F395514
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 218 | 601 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0219321|Ga0466967_0219321_198_674 |
| Length | 149 |
| Sequence | VTTTRLSPGDTAPDFTLPSDLRGRKVVVYFYPAAMTPGCTTEACDFSDSLDSLKGAGYEVLGISPDAPEKLAKFRENDHLTITLLSDPDRQALEAYGAYGEKQLYGKTVEGVIRSTFVVDEEGRIQIAQYNVKATGHVAKLRRDLGLAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 102 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 130 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 131 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 181 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 182 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 183 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 184 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 185 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 186 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 187 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 188 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 189 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 190 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 191 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 192 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 193 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 194 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 195 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 196 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 197 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 198 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 199 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 200 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 201 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 202 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 203 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 204 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 205 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 206 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 207 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 208 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 209 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 210 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 211 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 212 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 213 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 214 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 215 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 216 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 217 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 218 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89 |
| Metatranscriptomes | 0.67 |
| Isolates | 10.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.33 |
| Nodule | 1.67 |
| Rhizoplane | 4.67 |
| Rhizosphere | 79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0219321 | 3300045976 | Bacteria | 1807 |
| 2 | JGI24737J22298_10030814 | 3300001990 | Bacteria | 1677 |
| 3 | JGI25406J46586_10023143 | 3300003203 | Bacteria | 2459 |
| 4 | rootH1_10058328 | 3300003316 | Bacteria | 7413 |
| 5 | rootH1_10058328 | 3300003323 | Bacteria | 2451 |
| 6 | rootH1_10111601 | 3300003316 | Bacteria | 3409 |
| 7 | Ga0070658_10147535 | 3300005327 | Bacteria | 1968 |
| 8 | Ga0070658_10353021 | 3300005327 | Bacteria | 1259 |
| 9 | Ga0070658_10526091 | 3300005327 | Bacteria | 1023 |
| 10 | Ga0070658_10558427 | 3300005327 | Bacteria | 991 |
| 11 | Ga0070683_100234547 | 3300005329 | Bacteria | 1744 |
| 12 | Ga0070670_100378113 | 3300005331 | Bacteria | 1247 |
| 13 | Ga0070682_100107505 | 3300005337 | Bacteria | 1853 |
| 14 | Ga0070682_100493076 | 3300005337 | Bacteria | 947 |
| 15 | Ga0068868_100185388 | 3300005338 | Bacteria | 1728 |
| 16 | Ga0070661_100340683 | 3300005344 | Bacteria | 1174 |
| 17 | Ga0070668_100004532 | 3300005347 | Bacteria | 10309 |
