F395341

General Info

Members Datasets Scaffolds Average Seq Length
300 190 600 217

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10696594|Ga0105243_106965942
Length 249
Sequence VTGSEPQASIAGVPQNPETGSMATTGEGPIAGTAGGSADARAASQGGPPYDTDRTWTLPNLLSMLRLAGAPFVLWLILGPQADGLAVLVLAVGGCTDWLDGYLARAWHQTSRLGQMLDPIADRLYIVAVLTGLALREIVPWWLVVIVIGRDVMIASLVPLLKTRGFSSLPVHFLGKAATFSLLYAFPLVLLGSGEQGWLQLAWVLGWAFAIWGTALYWYAGGLYVAQTVKLVRTMPPINDRQRGGSTSG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
110 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
111 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
167 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2643221617 Nocardioides sp. Root79 Isolate Unclassified
185 2643221620 Nocardioides sp. Root240 Isolate Unclassified
186 2643221696 Nocardioides sp. Root140 Isolate Unclassified
187 2738541305 Nocardioides sp. CF167 Isolate Unclassified
188 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
189 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
190 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.33
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 8.67
Rhizosphere 88.67
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10696594 3300009148 Unclassified 990
2 JGI25405J52794_10014468 3300003911 Bacteria 1541
3 JGI25405J52794_10059252 3300003911 Bacteria 826
4 Ga0070658_10036586 3300005327 Bacteria 3957
5 Ga0070683_100079089 3300005329 Bacteria 3077
6 Ga0070683_100170668 3300005329 Bacteria 2065
7 Ga0070670_100429402 3300005331 Bacteria 1169
8 Ga0070682_100017908 3300005337 Bacteria 4133
9 Ga0070682_100064099 3300005337 Unclassified 2332
10 Ga0070691_10080502 3300005341 Bacteria 1594
11 Ga0070687_100097496 3300005343 Bacteria 1639
12 Ga0070668_100029453 3300005347 Bacteria 4170
13 Ga0070668_100294774 3300005347 Bacteria 1359
14 Ga0070669_100223598 3300005353 Bacteria 1489
15 Ga0070675_100124797 3300005354 Bacteria 2190
16 Ga0070673_100526543 3300005364 Bacteria 1072
17 Ga0070688_100227099 3300005365 Bacteria 1319
18 Ga0070659_100004944 3300005366 Bacteria 9534
19 Ga0070659_100017974 3300005366 Bacteria 5329
20 Ga0070659_100146033 3300005366 Bacteria 1927
21 Ga0070701_10078308 3300005438 Bacteria 1783
22 Ga0070701_10126865 3300005438 Bacteria 1445
23 Ga0070705_100321110 3300005440 Bacteria 1118
24 Ga0070700_100000406 3300005441 Bacteria 22003
25 Ga0070662_100028258 3300005457 Bacteria 3901
26 Ga0068867_100070226 3300005459 Bacteria 2618
27 Ga0068867_100087869 3300005459 Bacteria 2354
28 Ga0070684_100153143 3300005535 Bacteria 2090
29 Ga0070695_100339370 3300005545 Bacteria 1122
30 Ga0068855_100442349 3300005563 Bacteria 1419
31 Ga0070664_100178256 3300005564 Bacteria 1888
32 Ga0070702_100033494 3300005615 Bacteria 2826
33 Ga0068852_100347614 3300005616 Bacteria 1447
34 Ga0068859_100547361 3300005617 Bacteria 1252
