F395327

General Info

Members Datasets Scaffolds Average Seq Length
300 174 299 246

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10167503|Ga0111539_101675031
Length 283
Sequence MIPIEPEPGNAGAGNRNFKREFRLRRSSFFYCYLKNLMAKLNWQIGCSGFYYKEWKGIFYPESLPQKEWFKFYAENFNTLELNVTFYRFPVLKSLETWYNTTPGNFSFAVKAPRLITHYKKFTDCTRLIDDFYTLVSRGLREKLGPILFQLPPKYSFTVERLELITKSMYKEFKNVLEFRDASWWIPQVFDHSQKEKFIFCGIDYPGLPNEAIITNQTVYYRFHGRPRLYYSAYKKDELNIIADNLLANKKITDAYIFFNNTATQAAIKNATWLKKYISSYIG

Samples

Sample ID Description Type Environment
1 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
152 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
153 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
158 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
159 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
160 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
161 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
162 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
172 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 0
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10073737 3300003316 Bacteria 6152
2 rootH2_10054837 3300003320 Unclassified 4370
3 rootL2_10139189 3300003322 Bacteria 1546
4 rootL2_10276564 3300003322 Bacteria 1821
5 rootL2_10330272 3300003322 Bacteria 1326
6 rootH1_10015670 3300003323 Bacteria 15624
7 rootH1_10098697 3300003323 Bacteria 5533
8 rootH1_10169777 3300003323 Bacteria 1121
9 Ga0065712_10001358 3300005290 Bacteria 6597
10 Ga0070658_10249696 3300005327 Bacteria 1505
11 Ga0070658_10268095 3300005327 Bacteria 1451
12 Ga0070658_10362578 3300005327 Bacteria 1241
13 Ga0070658_10466906 3300005327 Bacteria 1088
14 Ga0070658_10654573 3300005327 Bacteria 911
15 Ga0070683_100415993 3300005329 Bacteria 1282
16 Ga0070670_100022643 3300005331 Bacteria 5407
17 Ga0070670_100131782 3300005331 Bacteria 2159
18 Ga0068869_100014839 3300005334 Bacteria 5208
19 Ga0070680_100009300 3300005336 Bacteria 7546
20 Ga0070682_100053283 3300005337 Bacteria 2535
21 Ga0068868_100218719 3300005338 Bacteria 1594
22 Ga0070660_100027993 3300005339 Bacteria 4212
23 Ga0070660_100299368 3300005339 Bacteria 1318
24 Ga0070689_100203268 3300005340 Bacteria 1618
25 Ga0070687_100029812 3300005343 Unclassified 2661
26 Ga0070687_100103210 3300005343 Bacteria 1600
27 Ga0070692_10430377 3300005345 Bacteria 840
28 Ga0070669_100058236 3300005353 Bacteria 2835
29 Ga0070675_100063503 3300005354 Bacteria 3053
30 Ga0070675_100159657 3300005354 Bacteria 1938
31 Ga0070675_100474531 3300005354 Bacteria 1124
32 Ga0070675_100633834 3300005354 Unclassified 971
33 Ga0070671_100260856 3300005355 Bacteria 1473
34 Ga0070674_100075792 3300005356 Bacteria 2390
35 Ga0070673_100106642 3300005364 Bacteria 2316
36 Ga0070688_100010468 3300005365 Bacteria 5114
37 Ga0070701_10054964 3300005438 Bacteria 2077
38 Ga0070663_100224390 3300005455 Bacteria 1476
39 Ga0070678_100209798 3300005456 Bacteria 1613
40 Ga0070681_10128731 3300005458 Unclassified 2464
41 Ga0070681_10160534 3300005458 Bacteria 2172
42 Ga0070681_10177273 3300005458 Bacteria 2053
43 Ga0068867_100292396 3300005459 Bacteria 1340
44 Ga0070698_100003102 3300005471 Bacteria 18312
45 Ga0070679_100001881 3300005530 Bacteria 18884
46 Ga0070679_100013309 3300005530 Bacteria 7876
47 Ga0070679_100243304 3300005530 Bacteria 1756
48 Ga0070672_100051682 3300005543 Bacteria 3206
49 Ga0070672_100374098 3300005543 Bacteria 1218
50 Ga0068855_100016847 3300005563 Bacteria 8791
51 Ga0068855_100022378 3300005563 Bacteria 7574
52 Ga0068855_100175001 3300005563 Bacteria 2429
53 Ga0068857_100070945 3300005577 Bacteria 3103
54 Ga0068857_100089457 3300005577 Bacteria 2755
55 Ga0068854_100447112 3300005578 Bacteria 1078
56 Ga0068856_100038406 3300005614 Bacteria 4701
57 Ga0068856_100340592 3300005614 Bacteria 1518
58 Ga0068852_100023253 3300005616 Bacteria 4985
59 Ga0068852_100205644 3300005616 Bacteria 1865
60 Ga0068852_100459191 3300005616 Unclassified 1262
61 Ga0068859_100158825 3300005617 Bacteria 2339
62 Ga0068859_101096701 3300005617 Bacteria 875
63 Ga0068864_100080761 3300005618 Bacteria 2849
64 Ga0068866_10003384 3300005718 Bacteria 6541
65 Ga0068866_10350601 3300005718 Bacteria 938
66 Ga0068861_100015930 3300005719 Bacteria 5307
67 Ga0068861_100027522 3300005719 Bacteria 4142
68 Ga0068870_10117273 3300005840 Bacteria 1528