| 18 | Ga0070668_100050718 | 3300005347 | Bacteria | 3196 |
| 19 | Ga0070675_100593981 | 3300005354 | Bacteria | 1004 |
| 20 | Ga0070671_100518720 | 3300005355 | Bacteria | 1026 |
| 21 | Ga0070659_100578323 | 3300005366 | Bacteria | 963 |
| 22 | Ga0070667_100064960 | 3300005367 | Bacteria | 3098 |
| 23 | Ga0070667_100075198 | 3300005367 | Bacteria | 2883 |
| 24 | Ga0070710_10690928 | 3300005437 | Bacteria | 719 |
| 25 | Ga0070700_100577095 | 3300005441 | Bacteria | 877 |
| 26 | Ga0070663_100048154 | 3300005455 | Bacteria | 3021 |
| 27 | Ga0070678_101038535 | 3300005456 | Bacteria | 755 |
| 28 | Ga0068867_100935593 | 3300005459 | Bacteria | 782 |
| 29 | Ga0070685_10087195 | 3300005466 | Bacteria | 1883 |
| 30 | Ga0070679_100232307 | 3300005530 | Bacteria | 1804 |
| 31 | Ga0070679_100364695 | 3300005530 | Bacteria | 1392 |
| 32 | Ga0070679_101010658 | 3300005530 | Bacteria | 776 |
| 33 | Ga0070686_101244557 | 3300005544 | Bacteria | 620 |
| 34 | Ga0070693_100642775 | 3300005547 | Bacteria | 771 |
| 35 | Ga0070665_100424413 | 3300005548 | Bacteria | 1338 |
| 36 | Ga0070665_100832981 | 3300005548 | Bacteria | 936 |
| 37 | Ga0070664_100155781 | 3300005564 | Bacteria | 2018 |
| 38 | Ga0068857_100332379 | 3300005577 | Bacteria | 1405 |
| 39 | Ga0068856_101328916 | 3300005614 | Bacteria | 734 |
| 40 | Ga0068852_100308644 | 3300005616 | Bacteria | 1533 |
| 41 | Ga0068864_100738711 | 3300005618 | Bacteria | 964 |
| 42 | Ga0068866_10247397 | 3300005718 | Bacteria | 1089 |
| 43 | Ga0068861_100495961 | 3300005719 | Bacteria | 1103 |
| 44 | Ga0068870_10118965 | 3300005840 | Bacteria | 1519 |
| 45 | Ga0068863_100428375 | 3300005841 | Bacteria | 1297 |
| 46 | Ga0068863_100633758 | 3300005841 | Bacteria | 1059 |
| 47 | Ga0068860_100103193 | 3300005843 | Bacteria | 2722 |
| 48 | Ga0068860_100446521 | 3300005843 | Bacteria | 1285 |
| 49 | Ga0081455_10066943 | 3300005937 | Bacteria | 2996 |
| 50 | Ga0081540_1063580 | 3300005983 | Bacteria | 1746 |
| 51 | Ga0081539_10000456 | 3300005985 | Bacteria | 86722 |
| 52 | Ga0081539_10003649 | 3300005985 | Bacteria | 18523 |
| 53 | Ga0081539_10005425 | 3300005985 | Bacteria | 13027 |
| 54 | Ga0081539_10012084 | 3300005985 | Bacteria | 6710 |
| 55 | Ga0070717_10345368 | 3300006028 | Bacteria | 1330 |
| 56 | Ga0070717_11017598 | 3300006028 | Bacteria | 755 |
| 57 | Ga0070712_100327096 | 3300006175 | Bacteria | 1248 |
| 58 | Ga0070712_101708366 | 3300006175 | Bacteria | 551 |
| 59 | Ga0075428_100044958 | 3300006844 | Bacteria | 4853 |
| 60 | Ga0075428_101779306 | 3300006844 | Bacteria | 642 |
| 61 | Ga0075430_101347251 | 3300006846 | Bacteria | 587 |
| 62 | Ga0075431_100256525 | 3300006847 | Bacteria | 1775 |
| 63 | Ga0068865_100234644 | 3300006881 | Bacteria | 1441 |
| 64 | Ga0105251_10042340 | 3300009011 | Bacteria | 2211 |
| 65 | Ga0105240_10523082 | 3300009093 | Bacteria | 1316 |
| 66 | Ga0105240_11625831 | 3300009093 | Bacteria | 675 |
| 67 | Ga0105245_10281681 | 3300009098 | Bacteria | 1625 |
| 68 | Ga0105245_10769863 | 3300009098 | Bacteria | 999 |
| 69 | Ga0105247_10691671 | 3300009101 | Bacteria | 766 |
| 70 | Ga0114129_10831692 | 3300009147 | Bacteria | 1175 |
| 71 | Ga0114129_11065136 | 3300009147 | Bacteria | 1014 |
| 72 | Ga0105243_11338535 | 3300009148 | Bacteria | 735 |
| 73 | Ga0105242_11966006 | 3300009176 | Bacteria | 626 |
| 74 | Ga0105242_12035078 | 3300009176 | Bacteria | 617 |
| 75 | Ga0105248_10852699 | 3300009177 | Bacteria | 1028 |
| 76 | Ga0105237_11589566 | 3300009545 | Bacteria | 661 |
| 77 | Ga0105237_12016729 | 3300009545 | Bacteria | 586 |
| 78 | Ga0105238_10391942 | 3300009551 | Bacteria | 1381 |
| 79 | Ga0105238_10874034 | 3300009551 | Bacteria | 917 |
| 80 | Ga0105028_112160 | 3300009993 | Bacteria | 909 |
| 81 | Ga0105239_11378204 | 3300010375 | Bacteria | 814 |
| 82 | Ga0105246_10752470 | 3300011119 | Bacteria | 860 |
| 83 | Ga0157369_10055984 | 3300013105 | Bacteria | 4256 |
| 84 | Ga0157374_10983781 | 3300013296 | Bacteria | 863 |
| 85 | Ga0157374_11573552 | 3300013296 | Bacteria | 681 |