35 Ga0068866_10168015 3300005718 Bacteria 1285
36 Ga0068866_10257073 3300005718 Bacteria 1071
37 Ga0068870_10001067 3300005840 Bacteria 10886
38 Ga0068858_100528592 3300005842 Bacteria 1141
39 Ga0068860_100300915 3300005843 Bacteria 1571
40 Ga0068860_100331885 3300005843 Bacteria 1494
41 Ga0068862_100130063 3300005844 Bacteria 2226
42 Ga0081455_10005218 3300005937 Bacteria 14293
43 Ga0081455_10022172 3300005937 Bacteria 5942
44 Ga0081455_10023863 3300005937 Bacteria 5681
45 Ga0081455_10078107 3300005937 Bacteria 2721
46 Ga0081538_10001931 3300005981 Bacteria 20762
47 Ga0081538_10096216 3300005981 Unclassified 1509
48 Ga0075432_10000028 3300006058 Bacteria 26814
49 Ga0075432_10010600 3300006058 Unclassified 3130
50 Ga0075432_10023546 3300006058 Bacteria 2109
51 Ga0075428_100254142 3300006844 Bacteria 1893
52 Ga0075428_100426656 3300006844 Bacteria 1421
53 Ga0075428_100865121 3300006844 Bacteria 959
54 Ga0075430_100308357 3300006846 Bacteria 1309
55 Ga0075431_100029697 3300006847 Bacteria 5628
56 Ga0075433_10002010 3300006852 Bacteria 15326
57 Ga0075434_100003989 3300006871 Bacteria 13221
58 Ga0075434_101362465 3300006871 Bacteria 720
59 Ga0075429_100049929 3300006880 Unclassified 3640
60 Ga0068865_100008425 3300006881 Bacteria 6375
61 Ga0068865_100022810 3300006881 Bacteria 4090
62 Ga0068865_100066065 3300006881 Bacteria 2551
63 Ga0075436_100003948 3300006914 Bacteria 10166
64 Ga0097620_100547357 3300006931 Bacteria 1252
65 Ga0097620_101092046 3300006931 Bacteria 877
66 Ga0075435_100002516 3300007076 Bacteria 12200
67 Ga0075435_100005184 3300007076 Bacteria 9065
68 Ga0111539_10001773 3300009094 Bacteria 28685
69 Ga0111539_10008586 3300009094 Bacteria 12973
70 Ga0105245_10025877 3300009098 Bacteria 5161
71 Ga0105245_10036510 3300009098 Bacteria 4366
72 Ga0105245_10087349 3300009098 Bacteria 2862
73 Ga0114129_10012017 3300009147 Bacteria 12315
74 Ga0114129_10450543 3300009147 Bacteria 1688
75 Ga0105243_10016977 3300009148 Bacteria 5504
76 Ga0105243_10040347 3300009148 Unclassified 3645
77 Ga0105243_10609959 3300009148 Bacteria 1052
78 Ga0105242_10190275 3300009176 Bacteria 1816
79 Ga0105237_10666509 3300009545 Bacteria 1047
80 Ga0105238_10321784 3300009551 Bacteria 1533
81 Ga0105249_10018095 3300009553 Bacteria 6263
82 Ga0105249_10089900 3300009553 Bacteria 2870
83 Ga0105249_11084949 3300009553 Bacteria 870
84 Ga0105239_10022373 3300010375 Bacteria 6969
85 Ga0105239_10059048 3300010375 Bacteria 4210
86 Ga0105239_10067515 3300010375 Unclassified 3928
87 Ga0105246_10625657 3300011119 Bacteria 933
88 Ga0157338_1001423 3300012515 Unclassified 1705
89 Ga0157371_10322154 3300013102 Bacteria 1122
90 Ga0163162_10035189 3300013306 Bacteria 4987
91 Ga0157372_10048131 3300013307 Bacteria 4739
92 Ga0157372_10778059 3300013307 Bacteria 1112