69 Ga0068863_100051050 3300005841 Bacteria 3920
70 Ga0068862_100163410 3300005844 Bacteria 1989
71 Ga0068862_100252954 3300005844 Bacteria 1606
72 Ga0075366_10007167 3300006195 Bacteria 6140
73 Ga0075366_10009582 3300006195 Bacteria 5410
74 Ga0075366_10037060 3300006195 Bacteria 2877
75 Ga0097621_100022066 3300006237 Bacteria 4937
76 Ga0097621_100194472 3300006237 Unclassified 1758
77 Ga0075370_10141572 3300006353 Bacteria 1406
78 Ga0068871_100286947 3300006358 Bacteria 1441
79 Ga0075428_100005956 3300006844 Bacteria 13547
80 Ga0075428_100167306 3300006844 Bacteria 2385
81 Ga0075431_100123505 3300006847 Bacteria 2671
82 Ga0075429_100000437 3300006880 Bacteria 31026
83 Ga0068865_100137612 3300006881 Bacteria 1837
84 Ga0097620_100158820 3300006931 Bacteria 2339
85 Ga0097620_101096727 3300006931 Bacteria 875
86 Ga0105240_10000068 3300009093 Bacteria 207756
87 Ga0105240_10330379 3300009093 Unclassified 1735
88 Ga0105240_10673306 3300009093 Bacteria 1132
89 Ga0111539_10070610 3300009094 Bacteria 4123
90 Ga0111539_10159344 3300009094 Bacteria 2640
91 Ga0111539_10167503 3300009094 Bacteria 2568
92 Ga0111539_10268465 3300009094 Bacteria 1986
93 Ga0114129_10001087 3300009147 Bacteria 35667
94 Ga0105243_10290712 3300009148 Bacteria 1476
95 Ga0105241_10010599 3300009174 Bacteria 6760
96 Ga0105241_10017462 3300009174 Bacteria 5276
97 Ga0105241_10463475 3300009174 Unclassified 1123
98 Ga0105242_10000305 3300009176 Bacteria 39232
99 Ga0105242_10286736 3300009176 Bacteria 1498
100 Ga0105237_10042274 3300009545 Bacteria 4597
101 Ga0105237_10068285 3300009545 Bacteria 3549
102 Ga0105238_10058207 3300009551 Bacteria 3874
103 Ga0105249_10001069 3300009553 Bacteria 24300
104 Ga0105249_10124870 3300009553 Bacteria 2450
105 Ga0105249_10208567 3300009553 Bacteria 1916
106 Ga0105249_10400015 3300009553 Bacteria 1403
107 Ga0105239_10000940 3300010375 Bacteria 41071
108 Ga0105239_10005787 3300010375 Bacteria 14422
109 Ga0157373_10073009 3300013100 Bacteria 2422
110 Ga0157373_10097130 3300013100 Bacteria 2074
111 Ga0157373_10108796 3300013100 Unclassified 1949
112 Ga0157371_10006231 3300013102 Bacteria 9891
113 Ga0157371_10062071 3300013102 Bacteria 2650
114 Ga0157371_10083598 3300013102 Unclassified 2260
115 Ga0157371_10086758 3300013102 Unclassified 2216
116 Ga0157371_10294753 3300013102 Bacteria 1173
117 Ga0157371_10342377 3300013102 Bacteria 1088
118 Ga0157370_10001205 3300013104 Bacteria 32309
119 Ga0157370_10280343 3300013104 Bacteria 1540
120 Ga0157369_10107439 3300013105 Bacteria 2969
121 Ga0157369_10165231 3300013105 Bacteria 2335
122 Ga0157369_10291400 3300013105 Bacteria 1699
123 Ga0157369_10554578 3300013105 Bacteria 1188
124 Ga0157378_10372962 3300013297 Bacteria 1399
125 Ga0157378_10840037 3300013297 Bacteria 946
126 Ga0163162_10000201 3300013306 Bacteria 55260
127 Ga0163162_10050123 3300013306 Bacteria 4187
128 Ga0163162_10136138 3300013306 Unclassified 2567
129 Ga0163162_10363495 3300013306 Bacteria 1580
130 Ga0163162_10683092 3300013306 Bacteria 1149
131 Ga0163162_11034301 3300013306 Bacteria 929
132 Ga0157372_10011324 3300013307 Bacteria 9484
133 Ga0157372_10074463 3300013307 Bacteria 3829
134 Ga0157372_10172876 3300013307 Bacteria 2499
135 Ga0157372_11073754 3300013307 Bacteria 932
136 Ga0157375_10102827 3300013308 Bacteria 2943
137 Ga0157375_10261592 3300013308 Bacteria 1892
138 Ga0157375_10317398 3300013308 Bacteria 1723
139 Ga0157375_10604068 3300013308 Bacteria 1256
140 Ga0163163_10379138 3300014325 Bacteria 1472
141 Ga0157380_10123430 3300014326 Bacteria 2198
142 Ga0157380_10193157 3300014326 Bacteria 1799
143 Ga0157380_10678963 3300014326 Bacteria 1032
144 Ga0157380_10802214 3300014326 Bacteria 958
145 Ga0157377_10010450 3300014745 Bacteria 4592
146 Ga0157377_10011234 3300014745 Unclassified 4462
147 Ga0157379_10173316 3300014968 Bacteria 1947
148 Ga0157376_10296818 3300014969 Unclassified 1528
149 Ga0157376_11002321 3300014969 Bacteria 858
150 Ga0182007_10009924 3300015262 Bacteria 3796
151 Ga0163161_10584392 3300017792 Bacteria 919
152 Ga0207642_10020913 3300025899 Unclassified 2565
153 Ga0207688_10012368 3300025901 Bacteria 4643
154 Ga0207645_10302644 3300025907 Bacteria 1065
155 Ga0207643_10097092 3300025908 Bacteria 1724
156 Ga0207705_10013236 3300025909 Bacteria 5954
157 Ga0207705_10085862 3300025909 Bacteria 2299