| 86 | Ga0157378_10926236 | 3300013297 | Bacteria | 903 |
| 87 | Ga0163162_10857622 | 3300013306 | Bacteria | 1023 |
| 88 | Ga0157372_10174076 | 3300013307 | Bacteria | 2491 |
| 89 | Ga0157375_10986613 | 3300013308 | Bacteria | 983 |
| 90 | Ga0157375_11287963 | 3300013308 | Bacteria | 859 |
| 91 | Ga0163163_10368612 | 3300014325 | Bacteria | 1493 |
| 92 | Ga0163163_11253405 | 3300014325 | Bacteria | 804 |
| 93 | Ga0157380_10256921 | 3300014326 | Bacteria | 1585 |
| 94 | Ga0157379_10198888 | 3300014968 | Bacteria | 1812 |
| 95 | Ga0157376_10900002 | 3300014969 | Bacteria | 903 |
| 96 | Ga0163161_10098209 | 3300017792 | Bacteria | 2176 |
| 97 | Ga0206356_10044827 | 3300020070 | Bacteria | 1130 |
| 98 | Ga0154015_1254536 | 3300020610 | Bacteria | 717 |
| 99 | Ga0207688_10641552 | 3300025901 | Bacteria | 670 |
| 100 | Ga0207699_11058368 | 3300025906 | Bacteria | 600 |
| 101 | Ga0207705_10804967 | 3300025909 | Bacteria | 729 |
| 102 | Ga0207654_10209053 | 3300025911 | Bacteria | 1289 |
| 103 | Ga0207654_10898054 | 3300025911 | Bacteria | 642 |
| 104 | Ga0207662_10160425 | 3300025918 | Bacteria | 1436 |
| 105 | Ga0207657_10713579 | 3300025919 | Bacteria | 778 |
| 106 | Ga0207652_10075650 | 3300025921 | Bacteria | 2935 |
| 107 | Ga0207652_10236135 | 3300025921 | Bacteria | 1648 |
| 108 | Ga0207652_10386007 | 3300025921 | Bacteria | 1264 |
| 109 | Ga0207652_11475175 | 3300025921 | Bacteria | 584 |
| 110 | Ga0207652_11689346 | 3300025921 | Bacteria | 538 |
| 111 | Ga0207650_10875729 | 3300025925 | Bacteria | 762 |
| 112 | Ga0207687_10204547 | 3300025927 | Bacteria | 1545 |
| 113 | Ga0207687_10229497 | 3300025927 | Bacteria | 1466 |
| 114 | Ga0207687_10723236 | 3300025927 | Bacteria | 846 |
| 115 | Ga0207687_11061701 | 3300025927 | Bacteria | 695 |
| 116 | Ga0207644_10451824 | 3300025931 | Bacteria | 1056 |
| 117 | Ga0207670_10527988 | 3300025936 | Bacteria | 962 |
| 118 | Ga0207661_10228376 | 3300025944 | Bacteria | 1647 |
| 119 | Ga0207661_10451470 | 3300025944 | Bacteria | 1171 |
| 120 | Ga0207679_10656120 | 3300025945 | Bacteria | 949 |
| 121 | Ga0207679_11502506 | 3300025945 | Bacteria | 618 |
| 122 | Ga0207668_10003387 | 3300025972 | Bacteria | 9346 |
| 123 | Ga0207668_10021090 | 3300025972 | Bacteria | 4152 |
| 124 | Ga0207668_11029119 | 3300025972 | Bacteria | 737 |
| 125 | Ga0207658_10221381 | 3300025986 | Bacteria | 1592 |
| 126 | Ga0207658_10304495 | 3300025986 | Bacteria | 1374 |
| 127 | Ga0207677_10090737 | 3300026023 | Bacteria | 2221 |
| 128 | Ga0207678_10123959 | 3300026067 | Bacteria | 2205 |
| 129 | Ga0207678_11266412 | 3300026067 | Bacteria | 653 |
| 130 | Ga0207708_10750981 | 3300026075 | Bacteria | 837 |
| 131 | Ga0207641_10314526 | 3300026088 | Bacteria | 1483 |
| 132 | Ga0207676_10169909 | 3300026095 | Bacteria | 1898 |
| 133 | Ga0207674_10039494 | 3300026116 | Bacteria | 4891 |
| 134 | Ga0207675_100441672 | 3300026118 | Bacteria | 1288 |
| 135 | Ga0207675_100879939 | 3300026118 | Bacteria | 911 |
| 136 | Ga0207683_10706812 | 3300026121 | Bacteria | 935 |
| 137 | Ga0207683_11203521 | 3300026121 | Bacteria | 702 |
| 138 | Ga0207698_11220419 | 3300026142 | Bacteria | 766 |
| 139 | Ga0268266_10134739 | 3300028379 | Bacteria | 2211 |
| 140 | Ga0268265_10123430 | 3300028380 | Bacteria | 2138 |
| 141 | Ga0268265_10191352 | 3300028380 | Bacteria | 1767 |
| 142 | Ga0268264_10971114 | 3300028381 | Bacteria | 855 |
| 143 | Ga0268264_11306433 | 3300028381 | Bacteria | 735 |
| 144 | Ga0307517_10148560 | 3300028786 | Bacteria | 1617 |
| 145 | Ga0307515_10051561 | 3300028794 | Bacteria | 6131 |
| 146 | Ga0307515_10097866 | 3300028794 | Bacteria | 3580 |
| 147 | Ga0307515_10161666 | 3300028794 | Bacteria | 2280 |
| 148 | Ga0307513_10020682 | 3300031456 | Bacteria | 7795 |
| 149 | Ga0307513_10175172 | 3300031456 | Bacteria | 2016 |
| 150 | Ga0307513_10579596 | 3300031456 | Bacteria | 832 |
| 151 | Ga0307509_10014161 | 3300031507 | Bacteria | 9402 |
| 152 | Ga0307509_10656849 | 3300031507 | Bacteria | 717 |