93 Ga0157372_11461991 3300013307 Bacteria 787
94 Ga0157375_11299750 3300013308 Bacteria 855
95 Ga0163163_10633854 3300014325 Bacteria 1132
96 Ga0163163_10686596 3300014325 Bacteria 1087
97 Ga0157380_10041630 3300014326 Unclassified 3586
98 Ga0157380_10650019 3300014326 Bacteria 1052
99 Ga0163161_10089374 3300017792 Bacteria 2278
100 Ga0163161_10468423 3300017792 Bacteria 1021
101 Ga0206356_11240218 3300020070 Bacteria 1608
102 Ga0207642_10148060 3300025899 Bacteria 1246
103 Ga0207642_10158967 3300025899 Bacteria 1211
104 Ga0207688_10003001 3300025901 Bacteria 9192
105 Ga0207647_10139154 3300025904 Bacteria 1423
106 Ga0207643_10001879 3300025908 Bacteria 11602
107 Ga0207705_10047719 3300025909 Bacteria 3079
108 Ga0207705_10365331 3300025909 Bacteria 1113
109 Ga0207705_10473579 3300025909 Bacteria 972
110 Ga0207662_10095366 3300025918 Bacteria 1836
111 Ga0207657_10015319 3300025919 Bacteria 7432
112 Ga0207694_10175808 3300025924 Bacteria 1735
113 Ga0207694_10240101 3300025924 Bacteria 1481
114 Ga0207650_10527693 3300025925 Bacteria 988
115 Ga0207659_10212447 3300025926 Bacteria 1551
116 Ga0207687_10016636 3300025927 Bacteria 4832
117 Ga0207687_10057785 3300025927 Bacteria 2727
118 Ga0207687_10228278 3300025927 Bacteria 1469
119 Ga0207687_10391788 3300025927 Bacteria 1140
120 Ga0207690_10149246 3300025932 Bacteria 1732
121 Ga0207706_10395308 3300025933 Bacteria 1199
122 Ga0207686_10050863 3300025934 Bacteria 2579
123 Ga0207686_10506773 3300025934 Bacteria 937
124 Ga0207709_10251130 3300025935 Bacteria 1292
125 Ga0207709_10334341 3300025935 Bacteria 1138
126 Ga0207709_10865707 3300025935 Bacteria 733
127 Ga0207669_10115783 3300025937 Bacteria 1808
128 Ga0207704_10038926 3300025938 Unclassified 2763
129 Ga0207704_10221985 3300025938 Bacteria 1399
130 Ga0207661_10114309 3300025944 Bacteria 2288
131 Ga0207661_10659360 3300025944 Bacteria 962
132 Ga0207712_10027364 3300025961 Bacteria 3807
133 Ga0207712_10122742 3300025961 Bacteria 1968
134 Ga0207668_10019373 3300025972 Bacteria 4301
135 Ga0207668_10131448 3300025972 Bacteria 1912
136 Ga0207677_10574005 3300026023 Bacteria 986
137 Ga0207639_10895652 3300026041 Bacteria 829
138 Ga0207708_10064908 3300026075 Bacteria 2790
139 Ga0207708_10530054 3300026075 Bacteria 991
140 Ga0207648_10010968 3300026089 Bacteria 8561
141 Ga0207648_10022104 3300026089 Bacteria 5714
142 Ga0207675_100000862 3300026118 Bacteria 30299
143 Ga0207675_100011648 3300026118 Bacteria 8223
144 Ga0207683_10359671 3300026121 Bacteria 1337
145 Ga0207698_10144567 3300026142 Bacteria 2054
146 Ga0207428_10000855 3300027907 Bacteria 34313
147 Ga0207428_10008400 3300027907 Bacteria 9325
148 Ga0207428_10039472 3300027907 Bacteria 3834
149 Ga0268265_10212502 3300028380 Bacteria 1687
150 Ga0268264_10245115 3300028381 Bacteria 1662
151 Ga0307408_100019928 3300031548 Bacteria 4519
