F395514

General Info

Members Datasets Scaffolds Average Seq Length
300 218 601 157

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0219321|Ga0466967_0219321_198_674
Length 149
Sequence VTTTRLSPGDTAPDFTLPSDLRGRKVVVYFYPAAMTPGCTTEACDFSDSLDSLKGAGYEVLGISPDAPEKLAKFRENDHLTITLLSDPDRQALEAYGAYGEKQLYGKTVEGVIRSTFVVDEEGRIQIAQYNVKATGHVAKLRRDLGLAS

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
185 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2501939600 Micromonospora sp. L5 Isolate Unclassified
189 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
190 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
191 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
192 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
193 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
194 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
195 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
196 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
197 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
198 2855683550 Micromonospora sp. RP3T Isolate Unclassified
199 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
200 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
201 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
202 2858882152 Micromonospora noduli MED15 Isolate Nodule
203 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
204 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
205 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
206 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
207 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
208 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
209 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
210 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
211 649633069 Micromonospora sp. L5 Isolate Unclassified
212 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
213 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
214 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
215 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
216 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
217 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
218 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89
Metatranscriptomes 0.67
Isolates 10.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 1.67
Rhizoplane 4.67
Rhizosphere 79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0219321 3300045976 Bacteria 1807
2 JGI24737J22298_10030814 3300001990 Bacteria 1677
3 JGI25406J46586_10023143 3300003203 Bacteria 2459
4 rootH1_10058328 3300003316 Bacteria 7413
5 rootH1_10058328 3300003323 Bacteria 2451
6 rootH1_10111601 3300003316 Bacteria 3409
7 Ga0070658_10147535 3300005327 Bacteria 1968
8 Ga0070658_10353021 3300005327 Bacteria 1259
9 Ga0070658_10526091 3300005327 Bacteria 1023
10 Ga0070658_10558427 3300005327 Bacteria 991
11 Ga0070683_100234547 3300005329 Bacteria 1744
12 Ga0070670_100378113 3300005331 Bacteria 1247
13 Ga0070682_100107505 3300005337 Bacteria 1853
14 Ga0070682_100493076 3300005337 Bacteria 947
15 Ga0068868_100185388 3300005338 Bacteria 1728
16 Ga0070661_100340683 3300005344 Bacteria 1174
17 Ga0070668_100004532 3300005347 Bacteria 10309
18 Ga0070668_100050718 3300005347 Bacteria 3196
19 Ga0070675_100593981 3300005354 Bacteria 1004
20 Ga0070671_100518720 3300005355 Bacteria 1026
21 Ga0070659_100578323 3300005366 Bacteria 963
22 Ga0070667_100064960 3300005367 Bacteria 3098
23 Ga0070667_100075198 3300005367 Bacteria 2883