| 153 | Ga0307508_10019402 | 3300031616 | Bacteria | 6181 |
| 154 | Ga0307508_10065188 | 3300031616 | Bacteria | 3210 |
| 155 | Ga0307516_10010957 | 3300031730 | Bacteria | 9910 |
| 156 | Ga0307516_10014056 | 3300031730 | Bacteria | 8487 |
| 157 | Ga0307405_10033631 | 3300031731 | Bacteria | 3043 |
| 158 | Ga0307405_10088305 | 3300031731 | Bacteria | 2045 |
| 159 | Ga0307405_10239592 | 3300031731 | Bacteria | 1343 |
| 160 | Ga0307413_10017776 | 3300031824 | Bacteria | 3712 |
| 161 | Ga0307413_10030465 | 3300031824 | Bacteria | 3031 |
| 162 | Ga0307410_10333479 | 3300031852 | Bacteria | 1207 |
| 163 | Ga0326468_10000941 | 3300031889 | Bacteria | 2817 |
| 164 | Ga0307406_10047034 | 3300031901 | Bacteria | 2717 |
| 165 | Ga0307406_10107261 | 3300031901 | Bacteria | 1915 |
| 166 | Ga0307407_10762399 | 3300031903 | Bacteria | 733 |
| 167 | Ga0307409_100018635 | 3300031995 | Bacteria | 4674 |
| 168 | Ga0307409_100157687 | 3300031995 | Bacteria | 1980 |
| 169 | Ga0307416_100171973 | 3300032002 | Bacteria | 2018 |
| 170 | Ga0307416_101022637 | 3300032002 | Bacteria | 930 |
| 171 | Ga0307414_10163109 | 3300032004 | Bacteria | 1773 |
| 172 | Ga0307411_10055951 | 3300032005 | Bacteria | 2598 |
| 173 | Ga0307415_100202988 | 3300032126 | Bacteria | 1575 |
| 174 | Ga0307415_100269318 | 3300032126 | Bacteria | 1394 |
| 175 | Ga0307415_100285561 | 3300032126 | Bacteria | 1359 |
| 176 | Ga0307415_100396870 | 3300032126 | Bacteria | 1176 |
| 177 | Ga0307415_100797101 | 3300032126 | Bacteria | 862 |
| 178 | Ga0307507_10037457 | 3300033179 | Bacteria | 4936 |
| 179 | Ga0307507_10296574 | 3300033179 | Bacteria | 995 |
| 180 | Ga0307507_10468839 | 3300033179 | Bacteria | 689 |
| 181 | Ga0307510_10207977 | 3300033180 | Bacteria | 1483 |
| 182 | Ga0373932_0038166 | 3300035112 | Bacteria | 1372 |
| 183 | Ga0373942_0000472 | 3300035207 | Bacteria | 11414 |
| 184 | Ga0373942_0153919 | 3300035207 | Bacteria | 740 |
| 185 | Ga0373962_0002632 | 3300035242 | Bacteria | 4268 |
| 186 | Ga0373935_0028733 | 3300035692 | Bacteria | 3437 |
| 187 | Ga0373937_0219403 | 3300036401 | Bacteria | 1790 |
| 188 | Ga0395898_0663690 | 3300037466 | Bacteria | 985 |
| 189 | Ga0395901_0186113 | 3300038443 | Bacteria | 2178 |
| 190 | Ga0395901_0311496 | 3300038443 | Bacteria | 1630 |
| 191 | Ga0451793_0130346 | 3300041452 | Bacteria | 631 |
| 192 | Ga0451797_0436408 | 3300041453 | Bacteria | 598 |
| 193 | Ga0451798_0168685 | 3300041458 | Bacteria | 554 |
| 194 | Ga0451802_0483349 | 3300041460 | Bacteria | 627 |
| 195 | Ga0451804_0100590 | 3300041463 | Bacteria | 600 |
| 196 | Ga0451853_1474361 | 3300041512 | Bacteria | 5695 |
| 197 | Ga0439440_0107168 | 3300042993 | Bacteria | 766 |
| 198 | Ga0466972_0004156 | 3300044658 | Bacteria | 7225 |
| 199 | Ga0466965_0083774 | 3300044683 | Bacteria | 1614 |
| 200 | Ga0466966_0145548 | 3300044684 | Bacteria | 1447 |
| 201 | Ga0466966_0836983 | 3300044684 | Bacteria | 555 |
| 202 | Ga0466963_0018717 | 3300044694 | Bacteria | 4335 |
| 203 | Ga0466963_0596023 | 3300044694 | Bacteria | 780 |
| 204 | Ga0466963_0879901 | 3300044694 | Bacteria | 631 |
| 205 | Ga0466971_0122721 | 3300044719 | Bacteria | 1203 |
| 206 | Ga0466957_0337435 | 3300044842 | Bacteria | 1020 |
| 207 | Ga0466957_0344279 | 3300044842 | Bacteria | 1010 |
| 208 | Ga0466960_0000588 | 3300044901 | Bacteria | 12592 |
| 209 | Ga0466959_0080435 | 3300045049 | Bacteria | 2349 |
| 210 | Ga0466959_0540852 | 3300045049 | Bacteria | 786 |
| 211 | Ga0466958_0106570 | 3300045836 | Bacteria | 1747 |
| 212 | Ga0466958_0170322 | 3300045836 | Bacteria | 1379 |
| 213 | Ga0466958_0200515 | 3300045836 | Bacteria | 1270 |
| 214 | Ga0466967_0056554 | 3300045976 | Bacteria | 3460 |
| 215 | Ga0495638_0184181 | 3300046460 | Bacteria | 1189 |
| 216 | Ga0495641_0052277 | 3300046461 | Bacteria | 1863 |
| 217 | Ga0495606_0001201 | 3300046507 | Bacteria | 36440 |
| 218 | Ga0495632_0150652 | 3300046519 | Bacteria | 1075 |
| 219 | Ga0495668_0000322 | 3300046616 | Bacteria | 65565 |
| 220 | Ga0495625_0001096 | 3300046660 | Bacteria | 35139 |