152 Ga0307405_10001045 3300031731 Bacteria 11203
153 Ga0307405_10140082 3300031731 Bacteria 1685
154 Ga0307405_10155222 3300031731 Bacteria 1614
155 Ga0307413_10003566 3300031824 Bacteria 6583
156 Ga0307410_10000766 3300031852 Bacteria 13524
157 Ga0307410_10001024 3300031852 Bacteria 12121
158 Ga0307410_10010771 3300031852 Bacteria 5201
159 Ga0307410_10413768 3300031852 Bacteria 1092
160 Ga0307406_10005025 3300031901 Bacteria 7210
161 Ga0307407_10009401 3300031903 Bacteria 4552
162 Ga0307407_10021498 3300031903 Bacteria 3329
163 Ga0307407_10160029 3300031903 Bacteria 1473
164 Ga0307412_10146043 3300031911 Bacteria 1739
165 Ga0307412_10335500 3300031911 Unclassified 1208
166 Ga0307412_10408814 3300031911 Bacteria 1107
167 Ga0307409_100000183 3300031995 Bacteria 24466
168 Ga0307409_100009847 3300031995 Bacteria 5897
169 Ga0307409_100203443 3300031995 Bacteria 1773
170 Ga0307409_100265429 3300031995 Bacteria 1578
171 Ga0307409_100992143 3300031995 Unclassified 857
172 Ga0307416_100000124 3300032002 Bacteria 46509
173 Ga0307416_100014956 3300032002 Bacteria 5340
174 Ga0307416_100583454 3300032002 Bacteria 1195
175 Ga0307414_10006047 3300032004 Bacteria 6714
176 Ga0307414_10117747 3300032004 Bacteria 2036
177 Ga0307411_10009966 3300032005 Bacteria 5034
178 Ga0307411_10105752 3300032005 Unclassified 2001
179 Ga0307411_10259233 3300032005 Unclassified 1372
180 Ga0307411_10278309 3300032005 Bacteria 1330
181 Ga0307415_100002631 3300032126 Bacteria 8945
182 Ga0307415_100003201 3300032126 Bacteria 8307
183 Ga0307415_100593911 3300032126 Bacteria 984
184 Ga0373960_0073416 3300035121 Bacteria 1063
185 Ga0395901_0038740 3300038443 Bacteria 4931
186 Ga0242420_029975 3300038996 Bacteria 1006
187 Ga0439448_0036168 3300042005 Bacteria 1583
188 Ga0439450_003317 3300042008 Bacteria 2648
189 Ga0439450_078360 3300042008 Unclassified 819
190 Ga0439463_002099 3300042016 Bacteria 5154
191 Ga0450888_006017 3300042126 Unclassified 1308
192 Ga0439446_0062068 3300042156 Bacteria 1131
193 Ga0439444_0001661 3300042437 Unclassified 2930
194 Ga0439460_0044108 3300042461 Unclassified 1319
195 Ga0439440_0001936 3300042993 Bacteria 3846
196 Ga0466972_0002214 3300044658 Bacteria 9547
197 Ga0466972_0095074 3300044658 Bacteria 1412
198 Ga0466965_0010900 3300044683 Bacteria 4252
199 Ga0466961_0100025 3300044693 Bacteria 1827
200 Ga0466963_0169548 3300044694 Bacteria 1521
201 Ga0466964_0005846 3300044706 Bacteria 4577
202 Ga0466971_0031191 3300044719 Bacteria 2386
203 Ga0466970_0016232 3300044765 Bacteria 3837
204 Ga0466970_0067952 3300044765 Bacteria 1914
205 Ga0466957_0007885 3300044842 Bacteria 6038
206 Ga0466957_0089800 3300044842 Bacteria 1924
207 Ga0466958_0032414 3300045836 Bacteria 3108
208 Ga0466967_0206429 3300045976 Bacteria 1862
209 Ga0466967_0323207 3300045976 Bacteria 1488