24 Ga0070710_10690928 3300005437 Bacteria 719
25 Ga0070700_100577095 3300005441 Bacteria 877
26 Ga0070663_100048154 3300005455 Bacteria 3021
27 Ga0070678_101038535 3300005456 Bacteria 755
28 Ga0068867_100935593 3300005459 Bacteria 782
29 Ga0070685_10087195 3300005466 Bacteria 1883
30 Ga0070679_100232307 3300005530 Bacteria 1804
31 Ga0070679_100364695 3300005530 Bacteria 1392
32 Ga0070679_101010658 3300005530 Bacteria 776
33 Ga0070686_101244557 3300005544 Bacteria 620
34 Ga0070693_100642775 3300005547 Bacteria 771
35 Ga0070665_100424413 3300005548 Bacteria 1338
36 Ga0070665_100832981 3300005548 Bacteria 936
37 Ga0070664_100155781 3300005564 Bacteria 2018
38 Ga0068857_100332379 3300005577 Bacteria 1405
39 Ga0068856_101328916 3300005614 Bacteria 734
40 Ga0068852_100308644 3300005616 Bacteria 1533
41 Ga0068864_100738711 3300005618 Bacteria 964
42 Ga0068866_10247397 3300005718 Bacteria 1089
43 Ga0068861_100495961 3300005719 Bacteria 1103
44 Ga0068870_10118965 3300005840 Bacteria 1519
45 Ga0068863_100428375 3300005841 Bacteria 1297
46 Ga0068863_100633758 3300005841 Bacteria 1059
47 Ga0068860_100103193 3300005843 Bacteria 2722
48 Ga0068860_100446521 3300005843 Bacteria 1285
49 Ga0081455_10066943 3300005937 Bacteria 2996
50 Ga0081540_1063580 3300005983 Bacteria 1746
51 Ga0081539_10000456 3300005985 Bacteria 86722
52 Ga0081539_10003649 3300005985 Bacteria 18523
53 Ga0081539_10005425 3300005985 Bacteria 13027
54 Ga0081539_10012084 3300005985 Bacteria 6710
55 Ga0070717_10345368 3300006028 Bacteria 1330
56 Ga0070717_11017598 3300006028 Bacteria 755
57 Ga0070712_100327096 3300006175 Bacteria 1248
58 Ga0070712_101708366 3300006175 Bacteria 551
59 Ga0075428_100044958 3300006844 Bacteria 4853
60 Ga0075428_101779306 3300006844 Bacteria 642
61 Ga0075430_101347251 3300006846 Bacteria 587
62 Ga0075431_100256525 3300006847 Bacteria 1775
63 Ga0068865_100234644 3300006881 Bacteria 1441
64 Ga0105251_10042340 3300009011 Bacteria 2211
65 Ga0105240_10523082 3300009093 Bacteria 1316
66 Ga0105240_11625831 3300009093 Bacteria 675
67 Ga0105245_10281681 3300009098 Bacteria 1625
68 Ga0105245_10769863 3300009098 Bacteria 999
69 Ga0105247_10691671 3300009101 Bacteria 766
70 Ga0114129_10831692 3300009147 Bacteria 1175
71 Ga0114129_11065136 3300009147 Bacteria 1014
72 Ga0105243_11338535 3300009148 Bacteria 735
73 Ga0105242_11966006 3300009176 Bacteria 626
74 Ga0105242_12035078 3300009176 Bacteria 617
75 Ga0105248_10852699 3300009177 Bacteria 1028
76 Ga0105237_11589566 3300009545 Bacteria 661
77 Ga0105237_12016729 3300009545 Bacteria 586
78 Ga0105238_10391942 3300009551 Bacteria 1381
79 Ga0105238_10874034 3300009551 Bacteria 917
80 Ga0105028_112160 3300009993 Bacteria 909
81 Ga0105239_11378204 3300010375 Bacteria 814
82 Ga0105246_10752470 3300011119 Bacteria 860
83 Ga0157369_10055984 3300013105 Bacteria 4256
84 Ga0157374_10983781 3300013296 Bacteria 863
85 Ga0157374_11573552 3300013296 Bacteria 681
86 Ga0157378_10926236 3300013297 Bacteria 903
87 Ga0163162_10857622 3300013306 Bacteria 1023
88 Ga0157372_10174076 3300013307 Bacteria 2491
89 Ga0157375_10986613 3300013308 Bacteria 983
90 Ga0157375_11287963 3300013308 Bacteria 859
91 Ga0163163_10368612 3300014325 Bacteria 1493
92 Ga0163163_11253405 3300014325 Bacteria 804
93 Ga0157380_10256921 3300014326 Bacteria 1585
94 Ga0157379_10198888 3300014968 Bacteria 1812
95 Ga0157376_10900002 3300014969 Bacteria 903
96 Ga0163161_10098209 3300017792 Bacteria 2176
97 Ga0206356_10044827 3300020070 Bacteria 1130
98 Ga0154015_1254536 3300020610 Bacteria 717