158 Ga0207705_10092912 3300025909 Unclassified 2211
159 Ga0207705_10133297 3300025909 Bacteria 1850
160 Ga0207705_10181340 3300025909 Unclassified 1589
161 Ga0207654_10048288 3300025911 Bacteria 2435
162 Ga0207654_10297965 3300025911 Bacteria 1096
163 Ga0207707_10245016 3300025912 Bacteria 1557
164 Ga0207707_10388798 3300025912 Bacteria 1198
165 Ga0207707_10498904 3300025912 Bacteria 1038
166 Ga0207695_10000131 3300025913 Bacteria 223762
167 Ga0207695_10364630 3300025913 Bacteria 1331
168 Ga0207671_10022880 3300025914 Bacteria 4719
169 Ga0207660_10047846 3300025917 Bacteria 3025
170 Ga0207660_10134313 3300025917 Bacteria 1886
171 Ga0207662_10023685 3300025918 Bacteria 3529
172 Ga0207662_10038195 3300025918 Bacteria 2813
173 Ga0207657_10225470 3300025919 Bacteria 1500
174 Ga0207652_10000011 3300025921 Bacteria 246742
175 Ga0207652_10008482 3300025921 Bacteria 8271
176 Ga0207652_10217509 3300025921 Bacteria 1721
177 Ga0207652_10225128 3300025921 Bacteria 1690
178 Ga0207681_10030214 3300025923 Bacteria 3530
179 Ga0207681_10343612 3300025923 Bacteria 1193
180 Ga0207650_10206396 3300025925 Bacteria 1576
181 Ga0207659_10157497 3300025926 Bacteria 1780
182 Ga0207659_10165892 3300025926 Bacteria 1738
183 Ga0207644_10319968 3300025931 Bacteria 1254
184 Ga0207690_10004453 3300025932 Bacteria 8271
185 Ga0207686_10000237 3300025934 Bacteria 42142
186 Ga0207686_10227689 3300025934 Bacteria 1350
187 Ga0207670_10150095 3300025936 Bacteria 1728
188 Ga0207704_10213308 3300025938 Bacteria 1423
189 Ga0207691_10021812 3300025940 Bacteria 6045
190 Ga0207691_10139317 3300025940 Bacteria 2138
191 Ga0207661_10032460 3300025944 Bacteria 4046
192 Ga0207661_10469522 3300025944 Bacteria 1148
193 Ga0207667_10010318 3300025949 Bacteria 10926
194 Ga0207667_10012866 3300025949 Bacteria 9614
195 Ga0207667_10110306 3300025949 Bacteria 2838
196 Ga0207651_10085545 3300025960 Bacteria 2288
197 Ga0207712_10000999 3300025961 Bacteria 20149
198 Ga0207712_10343275 3300025961 Bacteria 1239
199 Ga0207668_10344985 3300025972 Bacteria 1243
200 Ga0207640_10076949 3300025981 Bacteria 2267
201 Ga0207658_10147167 3300025986 Bacteria 1915
202 Ga0207639_10227514 3300026041 Bacteria 1614
203 Ga0207639_10775544 3300026041 Unclassified 893
204 Ga0207678_10346804 3300026067 Bacteria 1280
205 Ga0207708_10087463 3300026075 Bacteria 2399
206 Ga0207708_10347004 3300026075 Bacteria 1217
207 Ga0207702_10102684 3300026078 Unclassified 2527
208 Ga0207702_10131923 3300026078 Bacteria 2249
209 Ga0207641_10001972 3300026088 Bacteria 19612
210 Ga0207648_10064300 3300026089 Unclassified 3198
211 Ga0207648_10085034 3300026089 Bacteria 2759
212 Ga0207648_10179868 3300026089 Bacteria 1872
213 Ga0207676_10179311 3300026095 Bacteria 1853
214 Ga0207674_10041225 3300026116 Bacteria 4776
215 Ga0207674_10193106 3300026116 Bacteria 1986
216 Ga0207674_10286960 3300026116 Bacteria 1594
217 Ga0207674_10491777 3300026116 Bacteria 1185
218 Ga0207675_100024216 3300026118 Bacteria 5645
219 Ga0207675_100052117 3300026118 Bacteria 3818
220 Ga0207675_100066966 3300026118 Bacteria 3357
221 Ga0207698_10018072 3300026142 Bacteria 4797
222 Ga0207698_10248969 3300026142 Bacteria 1625
223 Ga0268266_10509050 3300028379 Bacteria 1150
224 Ga0268265_10077472 3300028380 Bacteria 2611
225 Ga0307513_10211550 3300031456 Bacteria 1770
226 Ga0307405_10007814 3300031731 Bacteria 5382
227 Ga0307412_10149931 3300031911 Bacteria 1719
228 Ga0307414_10002223 3300032004 Bacteria 10124
229 Ga0307414_10065072 3300032004 Bacteria 2600
230 Ga0307414_10848271 3300032004 Unclassified 835
231 Ga0395899_0004440 3300037312 Bacteria 10941
232 Ga0395899_0008012 3300037312 Bacteria 8135
233 Ga0395900_0004107 3300037418 Bacteria 15516
234 Ga0395900_0013714 3300037418 Bacteria 8273
235 Ga0395900_0021765 3300037418 Bacteria 6555
236 Ga0395900_0411617 3300037418 Bacteria 1314
237 Ga0395898_0004015 3300037466 Bacteria 16181
238 Ga0395898_0004358 3300037466 Bacteria 15487
239 Ga0395898_0041164 3300037466 Bacteria 4564
240 Ga0395898_0287557 3300037466 Bacteria 1568
241 Ga0395905_0041450 3300037471 Unclassified 4320
242 Ga0395901_0042082 3300038443 Bacteria 4735
243 Ga0395901_0158991 3300038443 Bacteria 2373
244 Ga0395901_0555491 3300038443 Bacteria 1163
245 Ga0395901_0661725 3300038443 Bacteria 1046
246 Ga0439436_0002047 3300041404 Bacteria 6007
247 Ga0439439_0051005 3300041406 Bacteria 1085