210 Ga0466967_0348275 3300045976 Bacteria 1433
211 Ga0466967_1344613 3300045976 Bacteria 711
212 Ga0495641_0052075 3300046461 Bacteria 1867
213 Ga0495582_0275525 3300046473 Bacteria 966
214 Ga0495644_0090865 3300046523 Bacteria 1152
215 Ga0495598_0136027 3300046537 Bacteria 847
216 Ga0495611_0136773 3300046648 Unclassified 1144
217 Ga0495661_0221230 3300046665 Bacteria 981
218 Ga0495658_0523496 3300046683 Bacteria 759
219 Ga0495660_0067268 3300046810 Bacteria 1909
220 Ga0496101_0211279 3300048904 Bacteria 1503
221 Ga0496102_0019554 3300048905 Bacteria 5965
222 Ga0496104_0121292 3300048907 Bacteria 2510
223 Ga0496105_0202755 3300048908 Bacteria 1619
224 Ga0496105_0533540 3300048908 Bacteria 918
225 Ga0496105_0540071 3300048908 Bacteria 911
226 Ga0496106_0015694 3300048909 Bacteria 5604
227 Ga0496107_0008975 3300048910 Bacteria 6930
228 Ga0496108_0004318 3300048911 Bacteria 11429
229 Ga0496108_0007443 3300048911 Bacteria 8874
230 Ga0496108_0418567 3300048911 Bacteria 1170
231 Ga0496109_0004950 3300048912 Bacteria 11126
232 Ga0496109_0031260 3300048912 Bacteria 4777
233 Ga0496109_0525508 3300048912 Bacteria 1117
234 Ga0496110_0014266 3300048913 Bacteria 6592
235 Ga0496110_0109281 3300048913 Bacteria 2483
236 Ga0496110_0125656 3300048913 Bacteria 2314
237 Ga0496110_0144293 3300048913 Bacteria 2153
238 Ga0496111_0018998 3300048914 Bacteria 4766
239 Ga0496111_0107553 3300048914 Bacteria 2053
240 Ga0496112_0860739 3300048915 Bacteria 829
241 Ga0496113_0063131 3300048916 Bacteria 2799
242 Ga0496113_0307830 3300048916 Bacteria 1269
243 Ga0496114_0012935 3300048917 Bacteria 6685
244 Ga0496114_0362604 3300048917 Bacteria 1282
245 Ga0496114_1031012 3300048917 Bacteria 706
246 Ga0501300_007512 3300049523 Unclassified 1599
247 Ga0501033_0065286 3300049570 Bacteria 2678
248 Ga0501034_0009364 3300049571 Bacteria 10262
249 Ga0501034_0235244 3300049571 Bacteria 1780
250 Ga0501036_0131115 3300049572 Bacteria 2116
251 Ga0501037_0173418 3300049573 Bacteria 1532
252 Ga0501038_0005729 3300049574 Bacteria 11514
253 Ga0501039_0016129 3300049575 Bacteria 5723
254 Ga0501039_0469785 3300049575 Bacteria 988
255 Ga0501040_0185394 3300049576 Bacteria 1476
256 Ga0501042_0011581 3300049578 Bacteria 5956
257 Ga0501043_0500820 3300049579 Bacteria 907
258 Ga0501046_0081249 3300049580 Bacteria 2503
259 Ga0501047_0045219 3300049581 Bacteria 4256
260 Ga0501067_0087592 3300049583 Bacteria 1728
261 Ga0501068_0025816 3300049584 Bacteria 3458
262 Ga0501068_0566833 3300049584 Bacteria 739
263 Ga0501069_0037061 3300049585 Bacteria 2691
264 Ga0501069_0060975 3300049585 Bacteria 2106
265 Ga0501070_0015547 3300049586 Bacteria 6401
266 Ga0501070_0018932 3300049586 Bacteria 5775
267 Ga0501071_0183623 3300049587 Bacteria 1568
268 Ga0501073_0026576 3300049589 Bacteria 4145
269 Ga0501074_0111765 3300049590 Bacteria 1954