| 221 | Ga0495649_0520888 | 3300046694 | Bacteria | 590 |
| 222 | Ga0495683_0064546 | 3300047323 | Bacteria | 1808 |
| 223 | Ga0495626_0000175 | 3300048091 | Bacteria | 79583 |
| 224 | Ga0496100_0024710 | 3300048903 | Bacteria | 3667 |
| 225 | Ga0496100_0203667 | 3300048903 | Bacteria | 1444 |
| 226 | Ga0496101_0251996 | 3300048904 | Bacteria | 1376 |
| 227 | Ga0496106_0282103 | 3300048909 | Bacteria | 1331 |
| 228 | Ga0496107_0286203 | 3300048910 | Bacteria | 1227 |
| 229 | Ga0496108_0000079 | 3300048911 | Bacteria | 103605 |
| 230 | Ga0496108_1549485 | 3300048911 | Bacteria | 550 |
| 231 | Ga0496112_0194944 | 3300048915 | Bacteria | 1987 |
| 232 | Ga0496115_0795696 | 3300048918 | Bacteria | 736 |
| 233 | Ga0496124_0467937 | 3300048927 | Bacteria | 855 |
| 234 | Ga0501031_0552384 | 3300049568 | Bacteria | 742 |
| 235 | Ga0501032_0116399 | 3300049569 | Bacteria | 1767 |
| 236 | Ga0501033_0001842 | 3300049570 | Bacteria | 18461 |
| 237 | Ga0501033_0151297 | 3300049570 | Bacteria | 1674 |
| 238 | Ga0501034_0259655 | 3300049571 | Bacteria | 1680 |
| 239 | Ga0501038_0000215 | 3300049574 | Bacteria | 49658 |
| 240 | Ga0501039_0041666 | 3300049575 | Bacteria | 3548 |
| 241 | Ga0501043_0013681 | 3300049579 | Bacteria | 6351 |
| 242 | Ga0501043_0128635 | 3300049579 | Bacteria | 1985 |
| 243 | Ga0501046_0000883 | 3300049580 | Bacteria | 29184 |
| 244 | Ga0501047_0043698 | 3300049581 | Bacteria | 4328 |
| 245 | Ga0501048_0004667 | 3300049582 | Bacteria | 10428 |
| 246 | Ga0501067_0479751 | 3300049583 | Bacteria | 695 |
| 247 | Ga0501068_0166871 | 3300049584 | Bacteria | 1389 |
| 248 | Ga0501069_0092789 | 3300049585 | Bacteria | 1708 |
| 249 | Ga0501070_0030450 | 3300049586 | Bacteria | 4522 |
| 250 | Ga0501070_0261476 | 3300049586 | Bacteria | 1414 |
| 251 | Ga0501070_1185638 | 3300049586 | Bacteria | 586 |
| 252 | Ga0501072_0129837 | 3300049588 | Bacteria | 2008 |
| 253 | Ga0501073_0059895 | 3300049589 | Bacteria | 2658 |
| 254 | Ga0501080_0523023 | 3300049742 | Bacteria | 1058 |
| 255 | Ga0501035_0317149 | 3300049822 | Bacteria | 1310 |
| 256 | Ga0501035_0329627 | 3300049822 | Bacteria | 1281 |
| 257 | Ga0501044_0113864 | 3300049823 | Bacteria | 2711 |
| 258 | nmdc:mga05p37_1357779_c1 | 3300050507 | Bacteria | 719 |
| 259 | nmdc:mga06r32_7898_c1 | 3300050510 | Bacteria | 9562 |
| 260 | nmdc:mga0n895_881313_c1 | 3300050512 | Bacteria | 881 |
| 261 | Ga0500644_0045119 | 3300053088 | Bacteria | 1483 |
| 262 | Ga0500646_0189201 | 3300053090 | Bacteria | 701 |
| 263 | Ga0500594_0038786 | 3300053118 | Bacteria | 1292 |
| 264 | Ga0500652_013995 | 3300053131 | Bacteria | 2858 |
| 265 | Ga0500559_0228214 | 3300053136 | Bacteria | 878 |
| 266 | Ga0500630_177113 | 3300053159 | Bacteria | 865 |
| 267 | Ga0500611_212712 | 3300053727 | Bacteria | 550 |
| 268 | Ga0466962_0295716 | 3300061719 | Bacteria | 800 |
| 269 | Ga0466962_0657287 | 3300061719 | Bacteria | 536 |
| 270 | Ga0530510_0151428 | 3300061734 | Bacteria | 1713 |
| 271 | 2501943955 | 2501939600 | Bacteria | 6907073 |
| 272 | 2515493558 | 2515154088 | Bacteria | 5526283 |
| 273 | 2515722457 | 2515154129 | Bacteria | 5584369 |
| 274 | 2515758488 | 2515154137 | Bacteria | 5711575 |
| 275 | 2516082533 | 2515154202 | Bacteria | 5471270 |
| 276 | 2516087904 | 2515154203 | Bacteria | 5458536 |
| 277 | 2753268659 | 2751185782 | Bacteria | 11227053 |
| 278 | 2772642359 | 2772190715 | Bacteria | 6959372 |
| 279 | 2855671268 | 2855670206 | Bacteria | 7120389 |
| 280 | 2855682534 | 2855676851 | Bacteria | 7063653 |
| 281 | 2855689439 | 2855683550 | Bacteria | 7134265 |
| 282 | 2856860862 | 2856858025 | Bacteria | 7255264 |
| 283 | 2857291963 | 2857288857 | Bacteria | 7189066 |
| 284 | 2858850751 | 2858848962 | Bacteria | 6963058 |
| 285 | 2858883875 | 2858882152 | Bacteria | 7230291 |
| 286 | 2858889971 | 2858888857 | Bacteria | 7060307 |
| 287 | 2858900823 | 2858895516 | Bacteria | 7378898 |
| 288 | 2869054570 | 2869048445 | Bacteria | 6875584 |
| 289 | 2869070949 | 2869068681 | Bacteria | 7205615 |