248 Ga0439441_022322 3300042001 Bacteria 1175
249 Ga0439445_0041036 3300042004 Unclassified 1229
250 Ga0439449_0017369 3300042007 Bacteria 2702
251 Ga0439449_0023888 3300042007 Bacteria 2286
252 Ga0439449_0047367 3300042007 Bacteria 1592
253 Ga0439457_000097 3300042014 Bacteria 20341
254 Ga0439457_043409 3300042014 Bacteria 1003
255 Ga0439462_0000205 3300042015 Bacteria 10292
256 Ga0439446_0023650 3300042156 Unclassified 1750
257 Ga0439434_0020674 3300042435 Unclassified 1977
258 Ga0466969_0000362 3300044656 Bacteria 24925
259 Ga0466965_0069942 3300044683 Bacteria 1764
260 Ga0466971_0059862 3300044719 Bacteria 1721
261 Ga0466968_0203871 3300044735 Bacteria 927
262 Ga0466957_0000101 3300044842 Bacteria 34646
263 Ga0495606_0002752 3300046507 Bacteria 19721
264 Ga0495621_0005550 3300046539 Bacteria 3632
265 Ga0495668_0000099 3300046616 Bacteria 137915
266 Ga0495668_0007460 3300046616 Bacteria 6988
267 Ga0495611_0127037 3300046648 Bacteria 1189
268 Ga0495600_0230589 3300046809 Bacteria 1182
269 Ga0495672_0016183 3300047320 Bacteria 5040
270 Ga0501291_010123 3300049514 Bacteria 1336
271 Ga0501298_003133 3300049521 Bacteria 2551
272 Ga0501034_0130925 3300049571 Unclassified 2492
273 Ga0501198_001761 3300049649 Bacteria 2854
274 Ga0501206_002014 3300049653 Bacteria 2561
275 Ga0501207_015348 3300049654 Bacteria 1178
276 Ga0501217_000316 3300049661 Bacteria 7712
277 Ga0501223_005924 3300049663 Unclassified 2552
278 Ga0501235_003960 3300049669 Bacteria 3205
279 Ga0501240_006721 3300049673 Bacteria 1424
280 Ga0501242_001564 3300049674 Bacteria 2320
281 Ga0501243_002420 3300049675 Bacteria 2732
282 Ga0501243_021007 3300049675 Bacteria 1076
283 Ga0501259_000322 3300049688 Bacteria 7571
284 Ga0501261_001470 3300049690 Bacteria 2897
285 Ga0501221_002630 3300049704 Unclassified 2958
286 Ga0501225_0011537 3300049705 Bacteria 2485
287 Ga0501035_0061873 3300049822 Bacteria 3331
288 nmdc:mga0k408_11591_c1 3300050493 Bacteria 4804
289 nmdc:mga05p37_4461_c2 3300050507 Bacteria 10234
290 nmdc:mga09592_2061_c1 3300050508 Bacteria 16202
291 nmdc:mga08y16_129123_c1 3300050511 Bacteria 2629
292 nmdc:mga08y16_227897_c1 3300050511 Bacteria 1928
293 nmdc:mga08y16_257324_c1 3300050511 Bacteria 1803
294 Ga0500650_0139793 3300053098 Bacteria 1123
295 Ga0500658_0033778 3300053134 Unclassified 2014
296 Ga0500589_060566 3300053147 Unclassified 1735
297 Ga0500604_0042107 3300053151 Bacteria 1383
298 Ga0500616_0011519 3300053153 Bacteria 5216
299 Ga0500622_0161355 3300053156 Unclassified 1051

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10463475 Ga0105241_104634751 192
2 3300037466 Ga0395898_0287557 Ga0395898_0287557_915_1550 211
3 3300025907 Ga0207645_10302644 Ga0207645_103026441 220
4 3300025923 Ga0207681_10343612 Ga0207681_103436122 220
5 3300026118 Ga0207675_100052117 Ga0207675_1000521175 220
6 3300013306 Ga0163162_10136138 Ga0163162_101361382 232
7 3300009147 Ga0114129_10001087 Ga0114129_1000108727 233
8 3300050507 nmdc:mga05p37_4461_c2 nmdc:mga05p37_4461_c2_6261_6998 233
9 iso_pu_bacteria 2898713307 2898714036 236
10 3300028379 Ga0268266_10509050 Ga0268266_105090502 237
11 3300046616 Ga0495668_0007460 Ga0495668_0007460_4501_5268 237
12 3300005578 Ga0068854_100447112 Ga0068854_1004471121 238
13 3300009093 Ga0105240_10000068 Ga0105240_10000068163 238
14 3300009174 Ga0105241_10010599 Ga0105241_100105997 238
15 3300009545 Ga0105237_10042274 Ga0105237_100422743 238
16 3300009551 Ga0105238_10058207 Ga0105238_100582073 238
17 3300010375 Ga0105239_10005787 Ga0105239_100057879 238
18 3300025911 Ga0207654_10297965 Ga0207654_102979651 238
19 3300025913 Ga0207695_10000131 Ga0207695_10000131164 238
20 3300025914 Ga0207671_10022880 Ga0207671_100228803 238
21 3300003323 rootH1_10015670 rootH1_100156702 239
22 3300003323 rootH1_10098697 rootH1_100986972 239
23 3300005327 Ga0070658_10654573 Ga0070658_106545731 239
24 3300005331 Ga0070670_100131782 Ga0070670_1001317822 239
25 3300005336 Ga0070680_100009300 Ga0070680_1000093007 239
26 3300005355 Ga0070671_100260856 Ga0070671_1002608562 239
27 3300005455 Ga0070663_100224390 Ga0070663_1002243902 239
28 3300005456 Ga0070678_100209798 Ga0070678_1002097982 239
29 3300005458 Ga0070681_10128731 Ga0070681_101287311 239
30 3300005563 Ga0068855_100022378 Ga0068855_1000223787 239
31 3300005563 Ga0068855_100175001 Ga0068855_1001750012 239