270 Ga0501207_015375 3300049654 Unclassified 1178
271 Ga0501243_014997 3300049675 Unclassified 1243
272 Ga0501234_023153 3300049707 Unclassified 993
273 Ga0501044_0023050 3300049823 Bacteria 6627
274 Ga0501212_003342 3300049851 Bacteria 2006
275 nmdc:mga05p37_763842_c1 3300050507 Bacteria 1063
276 nmdc:mga05p37_9426_c1 3300050507 Bacteria 11560
277 nmdc:mga09592_76448_c1 3300050508 Unclassified 2243
278 nmdc:mga0qj67_474454_c1 3300050509 Bacteria 1007
279 nmdc:mga06r32_16954_c2 3300050510 Bacteria 5171
280 nmdc:mga08y16_12187_c1 3300050511 Bacteria 9038
281 nmdc:mga08y16_6996_c1 3300050511 Bacteria 11831
282 nmdc:mga0n895_216120_c1 3300050512 Bacteria 1947
283 nmdc:mga0n895_390_c1 3300050512 Bacteria 29396
284 nmdc:mga0n895_635973_c1 3300050512 Bacteria 1067
285 nmdc:mga0rr50_16676_c1 3300050513 Unclassified 4885
286 nmdc:mga08x19_9875_c1 3300050514 Bacteria 5722
287 nmdc:mga0a205_11637_c1 3300050515 Bacteria 8111
288 nmdc:mga0a205_545_c1 3300050515 Bacteria 29797
289 Ga0495619_0133746 3300053085 Bacteria 1705
290 Ga0500620_054311 3300053155 Bacteria 1351
291 Ga0466962_0092891 3300061719 Bacteria 1446
292 Ga0530510_0019317 3300061734 Bacteria 4837
293 Ga0530510_0112481 3300061734 Bacteria 1995
294 2644101703 2643221617 Bacteria 5139111
295 2644115765 2643221620 Bacteria 5134593
296 2644531922 2643221696 Bacteria 5431823
297 2738868461 2738541305 Bacteria 4910150
298 2812332926 2811994874 Bacteria 5367947
299 2855387322 2855386786 Bacteria 4752232
300 2990259044 2990256926 Bacteria 4252839
301 Ga0105243_10696594
302 JGI25405J52794_10014468
303 JGI25405J52794_10059252
304 Ga0070658_10036586
305 Ga0070683_100079089
306 Ga0070683_100170668
307 Ga0070670_100429402
308 Ga0070682_100017908
309 Ga0070682_100064099
310 Ga0070691_10080502
311 Ga0070687_100097496
312 Ga0070668_100029453
313 Ga0070668_100294774
314 Ga0070669_100223598
315 Ga0070675_100124797
316 Ga0070673_100526543
317 Ga0070688_100227099
318 Ga0070659_100004944
319 Ga0070659_100017974
320 Ga0070659_100146033
321 Ga0070701_10078308
322 Ga0070701_10126865
323 Ga0070705_100321110
324 Ga0070700_100000406
325 Ga0070662_100028258
326 Ga0068867_100070226
327 Ga0068867_100087869
328 Ga0070684_100153143
329 Ga0070695_100339370
330 Ga0068855_100442349
331 Ga0070664_100178256
332 Ga0070702_100033494
333 Ga0068852_100347614
334 Ga0068859_100547361
335 Ga0068866_10168015
336 Ga0068866_10257073
337 Ga0068870_10001067
338 Ga0068858_100528592
339 Ga0068860_100300915
340 Ga0068860_100331885
341 Ga0068862_100130063
342 Ga0081455_10005218
343 Ga0081455_10022172
344 Ga0081455_10023863
345 Ga0081455_10078107
346 Ga0081538_10001931
347 Ga0081538_10096216
348 Ga0075432_10000028
349 Ga0075432_10010600
350 Ga0075432_10023546
351 Ga0075428_100254142
352 Ga0075428_100426656
353 Ga0075428_100865121
354 Ga0075430_100308357
355 Ga0075431_100029697
356 Ga0075433_10002010
357 Ga0075434_100003989
358 Ga0075434_101362465
359 Ga0075429_100049929
360 Ga0068865_100008425
361 Ga0068865_100022810
362 Ga0068865_100066065
363 Ga0075436_100003948
364 Ga0097620_100547357
365 Ga0097620_101092046
366 Ga0075435_100002516
367 Ga0075435_100005184
368 Ga0111539_10001773
369 Ga0111539_10008586
370 Ga0105245_10025877
371 Ga0105245_10036510
372 Ga0105245_10087349
373 Ga0114129_10012017
374 Ga0114129_10450543
375 Ga0105243_10016977
376 Ga0105243_10040347
377 Ga0105243_10609959
378 Ga0105242_10190275
379 Ga0105237_10666509
380 Ga0105238_10321784
381 Ga0105249_10018095
382 Ga0105249_10089900
383 Ga0105249_11084949
384 Ga0105239_10022373
385 Ga0105239_10059048
386 Ga0105239_10067515
387 Ga0105246_10625657
388 Ga0157338_1001423
389 Ga0157371_10322154
390 Ga0163162_10035189
391 Ga0157372_10048131
392 Ga0157372_10778059
393 Ga0157372_11461991
394 Ga0157375_11299750
395 Ga0163163_10633854
396 Ga0163163_10686596
397 Ga0157380_10041630
398 Ga0157380_10650019
399 Ga0163161_10089374
400 Ga0163161_10468423
401 Ga0206356_11240218
402 Ga0207642_10148060
403 Ga0207642_10158967
404 Ga0207688_10003001
405 Ga0207647_10139154
406 Ga0207643_10001879
407 Ga0207705_10047719
408 Ga0207705_10365331
409 Ga0207705_10473579
410 Ga0207662_10095366
411 Ga0207657_10015319
412 Ga0207694_10175808
413 Ga0207694_10240101
414 Ga0207650_10527693
415 Ga0207659_10212447
416 Ga0207687_10016636
417 Ga0207687_10057785
418 Ga0207687_10228278
419 Ga0207687_10391788
420 Ga0207690_10149246
421 Ga0207706_10395308
422 Ga0207686_10050863
423 Ga0207686_10506773
424 Ga0207709_10251130
425 Ga0207709_10334341
426 Ga0207709_10865707
427 Ga0207669_10115783
428 Ga0207704_10038926
429 Ga0207704_10221985
430 Ga0207661_10114309
431 Ga0207661_10659360
432 Ga0207712_10027364
433 Ga0207712_10122742
434 Ga0207668_10019373
435 Ga0207668_10131448
436 Ga0207677_10574005
437 Ga0207639_10895652
438 Ga0207708_10064908
439 Ga0207708_10530054
440 Ga0207648_10010968
441 Ga0207648_10022104
442 Ga0207675_100000862
443 Ga0207675_100011648
444 Ga0207683_10359671
445 Ga0207698_10144567
446 Ga0207428_10000855
447 Ga0207428_10008400
448 Ga0207428_10039472
449 Ga0268265_10212502
450 Ga0268264_10245115
451 Ga0307408_100019928
452 Ga0307405_10001045
453 Ga0307405_10140082
454 Ga0307405_10155222
455 Ga0307413_10003566
456 Ga0307410_10000766
457 Ga0307410_10001024
458 Ga0307410_10010771
459 Ga0307410_10413768
460 Ga0307406_10005025
461 Ga0307407_10009401
462 Ga0307407_10021498
463 Ga0307407_10160029
464 Ga0307412_10146043
465 Ga0307412_10335500
466 Ga0307412_10408814
467 Ga0307409_100000183
468 Ga0307409_100009847
469 Ga0307409_100203443
470 Ga0307409_100265429
471 Ga0307409_100992143
472 Ga0307416_100000124
473 Ga0307416_100014956
474 Ga0307416_100583454
475 Ga0307414_10006047
476 Ga0307414_10117747