| 290 | 2880493260 | 2880489317 | Bacteria | 7096270 |
| 291 | 2880499045 | 2880495981 | Bacteria | 7340502 |
| 292 | 2887483855 | 2887478801 | Bacteria | 8972725 |
| 293 | 2929227631 | 2929226422 | Bacteria | 7248583 |
| 294 | 649811613 | 649633069 | Bacteria | 6962533 |
| 295 | 8001783638 | 8001781756 | Bacteria | 9586736 |
| 296 | 8003858584 | 8003856774 | Bacteria | 7675274 |
| 297 | 8003875847 | 8003870546 | Bacteria | 7396674 |
| 298 | 8046355795 | 8046352972 | Bacteria | 3613806 |
| 299 | 8054705049 | 8054704163 | Bacteria | 7247792 |
| 300 | 8054730654 | 8054727385 | Bacteria | 7558670 |
| 301 | 8054735966 | 8054734606 | Bacteria | 6947278 |
| 302 | Ga0466967_0219321 | |||
| 303 | JGI24737J22298_10030814 | |||
| 304 | JGI25406J46586_10023143 | |||
| 305 | rootH1_10058328 | |||
| 306 | rootH1_10111601 | |||
| 307 | Ga0070658_10147535 | |||
| 308 | Ga0070658_10353021 | |||
| 309 | Ga0070658_10526091 | |||
| 310 | Ga0070658_10558427 | |||
| 311 | Ga0070683_100234547 | |||
| 312 | Ga0070670_100378113 | |||
| 313 | Ga0070682_100107505 | |||
| 314 | Ga0070682_100493076 | |||
| 315 | Ga0068868_100185388 | |||
| 316 | Ga0070661_100340683 | |||
| 317 | Ga0070668_100004532 | |||
| 318 | Ga0070668_100050718 | |||
| 319 | Ga0070675_100593981 | |||
| 320 | Ga0070671_100518720 | |||
| 321 | Ga0070659_100578323 | |||
| 322 | Ga0070667_100064960 | |||
| 323 | Ga0070667_100075198 | |||
| 324 | Ga0070710_10690928 | |||
| 325 | Ga0070700_100577095 | |||
| 326 | Ga0070663_100048154 | |||
| 327 | Ga0070678_101038535 | |||
| 328 | Ga0068867_100935593 | |||
| 329 | Ga0070685_10087195 | |||
| 330 | Ga0070679_100232307 | |||
| 331 | Ga0070679_100364695 | |||
| 332 | Ga0070679_101010658 | |||
| 333 | Ga0070686_101244557 | |||
| 334 | Ga0070693_100642775 | |||
| 335 | Ga0070665_100424413 | |||
| 336 | Ga0070665_100832981 | |||
| 337 | Ga0070664_100155781 | |||
| 338 | Ga0068857_100332379 | |||
| 339 | Ga0068856_101328916 | |||
| 340 | Ga0068852_100308644 | |||
| 341 | Ga0068864_100738711 | |||
| 342 | Ga0068866_10247397 | |||
| 343 | Ga0068861_100495961 | |||
| 344 | Ga0068870_10118965 | |||
| 345 | Ga0068863_100428375 | |||
| 346 | Ga0068863_100633758 | |||
| 347 | Ga0068860_100103193 | |||
| 348 | Ga0068860_100446521 | |||
| 349 | Ga0081455_10066943 | |||
| 350 | Ga0081540_1063580 | |||
| 351 | Ga0081539_10000456 | |||
| 352 | Ga0081539_10003649 | |||
| 353 | Ga0081539_10005425 | |||
| 354 | Ga0081539_10012084 | |||
| 355 | Ga0070717_10345368 | |||
| 356 | Ga0070717_11017598 | |||
| 357 | Ga0070712_100327096 | |||
| 358 | Ga0070712_101708366 | |||
| 359 | Ga0075428_100044958 | |||
| 360 | Ga0075428_101779306 | |||
| 361 | Ga0075430_101347251 | |||
| 362 | Ga0075431_100256525 | |||
| 363 | Ga0068865_100234644 | |||
| 364 | Ga0105251_10042340 | |||
| 365 | Ga0105240_10523082 | |||
| 366 | Ga0105240_11625831 | |||
| 367 | Ga0105245_10281681 | |||
| 368 | Ga0105245_10769863 | |||
| 369 | Ga0105247_10691671 | |||
| 370 | Ga0114129_10831692 | |||
| 371 | Ga0114129_11065136 | |||
| 372 | Ga0105243_11338535 | |||
| 373 | Ga0105242_11966006 | |||
| 374 | Ga0105242_12035078 | |||
| 375 | Ga0105248_10852699 | |||
| 376 | Ga0105237_11589566 | |||
| 377 | Ga0105237_12016729 | |||
| 378 | Ga0105238_10391942 | |||
| 379 | Ga0105238_10874034 | |||
| 380 | Ga0105028_112160 | |||
| 381 | Ga0105239_11378204 | |||
| 382 | Ga0105246_10752470 | |||
| 383 | Ga0157369_10055984 | |||
| 384 | Ga0157374_10983781 | |||
| 385 | Ga0157374_11573552 | |||
| 386 | Ga0157378_10926236 | |||
| 387 | Ga0163162_10857622 | |||
| 388 | Ga0157372_10174076 | |||
| 389 | Ga0157375_10986613 | |||
| 390 | Ga0157375_11287963 | |||
| 391 | Ga0163163_10368612 | |||
| 392 | Ga0163163_11253405 | |||
| 393 | Ga0157380_10256921 | |||
| 394 | Ga0157379_10198888 | |||
| 395 | Ga0157376_10900002 | |||
| 396 | Ga0163161_10098209 | |||
| 397 | Ga0206356_10044827 | |||
| 398 | Ga0154015_1254536 | |||
| 399 | Ga0207688_10641552 | |||
| 400 | Ga0207699_11058368 | |||
