Bacteria 2181
140 Ga0207670_10067630 3300025936 Bacteria 2459
141 Ga0207670_10094617 3300025936 Bacteria 2120
142 Ga0207669_10038354 3300025937 Bacteria 2758
143 Ga0207704_10265565 3300025938 Bacteria 1296
144 Ga0207691_10058345 3300025940 Bacteria 3511
145 Ga0207691_10083260 3300025940 Bacteria 2872
146 Ga0207711_10225814 3300025941 Bacteria 1714
147 Ga0207689_10011748 3300025942 Bacteria 7507
148 Ga0207679_10016372 3300025945 Bacteria 4923
149 Ga0207667_10934200 3300025949 Bacteria 858
150 Ga0207651_10043679 3300025960 Bacteria 2993
151 Ga0207712_10198974 3300025961 Bacteria 1587
152 Ga0207640_10312834 3300025981 Bacteria 1247
153 Ga0207658_10886643 3300025986 Bacteria 812
154 Ga0207677_10975518 3300026023 Bacteria 767
155 Ga0207708_10332176 3300026075 Bacteria 1243
156 Ga0207641_10206596 3300026088 Bacteria 1814
157 Ga0207648_11276499 3300026089 Bacteria 690
158 Ga0207675_100015959 3300026118 Bacteria 7008
159 Ga0207675_100445967 3300026118 Bacteria 1282
160 Ga0207683_10380037 3300026121 Bacteria 1298
161 Ga0207698_11030823 3300026142 Bacteria 834
162 Ga0268266_10341435 3300028379 Bacteria 1406
163 Ga0268264_10183549 3300028381 Bacteria 1902
164 Ga0307517_10106289 3300028786 Bacteria 2171
165 Ga0307513_10558037 3300031456 Bacteria 857
166 Ga0307413_10728481 3300031824 Bacteria 827
167 Ga0307410_10010664 3300031852 Bacteria 5219
168 Ga0307407_10481298 3300031903 Bacteria 906
169 Ga0307409_100026697 3300031995 Bacteria 4078
170 Ga0307409_100730036 3300031995 Bacteria 993
171 Ga0307416_100325092 3300032002 Bacteria 1542
172 Ga0307416_100395019 3300032002 Bacteria 1418
173 Ga0307414_10287912 3300032004 Bacteria 1384
174 Ga0307414_10576313 3300032004 Bacteria 1006
175 Ga0307411_10064817 3300032005 Bacteria 2447
176 Ga0307411_10189410 3300032005 Bacteria 1569
177 Ga0307411_10796356 3300032005 Bacteria 832
178 Ga0307415_100174390 3300032126 Bacteria 1680
179 Ga0373923_0046683 3300035111 Bacteria 1803
180 Ga0373946_0137962 3300035171 Bacteria 1128
181 Ga0395899_0039832 3300037312 Bacteria 3516
182 Ga0395900_0143346 3300037418 Bacteria 2445
183 Ga0395898_0480283 3300037466 Bacteria 1182
184 Ga0395905_0030764 3300037471 Bacteria 5056
185 Ga0395901_0030009 3300038443 Bacteria 5601
186 Ga0395901_0068507 3300038443 Bacteria 3696
187 Ga0436365_1708982 3300039437 Bacteria 957
188 Ga0436360_0846066 3300039438 Bacteria 1757
189 Ga0436361_0357845 3300039447 Bacteria 1809
190 Ga0451802_1940484 3300041460 Bacteria 598
191 Ga0451807_2405002 3300041486 Bacteria 754
192 Ga0451837_1227107 3300041494 Bacteria 1141
193 Ga0451853_2326760 3300041512 Bacteria 1313
194 Ga0439448_0072529 3300042005 Bacteria 1148
195 Ga0439454_063634 3300042011 Bacteria 644
196 Ga0439455_0002941 3300042012 Bacteria 3189
197 Ga0439463_004534 3300042016 Bacteria 3483
198 Ga0450912_019868 3300042116 Bacteria 643
199 Ga0439444_0005982 3300042437 Bacteria 1821
200 Ga0495641_0270260 3300046461 Bacteria 765
201 Ga0495580_0022674 3300046472 Bacteria 4617
202 Ga0495630_0392635 3300046517 Bacteria 1063
203 Ga0495666_0321708 3300046526 Bacteria 698
204 Ga0495586_0385299 3300046535 Bacteria 806
205 Ga0495624_0433404 3300046690 Bacteria 788
206 Ga0495581_0682791 3300047315 Bacteria 593
207 Ga0495676_0015211 3300047321 Bacteria 6861
208 Ga0495593_0170874 3300047673 Bacteria 1096
209 Ga0495615_0254106 3300048090 Bacteria 558
210 Ga0496101_0159928 3300048904 Bacteria 1727
211 Ga0496102_0204818 3300048905 Bacteria 1860
212 Ga0496103_0301187 3300048906 Bacteria 1031
213 Ga0496104_0044116 3300048907 Bacteria 4190
214 Ga0496105_0311137 3300048908 Bacteria 1264
215 Ga0496106_0424969 3300048909 Bacteria 1068
216 Ga0496107_0099216 3300048910 Bacteria 2134
217 Ga0496107_0652569 3300048910 Bacteria 776
218 Ga0496108_0320734 3300048911 Bacteria 1351
219 Ga0496109_0400218 3300048912 Bacteria 1297
220 Ga0496109_0640649 3300048912 Bacteria 1000
221 Ga0496110_0252427 3300048913 Bacteria 1605
222 Ga0496110_0859988 3300048913 Bacteria 812
223 Ga0496111_0089615 3300048914 Bacteria 2253
224 Ga0496111_0296098 3300048914 Bacteria 1200
225 Ga0496114_0102457 3300048917 Bacteria 2446
226 Ga0496114_0119816 3300048917 Bacteria 2263
227 Ga0496114_0275047 3300048917 Bacteria 1484
228 Ga0501034_0000986 3300049571 Bacteria 40824
229 Ga0501037_0004465 3300049573 Bacteria 10163
230 Ga0501037_0814380 3300049573 Bacteria 616
231 Ga0501039_0862383 3300049575 Bacteria 705
232 Ga0501040_0998988 3300049576 Bacteria 607
233 Ga0501046_0082770 3300049580 Bacteria 2478
234 Ga0501048_0103928 3300049582 Bacteria 2005
235 Ga0501067_0393845 3300049583 Bacteria 772
236 Ga0501068_0000178 3300049584 Bacteria 29882
237 Ga0501068_0013273 3300049584 Bacteria 4685
238 Ga0501069_0002824 3300049585 Bacteria 8887
239 Ga0501069_0232815 3300049585 Bacteria 1073
240 Ga0501070_0001076 3300049586 Bacteria 24470
241 Ga0501070_0045151 3300049586 Bacteria 3665
242 Ga0501071_0002881 3300049587 Bacteria 10605
243 Ga0501072_0051116 3300049588 Bacteria 3254
244 Ga0501072_0476612 3300049588 Bacteria 988
245 Ga0501073_0000128 3300049589 Bacteria 49589
246 Ga0501073_0000908 3300049589 Bacteria 21287
247 Ga0501074_0000373 3300049590 Bacteria 26438
248 Ga0501074_0027926 3300049590 Bacteria 4090
249 Ga0501076_0889672 3300049592 Bacteria 734
250 Ga0501233_123158 3300049668 Unclassified 702
251 Ga0501079_0029764 3300049741 Bacteria 4193
252 Ga0501080_0015388 3300049742 Bacteria 7051
253 Ga0501080_0129161 3300049742 Bacteria 2339
254 Ga0501083_0023780 3300049744 Bacteria 4249
255 Ga0501083_0032657 3300049744 Bacteria 3568
256 Ga0501035_0313769 3300049822 Bacteria 1319
257 nmdc:mga03683_117546_c1 3300050489 Bacteria 1180
258 nmdc:mga03683_44165_c1 3300050489 Bacteria 1841
259 nmdc:mga03683_869_c1 3300050489 Bacteria 8702
260 nmdc:mga03n38_108044_c1 3300050490 Bacteria 1351
261 nmdc:mga03n38_35616_c1 3300050490 Bacteria 2134
262 nmdc:mga03n38_407513_c1 3300050490 Bacteria 749
263 nmdc:mga03n38_423698_c1 3300050490 Bacteria 736
264 nmdc:mga00v17_12535_c1 3300050491 Bacteria 4681
265 nmdc:mga00v17_163301_c1 3300050491 Bacteria 1435
266 nmdc:mga00v17_201246_c1 3300050491 Bacteria 1287
267 nmdc:mga00v17_238550_c1 3300050491 Bacteria 1179
268 nmdc:mga00v17_963_c1 3300050491 Bacteria 15435
269 nmdc:mga0yw44_2681_c1 3300050492 Bacteria 7680
270 nmdc:mga0yw44_86685_c1 3300050492 Bacteria 1972
271 nmdc:mga0yw44_94640_c1 3300050492 Bacteria 1894
272 nmdc:mga0k408_27891_c1 3300050493 Bacteria 3209
273 nmdc:mga0k408_484678_c1 3300050493 Bacteria 733
274 nmdc:mga06z11_209390_c1 3300050494 Bacteria 1136
275 nmdc:mga06z11_6774_c1 3300050494 Bacteria 4680
276 nmdc:mga04h51_4930_c1 3300050495 Bacteria 3362
277 nmdc:mga07m45_37777_c1 3300050496 Bacteria 2693
278 nmdc:mga07m45_689233_c1 3300050496 Bacteria 588
279 nmdc:mga05p37_111374_c1 3300050507 Bacteria 3366
280 nmdc:mga05p37_152396_c1 3300050507 Bacteria 2827
281 nmdc:mga05p37_59613_c2 3300050507 Bacteria 2301
282 nmdc:mga09592_16586_c1 3300050508 Bacteria 6028
283 nmdc:mga09592_336958_c1 3300050508 Bacteria 1306
284 nmdc:mga09592_545773_c1 3300050508 Bacteria 996
285 nmdc:mga09592_97405_c1 3300050508 Bacteria 2517
286 nmdc:mga0qj67_361336_c1 3300050509 Bacteria 1173
287 nmdc:mga0qj67_5051_c1 3300050509 Bacteria 9596
288 nmdc:mga0qj67_753462_c1 3300050509 Bacteria 773
289 nmdc:mga06r32_247371_c1 3300050510 Bacteria 1771
290 nmdc:mga06r32_56325_c1 3300050510 Bacteria 3774
291 nmdc:mga08y16_145176_c1 3300050511 Bacteria 2467
292 nmdc:mga08y16_801018_c1 3300050511 Bacteria 935
293 nmdc:mga0n895_75868_c1 3300050512 Bacteria 3342
294 nmdc:mga0rr50_14177_c1 3300050513 Bacteria 5219
295 nmdc:mga0sz30_27165_c1 3300050516 Bacteria 2349
296 Ga0501084_0003125 3300054114 Bacteria 13410
297 Ga0501084_0776027 3300054114 Bacteria 807
298 Ga0501084_1780709 3300054114 Bacteria 514
299 Ga0501082_0207431 3300060353 Bacteria 1705
300 Ga0530510_0020969 3300061734 Bacteria 4647
301 Ga0530510_0155671 3300061734 Unclassified 1689
302 Ga0068869_100720374
303 JGI25407J50210_10045973
304 JGI25407J50210_10084718
305 Ga0065712_10093084
306 Ga0065715_10135803
307 Ga0070677_10016685
308 Ga0068869_100035041
309 Ga0070666_10125653
310 Ga0070682_100574865
311 Ga0068868_100313921
312 Ga0070689_100044447
313 Ga0070689_100087949
314 Ga0070691_10032102
315 Ga0070661_100237813
316 Ga0070661_100317223
317 Ga0070669_100233899
318 Ga0070669_101707963
319 Ga0070675_100014101
320 Ga0070675_100169994
321 Ga0070671_100090054
322 Ga0070674_100960178
323 Ga0070688_100272144
324 Ga0070714_100839168
325 Ga0070701_11148633
326 Ga0070705_100376495
327 Ga0070700_100164723
328 Ga0070700_100434030
329 Ga0070663_100716143
330 Ga0068867_100615802
331 Ga0068867_101027437
332 Ga0070706_100442264
333 Ga0070672_101357422
334 Ga0070686_100013829
335 Ga0070686_100681559
336 Ga0070696_100004267
337 Ga0070704_100198687
338 Ga0070704_100847289
339 Ga0068855_101554696
340 Ga0070664_100043133
341 Ga0068854_100158927
342 Ga0068852_100345430
343 Ga0068859_100209184
344 Ga0068859_101305808
345 Ga0068866_10537561
346 Ga0068861_100675256
347 Ga0068870_10405368
348 Ga0068860_100209702
349 Ga0068862_100025790
350 Ga0081455_10008722
351 Ga0081455_10010551
352 Ga0081455_10012996
353 Ga0081455_10080909
354 Ga0081455_10434086
355 Ga0081538_10028032
356 Ga0081538_10096890
357 Ga0075365_10010708
358 Ga0075365_10113429
359 Ga0075365_10209211
360 Ga0075368_10062704
361 Ga0075363_100027841
362 Ga0075363_100056000
363 Ga0075364_10002178
364 Ga0075364_10013128
365 Ga0075364_10131553
366 Ga0075364_10170435
367 Ga0075364_10502759
368 Ga0070715_10421402
369 Ga0075362_10010104
370 Ga0075362_10037207
371 Ga0075362_10087733
372 Ga0075367_10064125
373 Ga0075367_10082833
374 Ga0075367_10136059
375 Ga0075367_10509766
376 Ga0075369_10144241
377 Ga0075366_10076512
378 Ga0075370_10075863
379 Ga0075428_100058009
380 Ga0075428_100947937
381 Ga0075430_100009095
382 Ga0075430_100356688
383 Ga0075430_100463644
384 Ga0075430_100525251
385 Ga0075431_100047041
386 Ga0075431_100309641
387 Ga0075431_100343170
388 Ga0075434_100142407
389 Ga0075429_100154752
390 Ga0075429_100445022
391 Ga0068865_100753367
392 Ga0097620_100209194
393 Ga0097620_101305829
394 Ga0075435_100002800
395 Ga0111539_10184368
396 Ga0111539_10785050
397 Ga0111539_11076791
398 Ga0105247_10427600
399 Ga0114129_10035103
400 Ga0114129_10125330
401 Ga0114129_10308683
402 Ga0105243_10139855
403 Ga0105243_10191891
404 Ga0105242_10057674
405 Ga0105242_10058549
406 Ga0105248_10808470
407 Ga0105249_10821828
408 Ga0105249_12691965
409 Ga0105239_11457656
410 Ga0157378_10001154
411 Ga0157378_10917549
412 Ga0157375_10306537
413 Ga0157375_11001928
414 Ga0163163_10985748
415 Ga0163163_12131047
416 Ga0157377_10419812
417 Ga0157379_10028625
418 Ga0157376_10840002
419 Ga0213871_10091068
420 Ga0207697_10069717
421 Ga0207682_10080418
422 Ga0207642_10382140
423 Ga0207642_10545193
424 Ga0207710_10539581
425 Ga0207688_10038984
426 Ga0207688_10847727
427 Ga0207645_10010643
428 Ga0207649_10149563
429 Ga0207649_10285020
430 Ga0207681_10041697
431 Ga0207650_11173724
432 Ga0207650_11797654
433 Ga0207659_10027561
434 Ga0207659_10160432
435 Ga0207687_10516132
436 Ga0207644_10070080
437 Ga0207644_10096900
438 Ga0207686_10295319
439 Ga0207709_10047384
440 Ga0207709_10073305
441 Ga0207670_10067630
442 Ga0207670_10094617
443 Ga0207669_10038354
444 Ga0207704_10265565
445 Ga0207691_10058345
446 Ga0207691_10083260
447 Ga0207711_10225814
448 Ga0207689_10011748
449 Ga0207679_10016372
450 Ga0207667_10934200
451 Ga0207651_10043679
452 Ga0207712_10198974
453 Ga0207640_10312834
454 Ga0207658_10886643
455 Ga0207677_10975518
456 Ga0207708_10332176
457 Ga0207641_10206596
458 Ga0207648_11276499
459 Ga0207675_100015959
460 Ga0207675_100445967
461 Ga0207683_10380037
462 Ga0207698_11030823
463 Ga0268266_10341435
464 Ga0268264_10183549
465 Ga0307517_10106289
466 Ga0307513_10558037
467 Ga0307413_10728481
468 Ga0307410_10010664
469 Ga0307407_10481298
470 Ga0307409_100026697
471 Ga0307409_100730036
472 Ga0307416_100325092
473 Ga0307416_100395019
474 Ga0307414_10287912
475 Ga0307414_10576313
476 Ga0307411_10064817
477 Ga0307411_10189410
478 Ga0307411_10796356
479 Ga0307415_100174390
480 Ga0373923_0046683
481 Ga0373946_0137962
482 Ga0395899_0039832
483 Ga0395900_0143346
484 Ga0395898_0480283
485 Ga0395905_0030764
486 Ga0395901_0030009
487 Ga0395901_0068507
488 Ga0436365_1708982
489 Ga0436360_0846066
490 Ga0436361_0357845
491 Ga0451802_1940484
492 Ga0451807_2405002
493 Ga0451837_1227107
494 Ga0451853_2326760
495 Ga0439448_0072529
496 Ga0439454_063634
497 Ga0439455_0002941
498 Ga0439463_004534
499 Ga0450912_019868
500 Ga0439444_0005982
501 Ga0495641_0270260
502 Ga0495580_0022674
503 Ga0495630_0392635
504 Ga0495666_0321708
505 Ga0495586_0385299
506 Ga0495624_0433404
507 Ga0495581_0682791
508 Ga0495676_0015211
509 Ga0495593_0170874
510 Ga0495615_0254106
511 Ga0496101_0159928
512 Ga0496102_0204818
513 Ga0496103_0301187
514 Ga0496104_0044116
515 Ga0496105_0311137
516 Ga0496106_0424969
517 Ga0496107_0099216
518 Ga0496107_0652569
519 Ga0496108_0320734
520 Ga0496109_0400218
521 Ga0496109_0640649
522 Ga0496110_0252427
523 Ga0496110_0859988
524 Ga0496111_0089615
525 Ga0496111_0296098
526 Ga0496114_0102457
527 Ga0496114_0119816
528 Ga0496114_0275047
529 Ga0501034_0000986
530 Ga0501037_0004465
531 Ga0501037_0814380
532 Ga0501039_0862383
533 Ga0501040_0998988
534 Ga0501046_0082770
535 Ga0501048_0103928
536 Ga0501067_0393845
537 Ga0501068_0000178
538 Ga0501068_0013273
539 Ga0501069_0002824
540 Ga0501069_0232815
541 Ga0501070_0001076
542 Ga0501070_0045151
543 Ga0501071_0002881
544 Ga0501072_0051116
545 Ga0501072_0476612
546 Ga0501073_0000128
547 Ga0501073_0000908
548 Ga0501074_0000373
549 Ga0501074_0027926
550 Ga0501076_0889672
551 Ga0501233_123158
552 Ga0501079_0029764
553 Ga0501080_0015388
554 Ga0501080_0129161
555 Ga0501083_0023780
556 Ga0501083_0032657
557 Ga0501035_0313769
558 nmdc:mga03683_117546_c1
559 nmdc:mga03683_44165_c1
560 nmdc:mga03683_869_c1
561 nmdc:mga03n38_108044_c1
562 nmdc:mga03n38_35616_c1
563 nmdc:mga03n38_407513_c1
564 nmdc:mga03n38_423698_c1
565 nmdc:mga00v17_12535_c1
566 nmdc:mga00v17_163301_c1
567 nmdc:mga00v17_201246_c1
568 nmdc:mga00v17_238550_c1
569 nmdc:mga00v17_963_c1
570 nmdc:mga0yw44_2681_c1
571 nmdc:mga0yw44_86685_c1
572 nmdc:mga0yw44_94640_c1
573 nmdc:mga0k408_27891_c1
574 nmdc:mga0k408_484678_c1
575 nmdc:mga06z11_209390_c1
576 nmdc:mga06z11_6774_c1
577 nmdc:mga04h51_4930_c1
578 nmdc:mga07m45_37777_c1
579 nmdc:mga07m45_689233_c1
580 nmdc:mga05p37_111374_c1
581 nmdc:mga05p37_152396_c1
582 nmdc:mga05p37_59613_c2
583 nmdc:mga09592_16586_c1
584 nmdc:mga09592_336958_c1
585 nmdc:mga09592_545773_c1
586 nmdc:mga09592_97405_c1
587 nmdc:mga0qj67_361336_c1
588 nmdc:mga0qj67_5051_c1
589 nmdc:mga0qj67_753462_c1
590 nmdc:mga06r32_247371_c1
591 nmdc:mga06r32_56325_c1
592 nmdc:mga08y16_145176_c1
593 nmdc:mga08y16_801018_c1
594 nmdc:mga0n895_75868_c1
595 nmdc:mga0rr50_14177_c1
596 nmdc:mga0sz30_27165_c1
597 Ga0501084_0003125
598 Ga0501084_0776027
599 Ga0501084_1780709
600 Ga0501082_0207431
601 Ga0530510_0020969
602 Ga0530510_0155671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

3

140

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9953 1 145
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9877 2 144
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9864 2 146
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9842 2 142
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9828 1 143
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9861 2 146 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9828 1 143 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9814 2 142 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9728 2 146 3.40.1400.10
6fxsA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9654 2 143 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A7W1SDQ1-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 1.001 1 146 GO:0004751
GO:0009052
GO:0019316
AF-B1N6P2-F1-model_v4 Putative ribose-5-phosphate isomerase B 1.001 2 145 GO:0004751
GO:0009052
GO:0019316
AF-A0A6J7GNZ8-F1-model_v4 Unannotated protein 1.001 2 145 GO:0004751
GO:0009052
GO:0019316
AF-A0A1F2Y808-F1-model_v4 Ribose 5-phosphate isomerase B 1.001 14 145 GO:0005975
GO:0016861
AF-A0A7X9KG45-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 1 2 145 GO:0004751
GO:0009052
GO:0019316

Map