477 Ga0307411_10009966
478 Ga0307411_10105752
479 Ga0307411_10259233
480 Ga0307411_10278309
481 Ga0307415_100002631
482 Ga0307415_100003201
483 Ga0307415_100593911
484 Ga0373960_0073416
485 Ga0395901_0038740
486 Ga0242420_029975
487 Ga0439448_0036168
488 Ga0439450_003317
489 Ga0439450_078360
490 Ga0439463_002099
491 Ga0450888_006017
492 Ga0439446_0062068
493 Ga0439444_0001661
494 Ga0439460_0044108
495 Ga0439440_0001936
496 Ga0466972_0002214
497 Ga0466972_0095074
498 Ga0466965_0010900
499 Ga0466961_0100025
500 Ga0466963_0169548
501 Ga0466964_0005846
502 Ga0466971_0031191
503 Ga0466970_0016232
504 Ga0466970_0067952
505 Ga0466957_0007885
506 Ga0466957_0089800
507 Ga0466958_0032414
508 Ga0466967_0206429
509 Ga0466967_0323207
510 Ga0466967_0348275
511 Ga0466967_1344613
512 Ga0495641_0052075
513 Ga0495582_0275525
514 Ga0495644_0090865
515 Ga0495598_0136027
516 Ga0495611_0136773
517 Ga0495661_0221230
518 Ga0495658_0523496
519 Ga0495660_0067268
520 Ga0496101_0211279
521 Ga0496102_0019554
522 Ga0496104_0121292
523 Ga0496105_0202755
524 Ga0496105_0533540
525 Ga0496105_0540071
526 Ga0496106_0015694
527 Ga0496107_0008975
528 Ga0496108_0004318
529 Ga0496108_0007443
530 Ga0496108_0418567
531 Ga0496109_0004950
532 Ga0496109_0031260
533 Ga0496109_0525508
534 Ga0496110_0014266
535 Ga0496110_0109281
536 Ga0496110_0125656
537 Ga0496110_0144293
538 Ga0496111_0018998
539 Ga0496111_0107553
540 Ga0496112_0860739
541 Ga0496113_0063131
542 Ga0496113_0307830
543 Ga0496114_0012935
544 Ga0496114_0362604
545 Ga0496114_1031012
546 Ga0501300_007512
547 Ga0501033_0065286
548 Ga0501034_0009364
549 Ga0501034_0235244
550 Ga0501036_0131115
551 Ga0501037_0173418
552 Ga0501038_0005729
553 Ga0501039_0016129
554 Ga0501039_0469785
555 Ga0501040_0185394
556 Ga0501042_0011581
557 Ga0501043_0500820
558 Ga0501046_0081249
559 Ga0501047_0045219
560 Ga0501067_0087592
561 Ga0501068_0025816
562 Ga0501068_0566833
563 Ga0501069_0037061
564 Ga0501069_0060975
565 Ga0501070_0015547
566 Ga0501070_0018932
567 Ga0501071_0183623
568 Ga0501073_0026576
569 Ga0501074_0111765
570 Ga0501207_015375
571 Ga0501243_014997
572 Ga0501234_023153
573 Ga0501044_0023050
574 Ga0501212_003342
575 nmdc:mga05p37_763842_c1
576 nmdc:mga05p37_9426_c1
577 nmdc:mga09592_76448_c1
578 nmdc:mga0qj67_474454_c1
579 nmdc:mga06r32_16954_c2
580 nmdc:mga08y16_12187_c1
581 nmdc:mga08y16_6996_c1
582 nmdc:mga0n895_216120_c1
583 nmdc:mga0n895_390_c1
584 nmdc:mga0n895_635973_c1
585 nmdc:mga0rr50_16676_c1
586 nmdc:mga08x19_9875_c1
587 nmdc:mga0a205_11637_c1
588 nmdc:mga0a205_545_c1
589 Ga0495619_0133746
590 Ga0500620_054311
591 Ga0466962_0092891
592 Ga0530510_0019317
593 Ga0530510_0112481
594 2644101703
595 2644115765
596 2644531922
597 2738868461
598 2812332926
599 2855387322
600 2990259044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

56

215

0.92

Map