| 401 | Ga0207705_10804967 | |||
| 402 | Ga0207654_10209053 | |||
| 403 | Ga0207654_10898054 | |||
| 404 | Ga0207662_10160425 | |||
| 405 | Ga0207657_10713579 | |||
| 406 | Ga0207652_10075650 | |||
| 407 | Ga0207652_10236135 | |||
| 408 | Ga0207652_10386007 | |||
| 409 | Ga0207652_11475175 | |||
| 410 | Ga0207652_11689346 | |||
| 411 | Ga0207650_10875729 | |||
| 412 | Ga0207687_10204547 | |||
| 413 | Ga0207687_10229497 | |||
| 414 | Ga0207687_10723236 | |||
| 415 | Ga0207687_11061701 | |||
| 416 | Ga0207644_10451824 | |||
| 417 | Ga0207670_10527988 | |||
| 418 | Ga0207661_10228376 | |||
| 419 | Ga0207661_10451470 | |||
| 420 | Ga0207679_10656120 | |||
| 421 | Ga0207679_11502506 | |||
| 422 | Ga0207668_10003387 | |||
| 423 | Ga0207668_10021090 | |||
| 424 | Ga0207668_11029119 | |||
| 425 | Ga0207658_10221381 | |||
| 426 | Ga0207658_10304495 | |||
| 427 | Ga0207677_10090737 | |||
| 428 | Ga0207678_10123959 | |||
| 429 | Ga0207678_11266412 | |||
| 430 | Ga0207708_10750981 | |||
| 431 | Ga0207641_10314526 | |||
| 432 | Ga0207676_10169909 | |||
| 433 | Ga0207674_10039494 | |||
| 434 | Ga0207675_100441672 | |||
| 435 | Ga0207675_100879939 | |||
| 436 | Ga0207683_10706812 | |||
| 437 | Ga0207683_11203521 | |||
| 438 | Ga0207698_11220419 | |||
| 439 | Ga0268266_10134739 | |||
| 440 | Ga0268265_10123430 | |||
| 441 | Ga0268265_10191352 | |||
| 442 | Ga0268264_10971114 | |||
| 443 | Ga0268264_11306433 | |||
| 444 | Ga0307517_10148560 | |||
| 445 | Ga0307515_10051561 | |||
| 446 | Ga0307515_10097866 | |||
| 447 | Ga0307515_10161666 | |||
| 448 | Ga0307513_10020682 | |||
| 449 | Ga0307513_10175172 | |||
| 450 | Ga0307513_10579596 | |||
| 451 | Ga0307509_10014161 | |||
| 452 | Ga0307509_10656849 | |||
| 453 | Ga0307508_10019402 | |||
| 454 | Ga0307508_10065188 | |||
| 455 | Ga0307516_10010957 | |||
| 456 | Ga0307516_10014056 | |||
| 457 | Ga0307405_10033631 | |||
| 458 | Ga0307405_10088305 | |||
| 459 | Ga0307405_10239592 | |||
| 460 | Ga0307413_10017776 | |||
| 461 | Ga0307413_10030465 | |||
| 462 | Ga0307410_10333479 | |||
| 463 | Ga0326468_10000941 | |||
| 464 | Ga0307406_10047034 | |||
| 465 | Ga0307406_10107261 | |||
| 466 | Ga0307407_10762399 | |||
| 467 | Ga0307409_100018635 | |||
| 468 | Ga0307409_100157687 | |||
| 469 | Ga0307416_100171973 | |||
| 470 | Ga0307416_101022637 | |||
| 471 | Ga0307414_10163109 | |||
| 472 | Ga0307411_10055951 | |||
| 473 | Ga0307415_100202988 | |||
| 474 | Ga0307415_100269318 | |||
| 475 | Ga0307415_100285561 | |||
| 476 | Ga0307415_100396870 | |||
| 477 | Ga0307415_100797101 | |||
| 478 | Ga0307507_10037457 | |||
| 479 | Ga0307507_10296574 | |||
| 480 | Ga0307507_10468839 | |||
| 481 | Ga0307510_10207977 | |||
| 482 | Ga0373932_0038166 | |||
| 483 | Ga0373942_0000472 | |||
| 484 | Ga0373942_0153919 | |||
| 485 | Ga0373962_0002632 | |||
| 486 | Ga0373935_0028733 | |||
| 487 | Ga0373937_0219403 | |||
| 488 | Ga0395898_0663690 | |||
| 489 | Ga0395901_0186113 | |||
| 490 | Ga0395901_0311496 | |||
| 491 | Ga0451793_0130346 | |||
| 492 | Ga0451797_0436408 | |||
| 493 | Ga0451798_0168685 | |||
| 494 | Ga0451802_0483349 | |||
| 495 | Ga0451804_0100590 | |||
| 496 | Ga0451853_1474361 | |||
| 497 | Ga0439440_0107168 | |||
| 498 | Ga0466972_0004156 | |||
| 499 | Ga0466965_0083774 | |||
| 500 | Ga0466966_0145548 | |||
| 501 | Ga0466966_0836983 | |||
| 502 | Ga0466963_0018717 | |||
| 503 | Ga0466963_0596023 | |||
| 504 | Ga0466963_0879901 | |||
| 505 | Ga0466971_0122721 | |||
| 506 | Ga0466957_0337435 | |||
| 507 | Ga0466957_0344279 | |||
| 508 | Ga0466960_0000588 | |||
| 509 | Ga0466959_0080435 | |||
| 510 | Ga0466959_0540852 | |||
| 511 | Ga0466958_0106570 | |||
| 512 | Ga0466958_0170322 | |||
| 513 | Ga0466958_0200515 | |||
| 514 | Ga0466967_0056554 | |||
| 515 | Ga0495638_0184181 | |||
| 516 | Ga0495641_0052277 | |||
| 517 | Ga0495606_0001201 | |||
| 518 | Ga0495632_0150652 | |||
| 519 | Ga0495668_0000322 | |||
| 520 | Ga0495625_0001096 | |||
| 521 | Ga0495649_0520888 | |||
| 522 | Ga0495683_0064546 | |||