32 3300005614 Ga0068856_100340592 Ga0068856_1003405923 239
33 3300005617 Ga0068859_101096701 Ga0068859_1010967011 239
34 3300005718 Ga0068866_10003384 Ga0068866_100033842 239
35 3300006195 Ga0075366_10009582 Ga0075366_100095824 239
36 3300006237 Ga0097621_100194472 Ga0097621_1001944722 239
37 3300006353 Ga0075370_10141572 Ga0075370_101415721 239
38 3300006358 Ga0068871_100286947 Ga0068871_1002869472 239
39 3300006931 Ga0097620_101096727 Ga0097620_1010967272 239
40 3300009093 Ga0105240_10673306 Ga0105240_106733062 239
41 3300013100 Ga0157373_10108796 Ga0157373_101087963 239
42 3300013102 Ga0157371_10006231 Ga0157371_100062315 239
43 3300013102 Ga0157371_10086758 Ga0157371_100867582 239
44 3300013104 Ga0157370_10001205 Ga0157370_100012058 239
45 3300013104 Ga0157370_10280343 Ga0157370_102803433 239
46 3300013105 Ga0157369_10165231 Ga0157369_101652313 239
47 3300013105 Ga0157369_10554578 Ga0157369_105545782 239
48 3300013306 Ga0163162_10000201 Ga0163162_1000020136 239
49 3300013306 Ga0163162_10683092 Ga0163162_106830922 239
50 3300013308 Ga0157375_10317398 Ga0157375_103173981 239
51 3300014968 Ga0157379_10173316 Ga0157379_101733162 239
52 3300014969 Ga0157376_10296818 Ga0157376_102968183 239
53 3300025899 Ga0207642_10020913 Ga0207642_100209132 239
54 3300025909 Ga0207705_10013236 Ga0207705_100132363 239
55 3300025909 Ga0207705_10085862 Ga0207705_100858622 239
56 3300025909 Ga0207705_10133297 Ga0207705_101332971 239
57 3300025912 Ga0207707_10245016 Ga0207707_102450161 239
58 3300025913 Ga0207695_10364630 Ga0207695_103646302 239
59 3300025917 Ga0207660_10047846 Ga0207660_100478462 239
60 3300025921 Ga0207652_10008482 Ga0207652_100084823 239
61 3300025925 Ga0207650_10206396 Ga0207650_102063962 239
62 3300025944 Ga0207661_10032460 Ga0207661_100324604 239
63 3300025949 Ga0207667_10010318 Ga0207667_100103187 239
64 3300026067 Ga0207678_10346804 Ga0207678_103468042 239
65 3300026078 Ga0207702_10102684 Ga0207702_101026842 239
66 3300026089 Ga0207648_10064300 Ga0207648_100643003 239
67 3300031731 Ga0307405_10007814 Ga0307405_100078144 239
68 3300031911 Ga0307412_10149931 Ga0307412_101499313 239
69 3300037312 Ga0395899_0008012 Ga0395899_0008012_5006_5749 239
70 3300037418 Ga0395900_0013714 Ga0395900_0013714_4370_5089 239
71 3300037418 Ga0395900_0411617 Ga0395900_0411617_392_1111 239
72 3300037466 Ga0395898_0004015 Ga0395898_0004015_8505_9248 239
73 3300038443 Ga0395901_0555491 Ga0395901_0555491_116_835 239
74 3300038443 Ga0395901_0661725 Ga0395901_0661725_239_982 239
75 3300042004 Ga0439445_0041036 Ga0439445_0041036_194_934 239
76 3300042007 Ga0439449_0023888 Ga0439449_0023888_342_1082 239
77 3300042435 Ga0439434_0020674 Ga0439434_0020674_766_1506 239
78 3300046507 Ga0495606_0002752 Ga0495606_0002752_6101_6832 239
79 3300046616 Ga0495668_0000099 Ga0495668_0000099_731_1459 239
80 3300046648 Ga0495611_0127037 Ga0495611_0127037_192_920 239
81 3300047320 Ga0495672_0016183 Ga0495672_0016183_3681_4436 239
82 3300049663 Ga0501223_005924 Ga0501223_005924_993_1712 239
83 3300003320 rootH2_10054837 rootH2_100548373 240
84 3300005327 Ga0070658_10362578 Ga0070658_103625782 240
85 3300005327 Ga0070658_10466906 Ga0070658_104669061 240
86 3300005331 Ga0070670_100022643 Ga0070670_1000226433 240
87 3300005339 Ga0070660_100027993 Ga0070660_1000279932 240
88 3300005339 Ga0070660_100299368 Ga0070660_1002993682 240
89 3300005345 Ga0070692_10430377 Ga0070692_104303771 240
90 3300005458 Ga0070681_10177273 Ga0070681_101772731 240
91 3300005530 Ga0070679_100001881 Ga0070679_1000018813 240
92 3300005530 Ga0070679_100243304 Ga0070679_1002433042 240
93 3300005577 Ga0068857_100070945 Ga0068857_1000709452 240
94 3300005616 Ga0068852_100459191 Ga0068852_1004591912 240
95 3300013100 Ga0157373_10073009 Ga0157373_100730092 240
96 3300013100 Ga0157373_10097130 Ga0157373_100971302 240
97 3300013102 Ga0157371_10062071 Ga0157371_100620712 240
98 3300013102 Ga0157371_10083598 Ga0157371_100835982 240
99 3300013102 Ga0157371_10294753 Ga0157371_102947532 240
100 3300013102 Ga0157371_10342377 Ga0157371_103423772 240
101 3300013105 Ga0157369_10107439 Ga0157369_101074392 240
102 3300013297 Ga0157378_10372962 Ga0157378_103729622 240
103 3300013307 Ga0157372_10011324 Ga0157372_100113242 240
104 3300013307 Ga0157372_10074463 Ga0157372_100744632 240
105 3300013307 Ga0157372_11073754 Ga0157372_110737542 240
106 3300015262 Ga0182007_10009924 Ga0182007_100099242 240
107 3300017792 Ga0163161_10584392 Ga0163161_105843921 240
108 3300025909 Ga0207705_10181340 Ga0207705_101813401 240
109 3300025912 Ga0207707_10498904 Ga0207707_104989041 240
110 3300025919 Ga0207657_10225470 Ga0207657_102254702 240
111 3300025921 Ga0207652_10000011 Ga0207652_100000117 240
112 3300025921 Ga0207652_10217509 Ga0207652_102175092 240
113 3300025932 Ga0207690_10004453 Ga0207690_100044534 240
114 3300025949 Ga0207667_10110306 Ga0207667_101103062 240
115 3300026116 Ga0207674_10286960 Ga0207674_102869603 240
116 3300031456 Ga0307513_10211550 Ga0307513_102115502 240
117 3300032004 Ga0307414_10002223 Ga0307414_100022232 240
118 3300032004 Ga0307414_10848271 Ga0307414_108482711 240
119 3300037312 Ga0395899_0004440 Ga0395899_0004440_4233_4958 240
120 3300037418 Ga0395900_0004107 Ga0395900_0004107_9610_10335 240
121 3300037418 Ga0395900_0021765 Ga0395900_0021765_3524_4264 240
122 3300037466 Ga0395898_0004358 Ga0395898_0004358_5442_6167 240
123 3300037466 Ga0395898_0041164 Ga0395898_0041164_1535_2275 240
124 3300037471 Ga0395905_0041450 Ga0395905_0041450_1257_1997 240
125 3300038443 Ga0395901_0042082 Ga0395901_0042082_2367_3107 240
126 3300038443 Ga0395901_0158991 Ga0395901_0158991_1286_2011 240
127 3300049571 Ga0501034_0130925 Ga0501034_0130925_787_1515 240
128 3300049822 Ga0501035_0061873 Ga0501035_0061873_1036_1764 240
129 3300005327 Ga0070658_10249696 Ga0070658_102496962 241
130 3300005327 Ga0070658_10268095 Ga0070658_102680952 241
131 3300005329 Ga0070683_100415993 Ga0070683_1004159932 241
132 3300005337 Ga0070682_100053283 Ga0070682_1000532832 241
133 3300005353 Ga0070669_100058236 Ga0070669_1000582363 241
134 3300005354 Ga0070675_100159657 Ga0070675_1001596573 241
135 3300005356 Ga0070674_100075792 Ga0070674_1000757923 241
136 3300005458 Ga0070681_10160534 Ga0070681_101605343 241
137 3300005530 Ga0070679_100013309 Ga0070679_1000133098 241
138 3300005543 Ga0070672_100051682 Ga0070672_1000516823 241
139 3300005616 Ga0068852_100023253 Ga0068852_1000232535 241
140 3300013105 Ga0157369_10291400 Ga0157369_102914002 241
141 3300025912 Ga0207707_10388798 Ga0207707_103887982 241
142 3300025917 Ga0207660_10134313 Ga0207660_101343132 241
143 3300025921 Ga0207652_10225128 Ga0207652_102251282 241
144 3300025926 Ga0207659_10157497 Ga0207659_101574972 241
145 3300025926 Ga0207659_10165892 Ga0207659_101658921 241
146 3300025944 Ga0207661_10469522 Ga0207661_104695221 241
147 3300026041 Ga0207639_10227514 Ga0207639_102275141 241
148 3300026142 Ga0207698_10018072 Ga0207698_100180725 241
149 3300032004 Ga0307414_10065072 Ga0307414_100650723 241
150 3300044842 Ga0466957_0000101 Ga0466957_0000101_8980_9714 241
151 3300049514 Ga0501291_010123 Ga0501291_010123_160_888 241
152 3300049521 Ga0501298_003133 Ga0501298_003133_1649_2377 241
153 3300049649 Ga0501198_001761 Ga0501198_001761_1615_2343 241
154 3300049653 Ga0501206_002014 Ga0501206_002014_955_1683 241
155 3300049654 Ga0501207_015348 Ga0501207_015348_173_901 241
156 3300049661 Ga0501217_000316 Ga0501217_000316_5879_6607 241
157 3300049669 Ga0501235_003960 Ga0501235_003960_1317_2045 241
158 3300049673 Ga0501240_006721 Ga0501240_006721_517_1245 241
159 3300049674 Ga0501242_001564 Ga0501242_001564_430_1158 241
160 3300049675 Ga0501243_002420 Ga0501243_002420_605_1333 241
161 3300049675 Ga0501243_021007 Ga0501243_021007_52_780 241
162 3300049688 Ga0501259_000322 Ga0501259_000322_6685_7413 241
163 3300049690 Ga0501261_001470 Ga0501261_001470_1794_2522 241
164 3300049704 Ga0501221_002630 Ga0501221_002630_2074_2802 241
165 3300049705 Ga0501225_0011537 Ga0501225_0011537_235_963 241
166 3300003316 rootH1_10073737 rootH1_100737374 242
167 3300003322 rootL2_10139189 rootL2_101391891 242
168 3300003322 rootL2_10276564 rootL2_102765642 242
169 3300003322 rootL2_10330272 rootL2_103302722 242
170 3300003323 rootH1_10169777 rootH1_101697772 242
171 3300005290 Ga0065712_10001358 Ga0065712_100013584 242
172 3300005334 Ga0068869_100014839 Ga0068869_1000148392 242
173 3300005338 Ga0068868_100218719 Ga0068868_1002187191 242
174 3300005340 Ga0070689_100203268 Ga0070689_1002032682 242
175 3300005343 Ga0070687_100029812 Ga0070687_1000298125 242
176 3300005343 Ga0070687_100103210 Ga0070687_1001032102 242
177 3300005354 Ga0070675_100063503 Ga0070675_1000635034 242
178 3300005354 Ga0070675_100474531 Ga0070675_1004745312 242
179 3300005354 Ga0070675_100633834 Ga0070675_1006338341 242
180 3300005364 Ga0070673_100106642 Ga0070673_1001066423 242
181 3300005365 Ga0070688_100010468 Ga0070688_1000104681 242
182 3300005438 Ga0070701_10054964 Ga0070701_100549642 242
183 3300005459 Ga0068867_100292396 Ga0068867_1002923962 242
184 3300005471 Ga0070698_100003102 Ga0070698_1000031022 242
185 3300005543 Ga0070672_100374098 Ga0070672_1003740982 242
186 3300005563 Ga0068855_100016847 Ga0068855_1000168473 242
187 3300005577 Ga0068857_100089457 Ga0068857_1000894572 242
188 3300005614 Ga0068856_100038406 Ga0068856_1000384065 242
189 3300005616 Ga0068852_100205644 Ga0068852_1002056442 242
190 3300005617 Ga0068859_100158825 Ga0068859_1001588254 242
191 3300005618 Ga0068864_100080761 Ga0068864_1000807613 242
192 3300005718 Ga0068866_10350601 Ga0068866_103506012 242
193 3300005719 Ga0068861_100015930 Ga0068861_1000159305 242
194 3300005719 Ga0068861_100027522 Ga0068861_1000275223 242
195 3300005840 Ga0068870_10117273 Ga0068870_101172732 242
196 3300005841 Ga0068863_100051050 Ga0068863_1000510502 242
197 3300005844 Ga0068862_100163410 Ga0068862_1001634102 242
198 3300005844 Ga0068862_100252954 Ga0068862_1002529541 242
199 3300006195 Ga0075366_10007167 Ga0075366_100071678 242
200 3300006195 Ga0075366_10037060 Ga0075366_100370603 242
201 3300006237 Ga0097621_100022066 Ga0097621_1000220662 242
202 3300006844 Ga0075428_100005956 Ga0075428_10000595614 242
203 3300006844 Ga0075428_100167306 Ga0075428_1001673063 242
204 3300006847 Ga0075431_100123505 Ga0075431_1001235052 242
205 3300006880 Ga0075429_100000437 Ga0075429_10000043714 242
206 3300006881 Ga0068865_100137612 Ga0068865_1001376123 242
207 3300006931 Ga0097620_100158820 Ga0097620_1001588204 242
208 3300009093 Ga0105240_10330379 Ga0105240_103303792 242
209 3300009094 Ga0111539_10070610 Ga0111539_100706103 242
210 3300009094 Ga0111539_10159344 Ga0111539_101593444 242
211 3300009094 Ga0111539_10167503 Ga0111539_101675031 242
212 3300009094 Ga0111539_10268465 Ga0111539_102684653 242
213 3300009148 Ga0105243_10290712 Ga0105243_102907122 242
214 3300009174 Ga0105241_10017462 Ga0105241_100174623 242
215 3300009176 Ga0105242_10000305 Ga0105242_1000030519 242
216 3300009176 Ga0105242_10286736 Ga0105242_102867361 242
217 3300009545 Ga0105237_10068285 Ga0105237_100682852 242
218 3300009553 Ga0105249_10001069 Ga0105249_1000106913 242
219 3300009553 Ga0105249_10124870 Ga0105249_101248704 242
220 3300009553 Ga0105249_10208567 Ga0105249_102085673 242
221 3300009553 Ga0105249_10400015 Ga0105249_104000152 242
222 3300010375 Ga0105239_10000940 Ga0105239_1000094019 242
223 3300013297 Ga0157378_10840037 Ga0157378_108400371 242
224 3300013306 Ga0163162_10050123 Ga0163162_100501233 242
225 3300013306 Ga0163162_10363495 Ga0163162_103634952 242
226 3300013306 Ga0163162_11034301 Ga0163162_110343011 242
227 3300013307 Ga0157372_10172876 Ga0157372_101728762 242
228 3300013308 Ga0157375_10102827 Ga0157375_101028274 242
229 3300013308 Ga0157375_10261592 Ga0157375_102615923 242
230 3300013308 Ga0157375_10604068 Ga0157375_106040682 242
231 3300014325 Ga0163163_10379138 Ga0163163_103791381 242
232 3300014326 Ga0157380_10123430 Ga0157380_101234304 242
233 3300014326 Ga0157380_10193157 Ga0157380_101931572 242
234 3300014326 Ga0157380_10678963 Ga0157380_106789631 242
235 3300014326 Ga0157380_10802214 Ga0157380_108022142 242
236 3300014745 Ga0157377_10010450 Ga0157377_100104506 242
237 3300014745 Ga0157377_10011234 Ga0157377_100112345 242
238 3300014969 Ga0157376_11002321 Ga0157376_110023211 242
239 3300025901 Ga0207688_10012368 Ga0207688_100123685 242
240 3300025908 Ga0207643_10097092 Ga0207643_100970922 242
241 3300025909 Ga0207705_10092912 Ga0207705_100929122 242
242 3300025911 Ga0207654_10048288 Ga0207654_100482883 242
243 3300025918 Ga0207662_10023685 Ga0207662_100236853 242
244 3300025918 Ga0207662_10038195 Ga0207662_100381954 242
245 3300025923 Ga0207681_10030214 Ga0207681_100302142 242
246 3300025931 Ga0207644_10319968 Ga0207644_103199681 242
247 3300025934 Ga0207686_10000237 Ga0207686_1000023721 242
248 3300025934 Ga0207686_10227689 Ga0207686_102276892 242
249 3300025936 Ga0207670_10150095 Ga0207670_101500953 242
250 3300025938 Ga0207704_10213308 Ga0207704_102133082 242
251 3300025940 Ga0207691_10021812 Ga0207691_100218124 242
252 3300025940 Ga0207691_10139317 Ga0207691_101393173 242
253 3300025949 Ga0207667_10012866 Ga0207667_100128665 242
254 3300025960 Ga0207651_10085545 Ga0207651_100855452 242
255 3300025961 Ga0207712_10000999 Ga0207712_1000099912 242
256 3300025961 Ga0207712_10343275 Ga0207712_103432751 242
257 3300025972 Ga0207668_10344985 Ga0207668_103449852 242
258 3300025981 Ga0207640_10076949 Ga0207640_100769493 242
259 3300025986 Ga0207658_10147167 Ga0207658_101471672 242
260 3300026041 Ga0207639_10775544 Ga0207639_107755442 242
261 3300026075 Ga0207708_10087463 Ga0207708_100874632 242
262 3300026075 Ga0207708_10347004 Ga0207708_103470041 242
263 3300026078 Ga0207702_10131923 Ga0207702_101319232 242
264 3300026088 Ga0207641_10001972 Ga0207641_100019725 242
265 3300026089 Ga0207648_10085034 Ga0207648_100850343 242
266 3300026089 Ga0207648_10179868 Ga0207648_101798682 242
267 3300026095 Ga0207676_10179311 Ga0207676_101793112 242
268 3300026116 Ga0207674_10041225 Ga0207674_100412251 242
269 3300026116 Ga0207674_10193106 Ga0207674_101931062 242
270 3300026116 Ga0207674_10491777 Ga0207674_104917771 242
271 3300026118 Ga0207675_100024216 Ga0207675_1000242164 242
272 3300026118 Ga0207675_100066966 Ga0207675_1000669663 242
273 3300026142 Ga0207698_10248969 Ga0207698_102489692 242
274 3300028380 Ga0268265_10077472 Ga0268265_100774723 242
275 3300041404 Ga0439436_0002047 Ga0439436_0002047_4043_4774 242
276 3300041406 Ga0439439_0051005 Ga0439439_0051005_49_780 242
277 3300042001 Ga0439441_022322 Ga0439441_022322_328_1074 242
278 3300042007 Ga0439449_0017369 Ga0439449_0017369_490_1281 242
279 3300042007 Ga0439449_0047367 Ga0439449_0047367_634_1365 242
280 3300042014 Ga0439457_000097 Ga0439457_000097_15765_16496 242
281 3300042014 Ga0439457_043409 Ga0439457_043409_115_906 242
282 3300042015 Ga0439462_0000205 Ga0439462_0000205_9257_9988 242
283 3300042156 Ga0439446_0023650 Ga0439446_0023650_867_1598 242
284 3300044656 Ga0466969_0000362 Ga0466969_0000362_6704_7435 242
285 3300044683 Ga0466965_0069942 Ga0466965_0069942_271_1026 242
286 3300044719 Ga0466971_0059862 Ga0466971_0059862_140_895 242
287 3300044735 Ga0466968_0203871 Ga0466968_0203871_75_803 242
288 3300046539 Ga0495621_0005550 Ga0495621_0005550_1337_2071 242
289 3300046809 Ga0495600_0230589 Ga0495600_0230589_139_873 242
290 3300050493 nmdc:mga0k408_11591_c1 nmdc:mga0k408_11591_c1_469_1200 242
291 3300050508 nmdc:mga09592_2061_c1 nmdc:mga09592_2061_c1_12515_13246 242
292 3300050511 nmdc:mga08y16_129123_c1 nmdc:mga08y16_129123_c1_1280_2014 242
293 3300050511 nmdc:mga08y16_227897_c1 nmdc:mga08y16_227897_c1_550_1293 242
294 3300050511 nmdc:mga08y16_257324_c1 nmdc:mga08y16_257324_c1_913_1764 242
295 3300053098 Ga0500650_0139793 Ga0500650_0139793_156_887 242
296 3300053134 Ga0500658_0033778 Ga0500658_0033778_587_1318 242
297 3300053147 Ga0500589_060566 Ga0500589_060566_378_1109 242
298 3300053151 Ga0500604_0042107 Ga0500604_0042107_444_1214 242
299 3300053153 Ga0500616_0011519 Ga0500616_0011519_555_1295 242
300 3300053156 Ga0500622_0161355 Ga0500622_0161355_277_1008 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

60

277

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.9087 5 241
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8873 5 241
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8488 5 241
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8291 5 241
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.8254 4 241
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.9087 5 241 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8873 5 241 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8704 70 241 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8556 5 241 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8396 1 241 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A4Y7U3X3-F1-model_v4 DUF72 domain-containing protein 0.9971 49 167
AF-A0A4Q5YM53-F1-model_v4 deleted 0.9956 3 242
AF-A0A1G6ZD48-F1-model_v4 Uncharacterized conserved protein YecE, DUF72 family 0.9933 5 240
AF-A0A841JCV5-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.993 5 242
AF-A0A6N4SUT3-F1-model_v4 DUF72 domain-containing protein 0.9927 5 241

Feature Viewer

pLDDT pTM Quality
96.15 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map