99 Ga0207688_10641552 3300025901 Bacteria 670
100 Ga0207699_11058368 3300025906 Bacteria 600
101 Ga0207705_10804967 3300025909 Bacteria 729
102 Ga0207654_10209053 3300025911 Bacteria 1289
103 Ga0207654_10898054 3300025911 Bacteria 642
104 Ga0207662_10160425 3300025918 Bacteria 1436
105 Ga0207657_10713579 3300025919 Bacteria 778
106 Ga0207652_10075650 3300025921 Bacteria 2935
107 Ga0207652_10236135 3300025921 Bacteria 1648
108 Ga0207652_10386007 3300025921 Bacteria 1264
109 Ga0207652_11475175 3300025921 Bacteria 584
110 Ga0207652_11689346 3300025921 Bacteria 538
111 Ga0207650_10875729 3300025925 Bacteria 762
112 Ga0207687_10204547 3300025927 Bacteria 1545
113 Ga0207687_10229497 3300025927 Bacteria 1466
114 Ga0207687_10723236 3300025927 Bacteria 846
115 Ga0207687_11061701 3300025927 Bacteria 695
116 Ga0207644_10451824 3300025931 Bacteria 1056
117 Ga0207670_10527988 3300025936 Bacteria 962
118 Ga0207661_10228376 3300025944 Bacteria 1647
119 Ga0207661_10451470 3300025944 Bacteria 1171
120 Ga0207679_10656120 3300025945 Bacteria 949
121 Ga0207679_11502506 3300025945 Bacteria 618
122 Ga0207668_10003387 3300025972 Bacteria 9346
123 Ga0207668_10021090 3300025972 Bacteria 4152
124 Ga0207668_11029119 3300025972 Bacteria 737
125 Ga0207658_10221381 3300025986 Bacteria 1592
126 Ga0207658_10304495 3300025986 Bacteria 1374
127 Ga0207677_10090737 3300026023 Bacteria 2221
128 Ga0207678_10123959 3300026067 Bacteria 2205
129 Ga0207678_11266412 3300026067 Bacteria 653
130 Ga0207708_10750981 3300026075 Bacteria 837
131 Ga0207641_10314526 3300026088 Bacteria 1483
132 Ga0207676_10169909 3300026095 Bacteria 1898
133 Ga0207674_10039494 3300026116 Bacteria 4891
134 Ga0207675_100441672 3300026118 Bacteria 1288
135 Ga0207675_100879939 3300026118 Bacteria 911
136 Ga0207683_10706812 3300026121 Bacteria 935
137 Ga0207683_11203521 3300026121 Bacteria 702
138 Ga0207698_11220419 3300026142 Bacteria 766
139 Ga0268266_10134739 3300028379 Bacteria 2211
140 Ga0268265_10123430 3300028380 Bacteria 2138
141 Ga0268265_10191352 3300028380 Bacteria 1767
142 Ga0268264_10971114 3300028381 Bacteria 855
143 Ga0268264_11306433 3300028381 Bacteria 735
144 Ga0307517_10148560 3300028786 Bacteria 1617
145 Ga0307515_10051561 3300028794 Bacteria 6131
146 Ga0307515_10097866 3300028794 Bacteria 3580
147 Ga0307515_10161666 3300028794 Bacteria 2280
148 Ga0307513_10020682 3300031456 Bacteria 7795
149 Ga0307513_10175172 3300031456 Bacteria 2016
150 Ga0307513_10579596 3300031456 Bacteria 832
151 Ga0307509_10014161 3300031507 Bacteria 9402
152 Ga0307509_10656849 3300031507 Bacteria 717
153 Ga0307508_10019402 3300031616 Bacteria 6181
154 Ga0307508_10065188 3300031616 Bacteria 3210
155 Ga0307516_10010957 3300031730 Bacteria 9910
156 Ga0307516_10014056 3300031730 Bacteria 8487
157 Ga0307405_10033631 3300031731 Bacteria 3043
158 Ga0307405_10088305 3300031731 Bacteria 2045
159 Ga0307405_10239592 3300031731 Bacteria 1343
160 Ga0307413_10017776 3300031824 Bacteria 3712
161 Ga0307413_10030465 3300031824 Bacteria 3031
162 Ga0307410_10333479 3300031852 Bacteria 1207
163 Ga0326468_10000941 3300031889 Bacteria 2817
164 Ga0307406_10047034 3300031901 Bacteria 2717
165 Ga0307406_10107261 3300031901 Bacteria 1915
166 Ga0307407_10762399 3300031903 Bacteria 733
167 Ga0307409_100018635 3300031995 Bacteria 4674
168 Ga0307409_100157687 3300031995 Bacteria 1980
169 Ga0307416_100171973 3300032002 Bacteria 2018
170 Ga0307416_101022637 3300032002 Bacteria 930
171 Ga0307414_10163109 3300032004 Bacteria 1773
172 Ga0307411_10055951 3300032005 Bacteria 2598
173 Ga0307415_100202988 3300032126 Bacteria 1575
174 Ga0307415_100269318 3300032126 Bacteria 1394
175 Ga0307415_100285561 3300032126 Bacteria 1359
176 Ga0307415_100396870 3300032126 Bacteria 1176
177 Ga0307415_100797101 3300032126 Bacteria 862
178 Ga0307507_10037457 3300033179 Bacteria 4936
179 Ga0307507_10296574 3300033179 Bacteria 995
180 Ga0307507_10468839 3300033179 Bacteria 689
181 Ga0307510_10207977 3300033180 Bacteria 1483
182 Ga0373932_0038166 3300035112 Bacteria 1372
183 Ga0373942_0000472 3300035207 Bacteria 11414
184 Ga0373942_0153919 3300035207 Bacteria 740
185 Ga0373962_0002632 3300035242 Bacteria 4268
186 Ga0373935_0028733 3300035692 Bacteria 3437
187 Ga0373937_0219403 3300036401 Bacteria 1790
188 Ga0395898_0663690 3300037466 Bacteria 985
189 Ga0395901_0186113 3300038443 Bacteria 2178
190 Ga0395901_0311496 3300038443 Bacteria 1630
191 Ga0451793_0130346 3300041452 Bacteria 631
192 Ga0451797_0436408 3300041453 Bacteria 598
193 Ga0451798_0168685 3300041458 Bacteria 554
194 Ga0451802_0483349 3300041460 Bacteria 627
195 Ga0451804_0100590 3300041463 Bacteria 600
196 Ga0451853_1474361 3300041512 Bacteria 5695
197 Ga0439440_0107168 3300042993 Bacteria 766
198 Ga0466972_0004156 3300044658 Bacteria 7225
199 Ga0466965_0083774 3300044683 Bacteria 1614
200 Ga0466966_0145548 3300044684 Bacteria 1447
201 Ga0466966_0836983 3300044684 Bacteria 555
202 Ga0466963_0018717 3300044694 Bacteria 4335
203 Ga0466963_0596023 3300044694 Bacteria 780
204 Ga0466963_0879901 3300044694 Bacteria 631
205 Ga0466971_0122721 3300044719 Bacteria 1203
206 Ga0466957_0337435 3300044842 Bacteria 1020
207 Ga0466957_0344279 3300044842 Bacteria 1010
208 Ga0466960_0000588 3300044901 Bacteria 12592
209 Ga0466959_0080435 3300045049 Bacteria 2349
210 Ga0466959_0540852 3300045049 Bacteria 786
211 Ga0466958_0106570 3300045836 Bacteria 1747
212 Ga0466958_0170322 3300045836 Bacteria 1379
213 Ga0466958_0200515 3300045836 Bacteria 1270
214 Ga0466967_0056554 3300045976 Bacteria 3460
215 Ga0495638_0184181 3300046460 Bacteria 1189
216 Ga0495641_0052277 3300046461 Bacteria 1863
217 Ga0495606_0001201 3300046507 Bacteria 36440
218 Ga0495632_0150652 3300046519 Bacteria 1075
219 Ga0495668_0000322 3300046616 Bacteria 65565
220 Ga0495625_0001096 3300046660 Bacteria 35139
221 Ga0495649_0520888 3300046694 Bacteria 590
222 Ga0495683_0064546 3300047323 Bacteria 1808
223 Ga0495626_0000175 3300048091 Bacteria 79583
224 Ga0496100_0024710 3300048903 Bacteria 3667
225 Ga0496100_0203667 3300048903 Bacteria 1444
226 Ga0496101_0251996 3300048904 Bacteria 1376
227 Ga0496106_0282103 3300048909 Bacteria 1331
228 Ga0496107_0286203 3300048910 Bacteria 1227
229 Ga0496108_0000079 3300048911 Bacteria 103605
230 Ga0496108_1549485 3300048911 Bacteria 550
231 Ga0496112_0194944 3300048915 Bacteria 1987
232 Ga0496115_0795696 3300048918 Bacteria 736
233 Ga0496124_0467937 3300048927 Bacteria 855
234 Ga0501031_0552384 3300049568 Bacteria 742
235 Ga0501032_0116399 3300049569 Bacteria 1767
236 Ga0501033_0001842 3300049570 Bacteria 18461
237 Ga0501033_0151297 3300049570 Bacteria 1674
238 Ga0501034_0259655 3300049571 Bacteria 1680
239 Ga0501038_0000215 3300049574 Bacteria 49658
240 Ga0501039_0041666 3300049575 Bacteria 3548
241 Ga0501043_0013681 3300049579 Bacteria 6351
242 Ga0501043_0128635 3300049579 Bacteria 1985
243 Ga0501046_0000883 3300049580 Bacteria 29184
244 Ga0501047_0043698 3300049581 Bacteria 4328
245 Ga0501048_0004667 3300049582 Bacteria 10428
246 Ga0501067_0479751 3300049583 Bacteria 695
247 Ga0501068_0166871 3300049584 Bacteria 1389
248 Ga0501069_0092789 3300049585 Bacteria 1708
249 Ga0501070_0030450 3300049586 Bacteria 4522
250 Ga0501070_0261476 3300049586 Bacteria 1414
251 Ga0501070_1185638 3300049586 Bacteria 586
252 Ga0501072_0129837 3300049588 Bacteria 2008
253 Ga0501073_0059895 3300049589 Bacteria 2658
254 Ga0501080_0523023 3300049742 Bacteria 1058
255 Ga0501035_0317149 3300049822 Bacteria 1310
256 Ga0501035_0329627 3300049822 Bacteria 1281
257 Ga0501044_0113864 3300049823 Bacteria 2711
258 nmdc:mga05p37_1357779_c1 3300050507 Bacteria 719
259 nmdc:mga06r32_7898_c1 3300050510 Bacteria 9562
260 nmdc:mga0n895_881313_c1 3300050512 Bacteria 881
261 Ga0500644_0045119 3300053088 Bacteria 1483
262 Ga0500646_0189201 3300053090 Bacteria 701
263 Ga0500594_0038786 3300053118 Bacteria 1292
264 Ga0500652_013995 3300053131 Bacteria 2858
265 Ga0500559_0228214 3300053136 Bacteria 878
266 Ga0500630_177113 3300053159 Bacteria 865
267 Ga0500611_212712 3300053727 Bacteria 550
268 Ga0466962_0295716 3300061719 Bacteria 800
269 Ga0466962_0657287 3300061719 Bacteria 536
270 Ga0530510_0151428 3300061734 Bacteria 1713
271 2501943955 2501939600 Bacteria 6907073
272 2515493558 2515154088 Bacteria 5526283
273 2515722457 2515154129 Bacteria 5584369
274 2515758488 2515154137 Bacteria 5711575
275 2516082533 2515154202 Bacteria 5471270
276 2516087904 2515154203 Bacteria 5458536
277 2753268659 2751185782 Bacteria 11227053
278 2772642359 2772190715 Bacteria 6959372
279 2855671268 2855670206 Bacteria 7120389
280 2855682534 2855676851 Bacteria 7063653
281 2855689439 2855683550 Bacteria 7134265
282 2856860862 2856858025 Bacteria 7255264
283 2857291963 2857288857 Bacteria 7189066
284 2858850751 2858848962 Bacteria 6963058
285 2858883875 2858882152 Bacteria 7230291
286 2858889971 2858888857 Bacteria 7060307
287 2858900823 2858895516 Bacteria 7378898
288 2869054570 2869048445 Bacteria 6875584
289 2869070949 2869068681 Bacteria 7205615
290 2880493260 2880489317 Bacteria 7096270
291 2880499045 2880495981 Bacteria 7340502
292 2887483855 2887478801 Bacteria 8972725
293 2929227631 2929226422 Bacteria 7248583
294 649811613 649633069 Bacteria 6962533
295 8001783638 8001781756 Bacteria 9586736
296 8003858584 8003856774 Bacteria 7675274
297 8003875847 8003870546 Bacteria 7396674
298 8046355795 8046352972 Bacteria 3613806
299 8054705049 8054704163 Bacteria 7247792
300 8054730654 8054727385 Bacteria 7558670
301 8054735966 8054734606 Bacteria 6947278
302 Ga0466967_0219321
303 JGI24737J22298_10030814
304 JGI25406J46586_10023143
305 rootH1_10058328
306 rootH1_10111601
307 Ga0070658_10147535
308 Ga0070658_10353021
309 Ga0070658_10526091
310 Ga0070658_10558427
311 Ga0070683_100234547
312 Ga0070670_100378113
313 Ga0070682_100107505
314 Ga0070682_100493076
315 Ga0068868_100185388
316 Ga0070661_100340683
317 Ga0070668_100004532
318 Ga0070668_100050718
319 Ga0070675_100593981
320 Ga0070671_100518720
321 Ga0070659_100578323
322 Ga0070667_100064960
323 Ga0070667_100075198
324 Ga0070710_10690928
325 Ga0070700_100577095
326 Ga0070663_100048154
327 Ga0070678_101038535
328 Ga0068867_100935593
329 Ga0070685_10087195
330 Ga0070679_100232307
331 Ga0070679_100364695
332 Ga0070679_101010658
333 Ga0070686_101244557
334 Ga0070693_100642775
335 Ga0070665_100424413
336 Ga0070665_100832981
337 Ga0070664_100155781
338 Ga0068857_100332379
339 Ga0068856_101328916
340 Ga0068852_100308644
341 Ga0068864_100738711
342 Ga0068866_10247397
343 Ga0068861_100495961
344 Ga0068870_10118965
345 Ga0068863_100428375
346 Ga0068863_100633758
347 Ga0068860_100103193
348 Ga0068860_100446521
349 Ga0081455_10066943
350 Ga0081540_1063580
351 Ga0081539_10000456
352 Ga0081539_10003649
353 Ga0081539_10005425
354 Ga0081539_10012084
355 Ga0070717_10345368
356 Ga0070717_11017598
357 Ga0070712_100327096
358 Ga0070712_101708366
359 Ga0075428_100044958
360 Ga0075428_101779306
361 Ga0075430_101347251
362 Ga0075431_100256525
363 Ga0068865_100234644
364 Ga0105251_10042340
365 Ga0105240_10523082
366 Ga0105240_11625831
367 Ga0105245_10281681
368 Ga0105245_10769863
369 Ga0105247_10691671
370 Ga0114129_10831692
371 Ga0114129_11065136
372 Ga0105243_11338535
373 Ga0105242_11966006
374 Ga0105242_12035078
375 Ga0105248_10852699
376 Ga0105237_11589566
377 Ga0105237_12016729
378 Ga0105238_10391942
379 Ga0105238_10874034
380 Ga0105028_112160
381 Ga0105239_11378204
382 Ga0105246_10752470
383 Ga0157369_10055984
384 Ga0157374_10983781
385 Ga0157374_11573552
386 Ga0157378_10926236
387 Ga0163162_10857622
388 Ga0157372_10174076
389 Ga0157375_10986613
390 Ga0157375_11287963
391 Ga0163163_10368612
392 Ga0163163_11253405
393 Ga0157380_10256921
394 Ga0157379_10198888
395 Ga0157376_10900002
396 Ga0163161_10098209
397 Ga0206356_10044827
398 Ga0154015_1254536
399 Ga0207688_10641552
400 Ga0207699_11058368
401 Ga0207705_10804967
402 Ga0207654_10209053
403 Ga0207654_10898054
404 Ga0207662_10160425
405 Ga0207657_10713579
406 Ga0207652_10075650
407 Ga0207652_10236135
408 Ga0207652_10386007
409 Ga0207652_11475175
410 Ga0207652_11689346
411 Ga0207650_10875729
412 Ga0207687_10204547
413 Ga0207687_10229497
414 Ga0207687_10723236
415 Ga0207687_11061701
416 Ga0207644_10451824
417 Ga0207670_10527988
418 Ga0207661_10228376
419 Ga0207661_10451470
420 Ga0207679_10656120
421 Ga0207679_11502506
422 Ga0207668_10003387
423 Ga0207668_10021090
424 Ga0207668_11029119
425 Ga0207658_10221381
426 Ga0207658_10304495
427 Ga0207677_10090737
428 Ga0207678_10123959
429 Ga0207678_11266412
430 Ga0207708_10750981
431 Ga0207641_10314526
432 Ga0207676_10169909
433 Ga0207674_10039494
434 Ga0207675_100441672
435 Ga0207675_100879939
436 Ga0207683_10706812
437 Ga0207683_11203521
438 Ga0207698_11220419
439 Ga0268266_10134739
440 Ga0268265_10123430
441 Ga0268265_10191352
442 Ga0268264_10971114
443 Ga0268264_11306433
444 Ga0307517_10148560
445 Ga0307515_10051561
446 Ga0307515_10097866
447 Ga0307515_10161666
448 Ga0307513_10020682
449 Ga0307513_10175172
450 Ga0307513_10579596
451 Ga0307509_10014161
452 Ga0307509_10656849
453 Ga0307508_10019402
454 Ga0307508_10065188
455 Ga0307516_10010957
456 Ga0307516_10014056
457 Ga0307405_10033631
458 Ga0307405_10088305
459 Ga0307405_10239592
460 Ga0307413_10017776
461 Ga0307413_10030465
462 Ga0307410_10333479
463 Ga0326468_10000941
464 Ga0307406_10047034
465 Ga0307406_10107261
466 Ga0307407_10762399
467 Ga0307409_100018635
468 Ga0307409_100157687
469 Ga0307416_100171973
470 Ga0307416_101022637
471 Ga0307414_10163109
472 Ga0307411_10055951
473 Ga0307415_100202988
474 Ga0307415_100269318
475 Ga0307415_100285561
476 Ga0307415_100396870
477 Ga0307415_100797101
478 Ga0307507_10037457
479 Ga0307507_10296574
480 Ga0307507_10468839
481 Ga0307510_10207977
482 Ga0373932_0038166
483 Ga0373942_0000472
484 Ga0373942_0153919
485 Ga0373962_0002632
486 Ga0373935_0028733
487 Ga0373937_0219403
488 Ga0395898_0663690
489 Ga0395901_0186113
490 Ga0395901_0311496
491 Ga0451793_0130346
492 Ga0451797_0436408
493 Ga0451798_0168685
494 Ga0451802_0483349
495 Ga0451804_0100590
496 Ga0451853_1474361
497 Ga0439440_0107168
498 Ga0466972_0004156
499 Ga0466965_0083774
500 Ga0466966_0145548
501 Ga0466966_0836983
502 Ga0466963_0018717
503 Ga0466963_0596023
504 Ga0466963_0879901
505 Ga0466971_0122721
506 Ga0466957_0337435
507 Ga0466957_0344279
508 Ga0466960_0000588
509 Ga0466959_0080435
510 Ga0466959_0540852
511 Ga0466958_0106570
512 Ga0466958_0170322
513 Ga0466958_0200515
514 Ga0466967_0056554
515 Ga0495638_0184181
516 Ga0495641_0052277
517 Ga0495606_0001201
518 Ga0495632_0150652
519 Ga0495668_0000322
520 Ga0495625_0001096
521 Ga0495649_0520888
522 Ga0495683_0064546
523 Ga0495626_0000175
524 Ga0496100_0024710
525 Ga0496100_0203667
526 Ga0496101_0251996
527 Ga0496106_0282103
528 Ga0496107_0286203
529 Ga0496108_0000079
530 Ga0496108_1549485
531 Ga0496112_0194944
532 Ga0496115_0795696
533 Ga0496124_0467937
534 Ga0501031_0552384
535 Ga0501032_0116399
536 Ga0501033_0001842
537 Ga0501033_0151297
538 Ga0501034_0259655
539 Ga0501038_0000215
540 Ga0501039_0041666
541 Ga0501043_0013681
542 Ga0501043_0128635
543 Ga0501046_0000883
544 Ga0501047_0043698
545 Ga0501048_0004667
546 Ga0501067_0479751
547 Ga0501068_0166871
548 Ga0501069_0092789
549 Ga0501070_0030450
550 Ga0501070_0261476
551 Ga0501070_1185638
552 Ga0501072_0129837
553 Ga0501073_0059895
554 Ga0501080_0523023
555 Ga0501035_0317149
556 Ga0501035_0329627
557 Ga0501044_0113864
558 nmdc:mga05p37_1357779_c1
559 nmdc:mga06r32_7898_c1
560 nmdc:mga0n895_881313_c1
561 Ga0500644_0045119
562 Ga0500646_0189201
563 Ga0500594_0038786
564 Ga0500652_013995
565 Ga0500559_0228214
566 Ga0500630_177113
567 Ga0500611_212712
568 Ga0466962_0295716
569 Ga0466962_0657287
570 Ga0530510_0151428
571 2501943955
572 2515493558
573 2515722457
574 2515758488
575 2516082533
576 2516087904
577 2753268659
578 2772642359
579 2855671268
580 2855682534
581 2855689439
582 2856860862
583 2857291963
584 2858850751
585 2858883875
586 2858889971
587 2858900823
588 2869054570
589 2869070949
590 2880493260
591 2880499045
592 2887483855
593 2929227631
594 649811613
595 8001783638
596 8003858584
597 8003875847
598 8046355795
599 8054705049
600 8054730654
601 8054735966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

8

128

0.96

PF08534

Redoxin

Redoxin

7

145

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.945 13 153
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9414 13 153
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9288 1 153
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.922 2 152
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9144 4 153
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9956 4 153 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9825 4 153 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9682 4 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9504 5 153 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9449 13 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A522QG15-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 1 2 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A4P8STB5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9993 1 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A317CZZ0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9982 13 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A4R9AYD8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9979 2 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2M9L5J9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9967 2 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map