| 523 | Ga0495626_0000175 | |||
| 524 | Ga0496100_0024710 | |||
| 525 | Ga0496100_0203667 | |||
| 526 | Ga0496101_0251996 | |||
| 527 | Ga0496106_0282103 | |||
| 528 | Ga0496107_0286203 | |||
| 529 | Ga0496108_0000079 | |||
| 530 | Ga0496108_1549485 | |||
| 531 | Ga0496112_0194944 | |||
| 532 | Ga0496115_0795696 | |||
| 533 | Ga0496124_0467937 | |||
| 534 | Ga0501031_0552384 | |||
| 535 | Ga0501032_0116399 | |||
| 536 | Ga0501033_0001842 | |||
| 537 | Ga0501033_0151297 | |||
| 538 | Ga0501034_0259655 | |||
| 539 | Ga0501038_0000215 | |||
| 540 | Ga0501039_0041666 | |||
| 541 | Ga0501043_0013681 | |||
| 542 | Ga0501043_0128635 | |||
| 543 | Ga0501046_0000883 | |||
| 544 | Ga0501047_0043698 | |||
| 545 | Ga0501048_0004667 | |||
| 546 | Ga0501067_0479751 | |||
| 547 | Ga0501068_0166871 | |||
| 548 | Ga0501069_0092789 | |||
| 549 | Ga0501070_0030450 | |||
| 550 | Ga0501070_0261476 | |||
| 551 | Ga0501070_1185638 | |||
| 552 | Ga0501072_0129837 | |||
| 553 | Ga0501073_0059895 | |||
| 554 | Ga0501080_0523023 | |||
| 555 | Ga0501035_0317149 | |||
| 556 | Ga0501035_0329627 | |||
| 557 | Ga0501044_0113864 | |||
| 558 | nmdc:mga05p37_1357779_c1 | |||
| 559 | nmdc:mga06r32_7898_c1 | |||
| 560 | nmdc:mga0n895_881313_c1 | |||
| 561 | Ga0500644_0045119 | |||
| 562 | Ga0500646_0189201 | |||
| 563 | Ga0500594_0038786 | |||
| 564 | Ga0500652_013995 | |||
| 565 | Ga0500559_0228214 | |||
| 566 | Ga0500630_177113 | |||
| 567 | Ga0500611_212712 | |||
| 568 | Ga0466962_0295716 | |||
| 569 | Ga0466962_0657287 | |||
| 570 | Ga0530510_0151428 | |||
| 571 | 2501943955 | |||
| 572 | 2515493558 | |||
| 573 | 2515722457 | |||
| 574 | 2515758488 | |||
| 575 | 2516082533 | |||
| 576 | 2516087904 | |||
| 577 | 2753268659 | |||
| 578 | 2772642359 | |||
| 579 | 2855671268 | |||
| 580 | 2855682534 | |||
| 581 | 2855689439 | |||
| 582 | 2856860862 | |||
| 583 | 2857291963 | |||
| 584 | 2858850751 | |||
| 585 | 2858883875 | |||
| 586 | 2858889971 | |||
| 587 | 2858900823 | |||
| 588 | 2869054570 | |||
| 589 | 2869070949 | |||
| 590 | 2880493260 | |||
| 591 | 2880499045 | |||
| 592 | 2887483855 | |||
| 593 | 2929227631 | |||
| 594 | 649811613 | |||
| 595 | 8001783638 | |||
| 596 | 8003858584 | |||
| 597 | 8003875847 | |||
| 598 | 8046355795 | |||
| 599 | 8054705049 | |||
| 600 | 8054730654 | |||
| 601 | 8054735966 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iph-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c84s mutant | 0.945 | 13 | 153 |
| 5io2-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c48s mutant | 0.9414 | 13 | 153 |
| 3ixr-assembly1.cif.gz_A | crystal structure of xylella fastidiosa prxq c47s mutant | 0.9288 | 1 | 153 |
| 5enu-assembly2.cif.gz_B | crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria | 0.922 | 2 | 152 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.9144 | 4 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIE1_7_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9956 | 4 | 153 | 3.40.30.10 |
| af_P9WIE1_7_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9825 | 4 | 153 | 3.40.30.10 |
| af_P0AE52_4_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9682 | 4 | 153 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9504 | 5 | 153 | 3.40.30.10 |
| 5iphA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9449 | 13 | 153 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522QG15-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 1 | 2 | 155 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A4P8STB5-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9993 | 1 | 155 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A317CZZ0-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9982 | 13 | 155 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A4R9AYD8-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9979 | 2 | 155 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A2M9L5J9-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9967 | 2 | 153 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |