F395327
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 174 | 299 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10167503|Ga0111539_101675031 |
| Length | 283 |
| Sequence | MIPIEPEPGNAGAGNRNFKREFRLRRSSFFYCYLKNLMAKLNWQIGCSGFYYKEWKGIFYPESLPQKEWFKFYAENFNTLELNVTFYRFPVLKSLETWYNTTPGNFSFAVKAPRLITHYKKFTDCTRLIDDFYTLVSRGLREKLGPILFQLPPKYSFTVERLELITKSMYKEFKNVLEFRDASWWIPQVFDHSQKEKFIFCGIDYPGLPNEAIITNQTVYYRFHGRPRLYYSAYKKDELNIIADNLLANKKITDAYIFFNNTATQAAIKNATWLKKYISSYIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 129 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 130 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 133 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 134 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 135 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 149 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 152 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 153 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 154 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 155 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 158 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 159 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 160 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 161 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 162 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 163 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 170 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 171 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 172 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 173 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.67 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10073737 | 3300003316 | Bacteria | 6152 |
| 2 | rootH2_10054837 | 3300003320 | Unclassified | 4370 |
| 3 | rootL2_10139189 | 3300003322 | Bacteria | 1546 |
| 4 | rootL2_10276564 | 3300003322 | Bacteria | 1821 |
| 5 | rootL2_10330272 | 3300003322 | Bacteria | 1326 |
| 6 | rootH1_10015670 | 3300003323 | Bacteria | 15624 |
| 7 | rootH1_10098697 | 3300003323 | Bacteria | 5533 |
| 8 | rootH1_10169777 | 3300003323 | Bacteria | 1121 |
| 9 | Ga0065712_10001358 | 3300005290 | Bacteria | 6597 |
| 10 | Ga0070658_10249696 | 3300005327 | Bacteria | 1505 |
| 11 | Ga0070658_10268095 | 3300005327 | Bacteria | 1451 |
| 12 | Ga0070658_10362578 | 3300005327 | Bacteria | 1241 |
| 13 | Ga0070658_10466906 | 3300005327 | Bacteria | 1088 |
| 14 | Ga0070658_10654573 | 3300005327 | Bacteria | 911 |
| 15 | Ga0070683_100415993 | 3300005329 | Bacteria | 1282 |
| 16 | Ga0070670_100022643 | 3300005331 | Bacteria | 5407 |
| 17 | Ga0070670_100131782 | 3300005331 | Bacteria | 2159 |
| 18 | Ga0068869_100014839 | 3300005334 | Bacteria | 5208 |
| 19 | Ga0070680_100009300 | 3300005336 | Bacteria | 7546 |
| 20 | Ga0070682_100053283 | 3300005337 | Bacteria | 2535 |
| 21 | Ga0068868_100218719 | 3300005338 | Bacteria | 1594 |
| 22 | Ga0070660_100027993 | 3300005339 | Bacteria | 4212 |
| 23 | Ga0070660_100299368 | 3300005339 | Bacteria | 1318 |
| 24 | Ga0070689_100203268 | 3300005340 | Bacteria | 1618 |
| 25 | Ga0070687_100029812 | 3300005343 | Unclassified | 2661 |
| 26 | Ga0070687_100103210 | 3300005343 | Bacteria | 1600 |
| 27 | Ga0070692_10430377 | 3300005345 | Bacteria | 840 |
| 28 | Ga0070669_100058236 | 3300005353 | Bacteria | 2835 |
| 29 | Ga0070675_100063503 | 3300005354 | Bacteria | 3053 |
| 30 | Ga0070675_100159657 | 3300005354 | Bacteria | 1938 |
| 31 | Ga0070675_100474531 | 3300005354 | Bacteria | 1124 |
| 32 | Ga0070675_100633834 | 3300005354 | Unclassified | 971 |
| 33 | Ga0070671_100260856 | 3300005355 | Bacteria | 1473 |
| 34 | Ga0070674_100075792 | 3300005356 | Bacteria | 2390 |
| 35 | Ga0070673_100106642 | 3300005364 | Bacteria | 2316 |
| 36 | Ga0070688_100010468 | 3300005365 | Bacteria | 5114 |
| 37 | Ga0070701_10054964 | 3300005438 | Bacteria | 2077 |
| 38 | Ga0070663_100224390 | 3300005455 | Bacteria | 1476 |
| 39 | Ga0070678_100209798 | 3300005456 | Bacteria | 1613 |
| 40 | Ga0070681_10128731 | 3300005458 | Unclassified | 2464 |
| 41 | Ga0070681_10160534 | 3300005458 | Bacteria | 2172 |
| 42 | Ga0070681_10177273 | 3300005458 | Bacteria | 2053 |
| 43 | Ga0068867_100292396 | 3300005459 | Bacteria | 1340 |
| 44 | Ga0070698_100003102 | 3300005471 | Bacteria | 18312 |
| 45 | Ga0070679_100001881 | 3300005530 | Bacteria | 18884 |
| 46 | Ga0070679_100013309 | 3300005530 | Bacteria | 7876 |
| 47 | Ga0070679_100243304 | 3300005530 | Bacteria | 1756 |
| 48 | Ga0070672_100051682 | 3300005543 | Bacteria | 3206 |
| 49 | Ga0070672_100374098 | 3300005543 | Bacteria | 1218 |
| 50 | Ga0068855_100016847 | 3300005563 | Bacteria | 8791 |
| 51 | Ga0068855_100022378 | 3300005563 | Bacteria | 7574 |
| 52 | Ga0068855_100175001 | 3300005563 | Bacteria | 2429 |
| 53 | Ga0068857_100070945 | 3300005577 | Bacteria | 3103 |
| 54 | Ga0068857_100089457 | 3300005577 | Bacteria | 2755 |
| 55 | Ga0068854_100447112 | 3300005578 | Bacteria | 1078 |
| 56 | Ga0068856_100038406 | 3300005614 | Bacteria | 4701 |
| 57 | Ga0068856_100340592 | 3300005614 | Bacteria | 1518 |
| 58 | Ga0068852_100023253 | 3300005616 | Bacteria | 4985 |
| 59 | Ga0068852_100205644 | 3300005616 | Bacteria | 1865 |
| 60 | Ga0068852_100459191 | 3300005616 | Unclassified | 1262 |
| 61 | Ga0068859_100158825 | 3300005617 | Bacteria | 2339 |
| 62 | Ga0068859_101096701 | 3300005617 | Bacteria | 875 |
| 63 | Ga0068864_100080761 | 3300005618 | Bacteria | 2849 |
| 64 | Ga0068866_10003384 | 3300005718 | Bacteria | 6541 |
| 65 | Ga0068866_10350601 | 3300005718 | Bacteria | 938 |
| 66 | Ga0068861_100015930 | 3300005719 | Bacteria | 5307 |
| 67 | Ga0068861_100027522 | 3300005719 | Bacteria | 4142 |
| 68 | Ga0068870_10117273 | 3300005840 | Bacteria | 1528 |
| 69 | Ga0068863_100051050 | 3300005841 | Bacteria | 3920 |
| 70 | Ga0068862_100163410 | 3300005844 | Bacteria | 1989 |
| 71 | Ga0068862_100252954 | 3300005844 | Bacteria | 1606 |
| 72 | Ga0075366_10007167 | 3300006195 | Bacteria | 6140 |
| 73 | Ga0075366_10009582 | 3300006195 | Bacteria | 5410 |
| 74 | Ga0075366_10037060 | 3300006195 | Bacteria | 2877 |
| 75 | Ga0097621_100022066 | 3300006237 | Bacteria | 4937 |
| 76 | Ga0097621_100194472 | 3300006237 | Unclassified | 1758 |
| 77 | Ga0075370_10141572 | 3300006353 | Bacteria | 1406 |
| 78 | Ga0068871_100286947 | 3300006358 | Bacteria | 1441 |
| 79 | Ga0075428_100005956 | 3300006844 | Bacteria | 13547 |
| 80 | Ga0075428_100167306 | 3300006844 | Bacteria | 2385 |
| 81 | Ga0075431_100123505 | 3300006847 | Bacteria | 2671 |
| 82 | Ga0075429_100000437 | 3300006880 | Bacteria | 31026 |
| 83 | Ga0068865_100137612 | 3300006881 | Bacteria | 1837 |
| 84 | Ga0097620_100158820 | 3300006931 | Bacteria | 2339 |
| 85 | Ga0097620_101096727 | 3300006931 | Bacteria | 875 |
| 86 | Ga0105240_10000068 | 3300009093 | Bacteria | 207756 |
| 87 | Ga0105240_10330379 | 3300009093 | Unclassified | 1735 |
| 88 | Ga0105240_10673306 | 3300009093 | Bacteria | 1132 |
| 89 | Ga0111539_10070610 | 3300009094 | Bacteria | 4123 |
| 90 | Ga0111539_10159344 | 3300009094 | Bacteria | 2640 |
| 91 | Ga0111539_10167503 | 3300009094 | Bacteria | 2568 |
| 92 | Ga0111539_10268465 | 3300009094 | Bacteria | 1986 |
| 93 | Ga0114129_10001087 | 3300009147 | Bacteria | 35667 |
| 94 | Ga0105243_10290712 | 3300009148 | Bacteria | 1476 |
| 95 | Ga0105241_10010599 | 3300009174 | Bacteria | 6760 |
| 96 | Ga0105241_10017462 | 3300009174 | Bacteria | 5276 |
| 97 | Ga0105241_10463475 | 3300009174 | Unclassified | 1123 |
| 98 | Ga0105242_10000305 | 3300009176 | Bacteria | 39232 |
| 99 | Ga0105242_10286736 | 3300009176 | Bacteria | 1498 |
| 100 | Ga0105237_10042274 | 3300009545 | Bacteria | 4597 |
| 101 | Ga0105237_10068285 | 3300009545 | Bacteria | 3549 |
| 102 | Ga0105238_10058207 | 3300009551 | Bacteria | 3874 |
| 103 | Ga0105249_10001069 | 3300009553 | Bacteria | 24300 |
| 104 | Ga0105249_10124870 | 3300009553 | Bacteria | 2450 |
| 105 | Ga0105249_10208567 | 3300009553 | Bacteria | 1916 |
| 106 | Ga0105249_10400015 | 3300009553 | Bacteria | 1403 |
| 107 | Ga0105239_10000940 | 3300010375 | Bacteria | 41071 |
| 108 | Ga0105239_10005787 | 3300010375 | Bacteria | 14422 |
| 109 | Ga0157373_10073009 | 3300013100 | Bacteria | 2422 |
| 110 | Ga0157373_10097130 | 3300013100 | Bacteria | 2074 |
| 111 | Ga0157373_10108796 | 3300013100 | Unclassified | 1949 |
| 112 | Ga0157371_10006231 | 3300013102 | Bacteria | 9891 |
| 113 | Ga0157371_10062071 | 3300013102 | Bacteria | 2650 |
| 114 | Ga0157371_10083598 | 3300013102 | Unclassified | 2260 |
| 115 | Ga0157371_10086758 | 3300013102 | Unclassified | 2216 |
| 116 | Ga0157371_10294753 | 3300013102 | Bacteria | 1173 |
| 117 | Ga0157371_10342377 | 3300013102 | Bacteria | 1088 |
| 118 | Ga0157370_10001205 | 3300013104 | Bacteria | 32309 |
| 119 | Ga0157370_10280343 | 3300013104 | Bacteria | 1540 |
| 120 | Ga0157369_10107439 | 3300013105 | Bacteria | 2969 |
| 121 | Ga0157369_10165231 | 3300013105 | Bacteria | 2335 |
| 122 | Ga0157369_10291400 | 3300013105 | Bacteria | 1699 |
| 123 | Ga0157369_10554578 | 3300013105 | Bacteria | 1188 |
| 124 | Ga0157378_10372962 | 3300013297 | Bacteria | 1399 |
| 125 | Ga0157378_10840037 | 3300013297 | Bacteria | 946 |
| 126 | Ga0163162_10000201 | 3300013306 | Bacteria | 55260 |
| 127 | Ga0163162_10050123 | 3300013306 | Bacteria | 4187 |
| 128 | Ga0163162_10136138 | 3300013306 | Unclassified | 2567 |
| 129 | Ga0163162_10363495 | 3300013306 | Bacteria | 1580 |
| 130 | Ga0163162_10683092 | 3300013306 | Bacteria | 1149 |
| 131 | Ga0163162_11034301 | 3300013306 | Bacteria | 929 |
| 132 | Ga0157372_10011324 | 3300013307 | Bacteria | 9484 |
| 133 | Ga0157372_10074463 | 3300013307 | Bacteria | 3829 |
| 134 | Ga0157372_10172876 | 3300013307 | Bacteria | 2499 |
| 135 | Ga0157372_11073754 | 3300013307 | Bacteria | 932 |
| 136 | Ga0157375_10102827 | 3300013308 | Bacteria | 2943 |
| 137 | Ga0157375_10261592 | 3300013308 | Bacteria | 1892 |
| 138 | Ga0157375_10317398 | 3300013308 | Bacteria | 1723 |
| 139 | Ga0157375_10604068 | 3300013308 | Bacteria | 1256 |
| 140 | Ga0163163_10379138 | 3300014325 | Bacteria | 1472 |
| 141 | Ga0157380_10123430 | 3300014326 | Bacteria | 2198 |
| 142 | Ga0157380_10193157 | 3300014326 | Bacteria | 1799 |
| 143 | Ga0157380_10678963 | 3300014326 | Bacteria | 1032 |
| 144 | Ga0157380_10802214 | 3300014326 | Bacteria | 958 |
| 145 | Ga0157377_10010450 | 3300014745 | Bacteria | 4592 |
| 146 | Ga0157377_10011234 | 3300014745 | Unclassified | 4462 |
| 147 | Ga0157379_10173316 | 3300014968 | Bacteria | 1947 |
| 148 | Ga0157376_10296818 | 3300014969 | Unclassified | 1528 |
| 149 | Ga0157376_11002321 | 3300014969 | Bacteria | 858 |
| 150 | Ga0182007_10009924 | 3300015262 | Bacteria | 3796 |
| 151 | Ga0163161_10584392 | 3300017792 | Bacteria | 919 |
| 152 | Ga0207642_10020913 | 3300025899 | Unclassified | 2565 |
| 153 | Ga0207688_10012368 | 3300025901 | Bacteria | 4643 |
| 154 | Ga0207645_10302644 | 3300025907 | Bacteria | 1065 |
| 155 | Ga0207643_10097092 | 3300025908 | Bacteria | 1724 |
| 156 | Ga0207705_10013236 | 3300025909 | Bacteria | 5954 |
| 157 | Ga0207705_10085862 | 3300025909 | Bacteria | 2299 |
| 158 | Ga0207705_10092912 | 3300025909 | Unclassified | 2211 |
| 159 | Ga0207705_10133297 | 3300025909 | Bacteria | 1850 |
| 160 | Ga0207705_10181340 | 3300025909 | Unclassified | 1589 |
| 161 | Ga0207654_10048288 | 3300025911 | Bacteria | 2435 |
| 162 | Ga0207654_10297965 | 3300025911 | Bacteria | 1096 |
| 163 | Ga0207707_10245016 | 3300025912 | Bacteria | 1557 |
| 164 | Ga0207707_10388798 | 3300025912 | Bacteria | 1198 |
| 165 | Ga0207707_10498904 | 3300025912 | Bacteria | 1038 |
| 166 | Ga0207695_10000131 | 3300025913 | Bacteria | 223762 |
| 167 | Ga0207695_10364630 | 3300025913 | Bacteria | 1331 |
| 168 | Ga0207671_10022880 | 3300025914 | Bacteria | 4719 |
| 169 | Ga0207660_10047846 | 3300025917 | Bacteria | 3025 |
| 170 | Ga0207660_10134313 | 3300025917 | Bacteria | 1886 |
| 171 | Ga0207662_10023685 | 3300025918 | Bacteria | 3529 |
| 172 | Ga0207662_10038195 | 3300025918 | Bacteria | 2813 |
| 173 | Ga0207657_10225470 | 3300025919 | Bacteria | 1500 |
| 174 | Ga0207652_10000011 | 3300025921 | Bacteria | 246742 |
| 175 | Ga0207652_10008482 | 3300025921 | Bacteria | 8271 |
| 176 | Ga0207652_10217509 | 3300025921 | Bacteria | 1721 |
| 177 | Ga0207652_10225128 | 3300025921 | Bacteria | 1690 |
| 178 | Ga0207681_10030214 | 3300025923 | Bacteria | 3530 |
| 179 | Ga0207681_10343612 | 3300025923 | Bacteria | 1193 |
| 180 | Ga0207650_10206396 | 3300025925 | Bacteria | 1576 |
| 181 | Ga0207659_10157497 | 3300025926 | Bacteria | 1780 |
| 182 | Ga0207659_10165892 | 3300025926 | Bacteria | 1738 |
| 183 | Ga0207644_10319968 | 3300025931 | Bacteria | 1254 |
| 184 | Ga0207690_10004453 | 3300025932 | Bacteria | 8271 |
| 185 | Ga0207686_10000237 | 3300025934 | Bacteria | 42142 |
| 186 | Ga0207686_10227689 | 3300025934 | Bacteria | 1350 |
| 187 | Ga0207670_10150095 | 3300025936 | Bacteria | 1728 |
| 188 | Ga0207704_10213308 | 3300025938 | Bacteria | 1423 |
| 189 | Ga0207691_10021812 | 3300025940 | Bacteria | 6045 |
| 190 | Ga0207691_10139317 | 3300025940 | Bacteria | 2138 |
| 191 | Ga0207661_10032460 | 3300025944 | Bacteria | 4046 |
| 192 | Ga0207661_10469522 | 3300025944 | Bacteria | 1148 |
| 193 | Ga0207667_10010318 | 3300025949 | Bacteria | 10926 |
| 194 | Ga0207667_10012866 | 3300025949 | Bacteria | 9614 |
| 195 | Ga0207667_10110306 | 3300025949 | Bacteria | 2838 |
| 196 | Ga0207651_10085545 | 3300025960 | Bacteria | 2288 |
| 197 | Ga0207712_10000999 | 3300025961 | Bacteria | 20149 |
| 198 | Ga0207712_10343275 | 3300025961 | Bacteria | 1239 |
| 199 | Ga0207668_10344985 | 3300025972 | Bacteria | 1243 |
| 200 | Ga0207640_10076949 | 3300025981 | Bacteria | 2267 |
| 201 | Ga0207658_10147167 | 3300025986 | Bacteria | 1915 |
| 202 | Ga0207639_10227514 | 3300026041 | Bacteria | 1614 |
| 203 | Ga0207639_10775544 | 3300026041 | Unclassified | 893 |
| 204 | Ga0207678_10346804 | 3300026067 | Bacteria | 1280 |
| 205 | Ga0207708_10087463 | 3300026075 | Bacteria | 2399 |
| 206 | Ga0207708_10347004 | 3300026075 | Bacteria | 1217 |
| 207 | Ga0207702_10102684 | 3300026078 | Unclassified | 2527 |
| 208 | Ga0207702_10131923 | 3300026078 | Bacteria | 2249 |
| 209 | Ga0207641_10001972 | 3300026088 | Bacteria | 19612 |
| 210 | Ga0207648_10064300 | 3300026089 | Unclassified | 3198 |
| 211 | Ga0207648_10085034 | 3300026089 | Bacteria | 2759 |
| 212 | Ga0207648_10179868 | 3300026089 | Bacteria | 1872 |
| 213 | Ga0207676_10179311 | 3300026095 | Bacteria | 1853 |
| 214 | Ga0207674_10041225 | 3300026116 | Bacteria | 4776 |
| 215 | Ga0207674_10193106 | 3300026116 | Bacteria | 1986 |
| 216 | Ga0207674_10286960 | 3300026116 | Bacteria | 1594 |
| 217 | Ga0207674_10491777 | 3300026116 | Bacteria | 1185 |
| 218 | Ga0207675_100024216 | 3300026118 | Bacteria | 5645 |
| 219 | Ga0207675_100052117 | 3300026118 | Bacteria | 3818 |
| 220 | Ga0207675_100066966 | 3300026118 | Bacteria | 3357 |
| 221 | Ga0207698_10018072 | 3300026142 | Bacteria | 4797 |
| 222 | Ga0207698_10248969 | 3300026142 | Bacteria | 1625 |
| 223 | Ga0268266_10509050 | 3300028379 | Bacteria | 1150 |
| 224 | Ga0268265_10077472 | 3300028380 | Bacteria | 2611 |
| 225 | Ga0307513_10211550 | 3300031456 | Bacteria | 1770 |
| 226 | Ga0307405_10007814 | 3300031731 | Bacteria | 5382 |
| 227 | Ga0307412_10149931 | 3300031911 | Bacteria | 1719 |
| 228 | Ga0307414_10002223 | 3300032004 | Bacteria | 10124 |
| 229 | Ga0307414_10065072 | 3300032004 | Bacteria | 2600 |
| 230 | Ga0307414_10848271 | 3300032004 | Unclassified | 835 |
| 231 | Ga0395899_0004440 | 3300037312 | Bacteria | 10941 |
| 232 | Ga0395899_0008012 | 3300037312 | Bacteria | 8135 |
| 233 | Ga0395900_0004107 | 3300037418 | Bacteria | 15516 |
| 234 | Ga0395900_0013714 | 3300037418 | Bacteria | 8273 |
| 235 | Ga0395900_0021765 | 3300037418 | Bacteria | 6555 |
| 236 | Ga0395900_0411617 | 3300037418 | Bacteria | 1314 |
| 237 | Ga0395898_0004015 | 3300037466 | Bacteria | 16181 |
| 238 | Ga0395898_0004358 | 3300037466 | Bacteria | 15487 |
| 239 | Ga0395898_0041164 | 3300037466 | Bacteria | 4564 |
| 240 | Ga0395898_0287557 | 3300037466 | Bacteria | 1568 |
| 241 | Ga0395905_0041450 | 3300037471 | Unclassified | 4320 |
| 242 | Ga0395901_0042082 | 3300038443 | Bacteria | 4735 |
| 243 | Ga0395901_0158991 | 3300038443 | Bacteria | 2373 |
| 244 | Ga0395901_0555491 | 3300038443 | Bacteria | 1163 |
| 245 | Ga0395901_0661725 | 3300038443 | Bacteria | 1046 |
| 246 | Ga0439436_0002047 | 3300041404 | Bacteria | 6007 |
| 247 | Ga0439439_0051005 | 3300041406 | Bacteria | 1085 |
| 248 | Ga0439441_022322 | 3300042001 | Bacteria | 1175 |
| 249 | Ga0439445_0041036 | 3300042004 | Unclassified | 1229 |
| 250 | Ga0439449_0017369 | 3300042007 | Bacteria | 2702 |
| 251 | Ga0439449_0023888 | 3300042007 | Bacteria | 2286 |
| 252 | Ga0439449_0047367 | 3300042007 | Bacteria | 1592 |
| 253 | Ga0439457_000097 | 3300042014 | Bacteria | 20341 |
| 254 | Ga0439457_043409 | 3300042014 | Bacteria | 1003 |
| 255 | Ga0439462_0000205 | 3300042015 | Bacteria | 10292 |
| 256 | Ga0439446_0023650 | 3300042156 | Unclassified | 1750 |
| 257 | Ga0439434_0020674 | 3300042435 | Unclassified | 1977 |
| 258 | Ga0466969_0000362 | 3300044656 | Bacteria | 24925 |
| 259 | Ga0466965_0069942 | 3300044683 | Bacteria | 1764 |
| 260 | Ga0466971_0059862 | 3300044719 | Bacteria | 1721 |
| 261 | Ga0466968_0203871 | 3300044735 | Bacteria | 927 |
| 262 | Ga0466957_0000101 | 3300044842 | Bacteria | 34646 |
| 263 | Ga0495606_0002752 | 3300046507 | Bacteria | 19721 |
| 264 | Ga0495621_0005550 | 3300046539 | Bacteria | 3632 |
| 265 | Ga0495668_0000099 | 3300046616 | Bacteria | 137915 |
| 266 | Ga0495668_0007460 | 3300046616 | Bacteria | 6988 |
| 267 | Ga0495611_0127037 | 3300046648 | Bacteria | 1189 |
| 268 | Ga0495600_0230589 | 3300046809 | Bacteria | 1182 |
| 269 | Ga0495672_0016183 | 3300047320 | Bacteria | 5040 |
| 270 | Ga0501291_010123 | 3300049514 | Bacteria | 1336 |
| 271 | Ga0501298_003133 | 3300049521 | Bacteria | 2551 |
| 272 | Ga0501034_0130925 | 3300049571 | Unclassified | 2492 |
| 273 | Ga0501198_001761 | 3300049649 | Bacteria | 2854 |
| 274 | Ga0501206_002014 | 3300049653 | Bacteria | 2561 |
| 275 | Ga0501207_015348 | 3300049654 | Bacteria | 1178 |
| 276 | Ga0501217_000316 | 3300049661 | Bacteria | 7712 |
| 277 | Ga0501223_005924 | 3300049663 | Unclassified | 2552 |
| 278 | Ga0501235_003960 | 3300049669 | Bacteria | 3205 |
| 279 | Ga0501240_006721 | 3300049673 | Bacteria | 1424 |
| 280 | Ga0501242_001564 | 3300049674 | Bacteria | 2320 |
| 281 | Ga0501243_002420 | 3300049675 | Bacteria | 2732 |
| 282 | Ga0501243_021007 | 3300049675 | Bacteria | 1076 |
| 283 | Ga0501259_000322 | 3300049688 | Bacteria | 7571 |
| 284 | Ga0501261_001470 | 3300049690 | Bacteria | 2897 |
| 285 | Ga0501221_002630 | 3300049704 | Unclassified | 2958 |
| 286 | Ga0501225_0011537 | 3300049705 | Bacteria | 2485 |
| 287 | Ga0501035_0061873 | 3300049822 | Bacteria | 3331 |
| 288 | nmdc:mga0k408_11591_c1 | 3300050493 | Bacteria | 4804 |
| 289 | nmdc:mga05p37_4461_c2 | 3300050507 | Bacteria | 10234 |
| 290 | nmdc:mga09592_2061_c1 | 3300050508 | Bacteria | 16202 |
| 291 | nmdc:mga08y16_129123_c1 | 3300050511 | Bacteria | 2629 |
| 292 | nmdc:mga08y16_227897_c1 | 3300050511 | Bacteria | 1928 |
| 293 | nmdc:mga08y16_257324_c1 | 3300050511 | Bacteria | 1803 |
| 294 | Ga0500650_0139793 | 3300053098 | Bacteria | 1123 |
| 295 | Ga0500658_0033778 | 3300053134 | Unclassified | 2014 |
| 296 | Ga0500589_060566 | 3300053147 | Unclassified | 1735 |
| 297 | Ga0500604_0042107 | 3300053151 | Bacteria | 1383 |
| 298 | Ga0500616_0011519 | 3300053153 | Bacteria | 5216 |
| 299 | Ga0500622_0161355 | 3300053156 | Unclassified | 1051 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009174 | Ga0105241_10463475 | Ga0105241_104634751 | 192 |
| 2 | 3300037466 | Ga0395898_0287557 | Ga0395898_0287557_915_1550 | 211 |
| 3 | 3300025907 | Ga0207645_10302644 | Ga0207645_103026441 | 220 |
| 4 | 3300025923 | Ga0207681_10343612 | Ga0207681_103436122 | 220 |
| 5 | 3300026118 | Ga0207675_100052117 | Ga0207675_1000521175 | 220 |
| 6 | 3300013306 | Ga0163162_10136138 | Ga0163162_101361382 | 232 |
| 7 | 3300009147 | Ga0114129_10001087 | Ga0114129_1000108727 | 233 |
| 8 | 3300050507 | nmdc:mga05p37_4461_c2 | nmdc:mga05p37_4461_c2_6261_6998 | 233 |
| 9 | iso_pu_bacteria | 2898713307 | 2898714036 | 236 |
| 10 | 3300028379 | Ga0268266_10509050 | Ga0268266_105090502 | 237 |
| 11 | 3300046616 | Ga0495668_0007460 | Ga0495668_0007460_4501_5268 | 237 |
| 12 | 3300005578 | Ga0068854_100447112 | Ga0068854_1004471121 | 238 |
| 13 | 3300009093 | Ga0105240_10000068 | Ga0105240_10000068163 | 238 |
| 14 | 3300009174 | Ga0105241_10010599 | Ga0105241_100105997 | 238 |
| 15 | 3300009545 | Ga0105237_10042274 | Ga0105237_100422743 | 238 |
| 16 | 3300009551 | Ga0105238_10058207 | Ga0105238_100582073 | 238 |
| 17 | 3300010375 | Ga0105239_10005787 | Ga0105239_100057879 | 238 |
| 18 | 3300025911 | Ga0207654_10297965 | Ga0207654_102979651 | 238 |
| 19 | 3300025913 | Ga0207695_10000131 | Ga0207695_10000131164 | 238 |
| 20 | 3300025914 | Ga0207671_10022880 | Ga0207671_100228803 | 238 |
| 21 | 3300003323 | rootH1_10015670 | rootH1_100156702 | 239 |
| 22 | 3300003323 | rootH1_10098697 | rootH1_100986972 | 239 |
| 23 | 3300005327 | Ga0070658_10654573 | Ga0070658_106545731 | 239 |
| 24 | 3300005331 | Ga0070670_100131782 | Ga0070670_1001317822 | 239 |
| 25 | 3300005336 | Ga0070680_100009300 | Ga0070680_1000093007 | 239 |
| 26 | 3300005355 | Ga0070671_100260856 | Ga0070671_1002608562 | 239 |
| 27 | 3300005455 | Ga0070663_100224390 | Ga0070663_1002243902 | 239 |
| 28 | 3300005456 | Ga0070678_100209798 | Ga0070678_1002097982 | 239 |
| 29 | 3300005458 | Ga0070681_10128731 | Ga0070681_101287311 | 239 |
| 30 | 3300005563 | Ga0068855_100022378 | Ga0068855_1000223787 | 239 |
| 31 | 3300005563 | Ga0068855_100175001 | Ga0068855_1001750012 | 239 |
| 32 | 3300005614 | Ga0068856_100340592 | Ga0068856_1003405923 | 239 |
| 33 | 3300005617 | Ga0068859_101096701 | Ga0068859_1010967011 | 239 |
| 34 | 3300005718 | Ga0068866_10003384 | Ga0068866_100033842 | 239 |
| 35 | 3300006195 | Ga0075366_10009582 | Ga0075366_100095824 | 239 |
| 36 | 3300006237 | Ga0097621_100194472 | Ga0097621_1001944722 | 239 |
| 37 | 3300006353 | Ga0075370_10141572 | Ga0075370_101415721 | 239 |
| 38 | 3300006358 | Ga0068871_100286947 | Ga0068871_1002869472 | 239 |
| 39 | 3300006931 | Ga0097620_101096727 | Ga0097620_1010967272 | 239 |
| 40 | 3300009093 | Ga0105240_10673306 | Ga0105240_106733062 | 239 |
| 41 | 3300013100 | Ga0157373_10108796 | Ga0157373_101087963 | 239 |
| 42 | 3300013102 | Ga0157371_10006231 | Ga0157371_100062315 | 239 |
| 43 | 3300013102 | Ga0157371_10086758 | Ga0157371_100867582 | 239 |
| 44 | 3300013104 | Ga0157370_10001205 | Ga0157370_100012058 | 239 |
| 45 | 3300013104 | Ga0157370_10280343 | Ga0157370_102803433 | 239 |
| 46 | 3300013105 | Ga0157369_10165231 | Ga0157369_101652313 | 239 |
| 47 | 3300013105 | Ga0157369_10554578 | Ga0157369_105545782 | 239 |
| 48 | 3300013306 | Ga0163162_10000201 | Ga0163162_1000020136 | 239 |
| 49 | 3300013306 | Ga0163162_10683092 | Ga0163162_106830922 | 239 |
| 50 | 3300013308 | Ga0157375_10317398 | Ga0157375_103173981 | 239 |
| 51 | 3300014968 | Ga0157379_10173316 | Ga0157379_101733162 | 239 |
| 52 | 3300014969 | Ga0157376_10296818 | Ga0157376_102968183 | 239 |
| 53 | 3300025899 | Ga0207642_10020913 | Ga0207642_100209132 | 239 |
| 54 | 3300025909 | Ga0207705_10013236 | Ga0207705_100132363 | 239 |
| 55 | 3300025909 | Ga0207705_10085862 | Ga0207705_100858622 | 239 |
| 56 | 3300025909 | Ga0207705_10133297 | Ga0207705_101332971 | 239 |
| 57 | 3300025912 | Ga0207707_10245016 | Ga0207707_102450161 | 239 |
| 58 | 3300025913 | Ga0207695_10364630 | Ga0207695_103646302 | 239 |
| 59 | 3300025917 | Ga0207660_10047846 | Ga0207660_100478462 | 239 |
| 60 | 3300025921 | Ga0207652_10008482 | Ga0207652_100084823 | 239 |
| 61 | 3300025925 | Ga0207650_10206396 | Ga0207650_102063962 | 239 |
| 62 | 3300025944 | Ga0207661_10032460 | Ga0207661_100324604 | 239 |
| 63 | 3300025949 | Ga0207667_10010318 | Ga0207667_100103187 | 239 |
| 64 | 3300026067 | Ga0207678_10346804 | Ga0207678_103468042 | 239 |
| 65 | 3300026078 | Ga0207702_10102684 | Ga0207702_101026842 | 239 |
| 66 | 3300026089 | Ga0207648_10064300 | Ga0207648_100643003 | 239 |
| 67 | 3300031731 | Ga0307405_10007814 | Ga0307405_100078144 | 239 |
| 68 | 3300031911 | Ga0307412_10149931 | Ga0307412_101499313 | 239 |
| 69 | 3300037312 | Ga0395899_0008012 | Ga0395899_0008012_5006_5749 | 239 |
| 70 | 3300037418 | Ga0395900_0013714 | Ga0395900_0013714_4370_5089 | 239 |
| 71 | 3300037418 | Ga0395900_0411617 | Ga0395900_0411617_392_1111 | 239 |
| 72 | 3300037466 | Ga0395898_0004015 | Ga0395898_0004015_8505_9248 | 239 |
| 73 | 3300038443 | Ga0395901_0555491 | Ga0395901_0555491_116_835 | 239 |
| 74 | 3300038443 | Ga0395901_0661725 | Ga0395901_0661725_239_982 | 239 |
| 75 | 3300042004 | Ga0439445_0041036 | Ga0439445_0041036_194_934 | 239 |
| 76 | 3300042007 | Ga0439449_0023888 | Ga0439449_0023888_342_1082 | 239 |
| 77 | 3300042435 | Ga0439434_0020674 | Ga0439434_0020674_766_1506 | 239 |
| 78 | 3300046507 | Ga0495606_0002752 | Ga0495606_0002752_6101_6832 | 239 |
| 79 | 3300046616 | Ga0495668_0000099 | Ga0495668_0000099_731_1459 | 239 |
| 80 | 3300046648 | Ga0495611_0127037 | Ga0495611_0127037_192_920 | 239 |
| 81 | 3300047320 | Ga0495672_0016183 | Ga0495672_0016183_3681_4436 | 239 |
| 82 | 3300049663 | Ga0501223_005924 | Ga0501223_005924_993_1712 | 239 |
| 83 | 3300003320 | rootH2_10054837 | rootH2_100548373 | 240 |
| 84 | 3300005327 | Ga0070658_10362578 | Ga0070658_103625782 | 240 |
| 85 | 3300005327 | Ga0070658_10466906 | Ga0070658_104669061 | 240 |
| 86 | 3300005331 | Ga0070670_100022643 | Ga0070670_1000226433 | 240 |
| 87 | 3300005339 | Ga0070660_100027993 | Ga0070660_1000279932 | 240 |
| 88 | 3300005339 | Ga0070660_100299368 | Ga0070660_1002993682 | 240 |
| 89 | 3300005345 | Ga0070692_10430377 | Ga0070692_104303771 | 240 |
| 90 | 3300005458 | Ga0070681_10177273 | Ga0070681_101772731 | 240 |
| 91 | 3300005530 | Ga0070679_100001881 | Ga0070679_1000018813 | 240 |
| 92 | 3300005530 | Ga0070679_100243304 | Ga0070679_1002433042 | 240 |
| 93 | 3300005577 | Ga0068857_100070945 | Ga0068857_1000709452 | 240 |
| 94 | 3300005616 | Ga0068852_100459191 | Ga0068852_1004591912 | 240 |
| 95 | 3300013100 | Ga0157373_10073009 | Ga0157373_100730092 | 240 |
| 96 | 3300013100 | Ga0157373_10097130 | Ga0157373_100971302 | 240 |
| 97 | 3300013102 | Ga0157371_10062071 | Ga0157371_100620712 | 240 |
| 98 | 3300013102 | Ga0157371_10083598 | Ga0157371_100835982 | 240 |
| 99 | 3300013102 | Ga0157371_10294753 | Ga0157371_102947532 | 240 |
| 100 | 3300013102 | Ga0157371_10342377 | Ga0157371_103423772 | 240 |
| 101 | 3300013105 | Ga0157369_10107439 | Ga0157369_101074392 | 240 |
| 102 | 3300013297 | Ga0157378_10372962 | Ga0157378_103729622 | 240 |
| 103 | 3300013307 | Ga0157372_10011324 | Ga0157372_100113242 | 240 |
| 104 | 3300013307 | Ga0157372_10074463 | Ga0157372_100744632 | 240 |
| 105 | 3300013307 | Ga0157372_11073754 | Ga0157372_110737542 | 240 |
| 106 | 3300015262 | Ga0182007_10009924 | Ga0182007_100099242 | 240 |
| 107 | 3300017792 | Ga0163161_10584392 | Ga0163161_105843921 | 240 |
| 108 | 3300025909 | Ga0207705_10181340 | Ga0207705_101813401 | 240 |
| 109 | 3300025912 | Ga0207707_10498904 | Ga0207707_104989041 | 240 |
| 110 | 3300025919 | Ga0207657_10225470 | Ga0207657_102254702 | 240 |
| 111 | 3300025921 | Ga0207652_10000011 | Ga0207652_100000117 | 240 |
| 112 | 3300025921 | Ga0207652_10217509 | Ga0207652_102175092 | 240 |
| 113 | 3300025932 | Ga0207690_10004453 | Ga0207690_100044534 | 240 |
| 114 | 3300025949 | Ga0207667_10110306 | Ga0207667_101103062 | 240 |
| 115 | 3300026116 | Ga0207674_10286960 | Ga0207674_102869603 | 240 |
| 116 | 3300031456 | Ga0307513_10211550 | Ga0307513_102115502 | 240 |
| 117 | 3300032004 | Ga0307414_10002223 | Ga0307414_100022232 | 240 |
| 118 | 3300032004 | Ga0307414_10848271 | Ga0307414_108482711 | 240 |
| 119 | 3300037312 | Ga0395899_0004440 | Ga0395899_0004440_4233_4958 | 240 |
| 120 | 3300037418 | Ga0395900_0004107 | Ga0395900_0004107_9610_10335 | 240 |
| 121 | 3300037418 | Ga0395900_0021765 | Ga0395900_0021765_3524_4264 | 240 |
| 122 | 3300037466 | Ga0395898_0004358 | Ga0395898_0004358_5442_6167 | 240 |
| 123 | 3300037466 | Ga0395898_0041164 | Ga0395898_0041164_1535_2275 | 240 |
| 124 | 3300037471 | Ga0395905_0041450 | Ga0395905_0041450_1257_1997 | 240 |
| 125 | 3300038443 | Ga0395901_0042082 | Ga0395901_0042082_2367_3107 | 240 |
| 126 | 3300038443 | Ga0395901_0158991 | Ga0395901_0158991_1286_2011 | 240 |
| 127 | 3300049571 | Ga0501034_0130925 | Ga0501034_0130925_787_1515 | 240 |
| 128 | 3300049822 | Ga0501035_0061873 | Ga0501035_0061873_1036_1764 | 240 |
| 129 | 3300005327 | Ga0070658_10249696 | Ga0070658_102496962 | 241 |
| 130 | 3300005327 | Ga0070658_10268095 | Ga0070658_102680952 | 241 |
| 131 | 3300005329 | Ga0070683_100415993 | Ga0070683_1004159932 | 241 |
| 132 | 3300005337 | Ga0070682_100053283 | Ga0070682_1000532832 | 241 |
| 133 | 3300005353 | Ga0070669_100058236 | Ga0070669_1000582363 | 241 |
| 134 | 3300005354 | Ga0070675_100159657 | Ga0070675_1001596573 | 241 |
| 135 | 3300005356 | Ga0070674_100075792 | Ga0070674_1000757923 | 241 |
| 136 | 3300005458 | Ga0070681_10160534 | Ga0070681_101605343 | 241 |
| 137 | 3300005530 | Ga0070679_100013309 | Ga0070679_1000133098 | 241 |
| 138 | 3300005543 | Ga0070672_100051682 | Ga0070672_1000516823 | 241 |
| 139 | 3300005616 | Ga0068852_100023253 | Ga0068852_1000232535 | 241 |
| 140 | 3300013105 | Ga0157369_10291400 | Ga0157369_102914002 | 241 |
| 141 | 3300025912 | Ga0207707_10388798 | Ga0207707_103887982 | 241 |
| 142 | 3300025917 | Ga0207660_10134313 | Ga0207660_101343132 | 241 |
| 143 | 3300025921 | Ga0207652_10225128 | Ga0207652_102251282 | 241 |
| 144 | 3300025926 | Ga0207659_10157497 | Ga0207659_101574972 | 241 |
| 145 | 3300025926 | Ga0207659_10165892 | Ga0207659_101658921 | 241 |
| 146 | 3300025944 | Ga0207661_10469522 | Ga0207661_104695221 | 241 |
| 147 | 3300026041 | Ga0207639_10227514 | Ga0207639_102275141 | 241 |
| 148 | 3300026142 | Ga0207698_10018072 | Ga0207698_100180725 | 241 |
| 149 | 3300032004 | Ga0307414_10065072 | Ga0307414_100650723 | 241 |
| 150 | 3300044842 | Ga0466957_0000101 | Ga0466957_0000101_8980_9714 | 241 |
| 151 | 3300049514 | Ga0501291_010123 | Ga0501291_010123_160_888 | 241 |
| 152 | 3300049521 | Ga0501298_003133 | Ga0501298_003133_1649_2377 | 241 |
| 153 | 3300049649 | Ga0501198_001761 | Ga0501198_001761_1615_2343 | 241 |
| 154 | 3300049653 | Ga0501206_002014 | Ga0501206_002014_955_1683 | 241 |
| 155 | 3300049654 | Ga0501207_015348 | Ga0501207_015348_173_901 | 241 |
| 156 | 3300049661 | Ga0501217_000316 | Ga0501217_000316_5879_6607 | 241 |
| 157 | 3300049669 | Ga0501235_003960 | Ga0501235_003960_1317_2045 | 241 |
| 158 | 3300049673 | Ga0501240_006721 | Ga0501240_006721_517_1245 | 241 |
| 159 | 3300049674 | Ga0501242_001564 | Ga0501242_001564_430_1158 | 241 |
| 160 | 3300049675 | Ga0501243_002420 | Ga0501243_002420_605_1333 | 241 |
| 161 | 3300049675 | Ga0501243_021007 | Ga0501243_021007_52_780 | 241 |
| 162 | 3300049688 | Ga0501259_000322 | Ga0501259_000322_6685_7413 | 241 |
| 163 | 3300049690 | Ga0501261_001470 | Ga0501261_001470_1794_2522 | 241 |
| 164 | 3300049704 | Ga0501221_002630 | Ga0501221_002630_2074_2802 | 241 |
| 165 | 3300049705 | Ga0501225_0011537 | Ga0501225_0011537_235_963 | 241 |
| 166 | 3300003316 | rootH1_10073737 | rootH1_100737374 | 242 |
| 167 | 3300003322 | rootL2_10139189 | rootL2_101391891 | 242 |
| 168 | 3300003322 | rootL2_10276564 | rootL2_102765642 | 242 |
| 169 | 3300003322 | rootL2_10330272 | rootL2_103302722 | 242 |
| 170 | 3300003323 | rootH1_10169777 | rootH1_101697772 | 242 |
| 171 | 3300005290 | Ga0065712_10001358 | Ga0065712_100013584 | 242 |
| 172 | 3300005334 | Ga0068869_100014839 | Ga0068869_1000148392 | 242 |
| 173 | 3300005338 | Ga0068868_100218719 | Ga0068868_1002187191 | 242 |
| 174 | 3300005340 | Ga0070689_100203268 | Ga0070689_1002032682 | 242 |
| 175 | 3300005343 | Ga0070687_100029812 | Ga0070687_1000298125 | 242 |
| 176 | 3300005343 | Ga0070687_100103210 | Ga0070687_1001032102 | 242 |
| 177 | 3300005354 | Ga0070675_100063503 | Ga0070675_1000635034 | 242 |
| 178 | 3300005354 | Ga0070675_100474531 | Ga0070675_1004745312 | 242 |
| 179 | 3300005354 | Ga0070675_100633834 | Ga0070675_1006338341 | 242 |
| 180 | 3300005364 | Ga0070673_100106642 | Ga0070673_1001066423 | 242 |
| 181 | 3300005365 | Ga0070688_100010468 | Ga0070688_1000104681 | 242 |
| 182 | 3300005438 | Ga0070701_10054964 | Ga0070701_100549642 | 242 |
| 183 | 3300005459 | Ga0068867_100292396 | Ga0068867_1002923962 | 242 |
| 184 | 3300005471 | Ga0070698_100003102 | Ga0070698_1000031022 | 242 |
| 185 | 3300005543 | Ga0070672_100374098 | Ga0070672_1003740982 | 242 |
| 186 | 3300005563 | Ga0068855_100016847 | Ga0068855_1000168473 | 242 |
| 187 | 3300005577 | Ga0068857_100089457 | Ga0068857_1000894572 | 242 |
| 188 | 3300005614 | Ga0068856_100038406 | Ga0068856_1000384065 | 242 |
| 189 | 3300005616 | Ga0068852_100205644 | Ga0068852_1002056442 | 242 |
| 190 | 3300005617 | Ga0068859_100158825 | Ga0068859_1001588254 | 242 |
| 191 | 3300005618 | Ga0068864_100080761 | Ga0068864_1000807613 | 242 |
| 192 | 3300005718 | Ga0068866_10350601 | Ga0068866_103506012 | 242 |
| 193 | 3300005719 | Ga0068861_100015930 | Ga0068861_1000159305 | 242 |
| 194 | 3300005719 | Ga0068861_100027522 | Ga0068861_1000275223 | 242 |
| 195 | 3300005840 | Ga0068870_10117273 | Ga0068870_101172732 | 242 |
| 196 | 3300005841 | Ga0068863_100051050 | Ga0068863_1000510502 | 242 |
| 197 | 3300005844 | Ga0068862_100163410 | Ga0068862_1001634102 | 242 |
| 198 | 3300005844 | Ga0068862_100252954 | Ga0068862_1002529541 | 242 |
| 199 | 3300006195 | Ga0075366_10007167 | Ga0075366_100071678 | 242 |
| 200 | 3300006195 | Ga0075366_10037060 | Ga0075366_100370603 | 242 |
| 201 | 3300006237 | Ga0097621_100022066 | Ga0097621_1000220662 | 242 |
| 202 | 3300006844 | Ga0075428_100005956 | Ga0075428_10000595614 | 242 |
| 203 | 3300006844 | Ga0075428_100167306 | Ga0075428_1001673063 | 242 |
| 204 | 3300006847 | Ga0075431_100123505 | Ga0075431_1001235052 | 242 |
| 205 | 3300006880 | Ga0075429_100000437 | Ga0075429_10000043714 | 242 |
| 206 | 3300006881 | Ga0068865_100137612 | Ga0068865_1001376123 | 242 |
| 207 | 3300006931 | Ga0097620_100158820 | Ga0097620_1001588204 | 242 |
| 208 | 3300009093 | Ga0105240_10330379 | Ga0105240_103303792 | 242 |
| 209 | 3300009094 | Ga0111539_10070610 | Ga0111539_100706103 | 242 |
| 210 | 3300009094 | Ga0111539_10159344 | Ga0111539_101593444 | 242 |
| 211 | 3300009094 | Ga0111539_10167503 | Ga0111539_101675031 | 242 |
| 212 | 3300009094 | Ga0111539_10268465 | Ga0111539_102684653 | 242 |
| 213 | 3300009148 | Ga0105243_10290712 | Ga0105243_102907122 | 242 |
| 214 | 3300009174 | Ga0105241_10017462 | Ga0105241_100174623 | 242 |
| 215 | 3300009176 | Ga0105242_10000305 | Ga0105242_1000030519 | 242 |
| 216 | 3300009176 | Ga0105242_10286736 | Ga0105242_102867361 | 242 |
| 217 | 3300009545 | Ga0105237_10068285 | Ga0105237_100682852 | 242 |
| 218 | 3300009553 | Ga0105249_10001069 | Ga0105249_1000106913 | 242 |
| 219 | 3300009553 | Ga0105249_10124870 | Ga0105249_101248704 | 242 |
| 220 | 3300009553 | Ga0105249_10208567 | Ga0105249_102085673 | 242 |
| 221 | 3300009553 | Ga0105249_10400015 | Ga0105249_104000152 | 242 |
| 222 | 3300010375 | Ga0105239_10000940 | Ga0105239_1000094019 | 242 |
| 223 | 3300013297 | Ga0157378_10840037 | Ga0157378_108400371 | 242 |
| 224 | 3300013306 | Ga0163162_10050123 | Ga0163162_100501233 | 242 |
| 225 | 3300013306 | Ga0163162_10363495 | Ga0163162_103634952 | 242 |
| 226 | 3300013306 | Ga0163162_11034301 | Ga0163162_110343011 | 242 |
| 227 | 3300013307 | Ga0157372_10172876 | Ga0157372_101728762 | 242 |
| 228 | 3300013308 | Ga0157375_10102827 | Ga0157375_101028274 | 242 |
| 229 | 3300013308 | Ga0157375_10261592 | Ga0157375_102615923 | 242 |
| 230 | 3300013308 | Ga0157375_10604068 | Ga0157375_106040682 | 242 |
| 231 | 3300014325 | Ga0163163_10379138 | Ga0163163_103791381 | 242 |
| 232 | 3300014326 | Ga0157380_10123430 | Ga0157380_101234304 | 242 |
| 233 | 3300014326 | Ga0157380_10193157 | Ga0157380_101931572 | 242 |
| 234 | 3300014326 | Ga0157380_10678963 | Ga0157380_106789631 | 242 |
| 235 | 3300014326 | Ga0157380_10802214 | Ga0157380_108022142 | 242 |
| 236 | 3300014745 | Ga0157377_10010450 | Ga0157377_100104506 | 242 |
| 237 | 3300014745 | Ga0157377_10011234 | Ga0157377_100112345 | 242 |
| 238 | 3300014969 | Ga0157376_11002321 | Ga0157376_110023211 | 242 |
| 239 | 3300025901 | Ga0207688_10012368 | Ga0207688_100123685 | 242 |
| 240 | 3300025908 | Ga0207643_10097092 | Ga0207643_100970922 | 242 |
| 241 | 3300025909 | Ga0207705_10092912 | Ga0207705_100929122 | 242 |
| 242 | 3300025911 | Ga0207654_10048288 | Ga0207654_100482883 | 242 |
| 243 | 3300025918 | Ga0207662_10023685 | Ga0207662_100236853 | 242 |
| 244 | 3300025918 | Ga0207662_10038195 | Ga0207662_100381954 | 242 |
| 245 | 3300025923 | Ga0207681_10030214 | Ga0207681_100302142 | 242 |
| 246 | 3300025931 | Ga0207644_10319968 | Ga0207644_103199681 | 242 |
| 247 | 3300025934 | Ga0207686_10000237 | Ga0207686_1000023721 | 242 |
| 248 | 3300025934 | Ga0207686_10227689 | Ga0207686_102276892 | 242 |
| 249 | 3300025936 | Ga0207670_10150095 | Ga0207670_101500953 | 242 |
| 250 | 3300025938 | Ga0207704_10213308 | Ga0207704_102133082 | 242 |
| 251 | 3300025940 | Ga0207691_10021812 | Ga0207691_100218124 | 242 |
| 252 | 3300025940 | Ga0207691_10139317 | Ga0207691_101393173 | 242 |
| 253 | 3300025949 | Ga0207667_10012866 | Ga0207667_100128665 | 242 |
| 254 | 3300025960 | Ga0207651_10085545 | Ga0207651_100855452 | 242 |
| 255 | 3300025961 | Ga0207712_10000999 | Ga0207712_1000099912 | 242 |
| 256 | 3300025961 | Ga0207712_10343275 | Ga0207712_103432751 | 242 |
| 257 | 3300025972 | Ga0207668_10344985 | Ga0207668_103449852 | 242 |
| 258 | 3300025981 | Ga0207640_10076949 | Ga0207640_100769493 | 242 |
| 259 | 3300025986 | Ga0207658_10147167 | Ga0207658_101471672 | 242 |
| 260 | 3300026041 | Ga0207639_10775544 | Ga0207639_107755442 | 242 |
| 261 | 3300026075 | Ga0207708_10087463 | Ga0207708_100874632 | 242 |
| 262 | 3300026075 | Ga0207708_10347004 | Ga0207708_103470041 | 242 |
| 263 | 3300026078 | Ga0207702_10131923 | Ga0207702_101319232 | 242 |
| 264 | 3300026088 | Ga0207641_10001972 | Ga0207641_100019725 | 242 |
| 265 | 3300026089 | Ga0207648_10085034 | Ga0207648_100850343 | 242 |
| 266 | 3300026089 | Ga0207648_10179868 | Ga0207648_101798682 | 242 |
| 267 | 3300026095 | Ga0207676_10179311 | Ga0207676_101793112 | 242 |
| 268 | 3300026116 | Ga0207674_10041225 | Ga0207674_100412251 | 242 |
| 269 | 3300026116 | Ga0207674_10193106 | Ga0207674_101931062 | 242 |
| 270 | 3300026116 | Ga0207674_10491777 | Ga0207674_104917771 | 242 |
| 271 | 3300026118 | Ga0207675_100024216 | Ga0207675_1000242164 | 242 |
| 272 | 3300026118 | Ga0207675_100066966 | Ga0207675_1000669663 | 242 |
| 273 | 3300026142 | Ga0207698_10248969 | Ga0207698_102489692 | 242 |
| 274 | 3300028380 | Ga0268265_10077472 | Ga0268265_100774723 | 242 |
| 275 | 3300041404 | Ga0439436_0002047 | Ga0439436_0002047_4043_4774 | 242 |
| 276 | 3300041406 | Ga0439439_0051005 | Ga0439439_0051005_49_780 | 242 |
| 277 | 3300042001 | Ga0439441_022322 | Ga0439441_022322_328_1074 | 242 |
| 278 | 3300042007 | Ga0439449_0017369 | Ga0439449_0017369_490_1281 | 242 |
| 279 | 3300042007 | Ga0439449_0047367 | Ga0439449_0047367_634_1365 | 242 |
| 280 | 3300042014 | Ga0439457_000097 | Ga0439457_000097_15765_16496 | 242 |
| 281 | 3300042014 | Ga0439457_043409 | Ga0439457_043409_115_906 | 242 |
| 282 | 3300042015 | Ga0439462_0000205 | Ga0439462_0000205_9257_9988 | 242 |
| 283 | 3300042156 | Ga0439446_0023650 | Ga0439446_0023650_867_1598 | 242 |
| 284 | 3300044656 | Ga0466969_0000362 | Ga0466969_0000362_6704_7435 | 242 |
| 285 | 3300044683 | Ga0466965_0069942 | Ga0466965_0069942_271_1026 | 242 |
| 286 | 3300044719 | Ga0466971_0059862 | Ga0466971_0059862_140_895 | 242 |
| 287 | 3300044735 | Ga0466968_0203871 | Ga0466968_0203871_75_803 | 242 |
| 288 | 3300046539 | Ga0495621_0005550 | Ga0495621_0005550_1337_2071 | 242 |
| 289 | 3300046809 | Ga0495600_0230589 | Ga0495600_0230589_139_873 | 242 |
| 290 | 3300050493 | nmdc:mga0k408_11591_c1 | nmdc:mga0k408_11591_c1_469_1200 | 242 |
| 291 | 3300050508 | nmdc:mga09592_2061_c1 | nmdc:mga09592_2061_c1_12515_13246 | 242 |
| 292 | 3300050511 | nmdc:mga08y16_129123_c1 | nmdc:mga08y16_129123_c1_1280_2014 | 242 |
| 293 | 3300050511 | nmdc:mga08y16_227897_c1 | nmdc:mga08y16_227897_c1_550_1293 | 242 |
| 294 | 3300050511 | nmdc:mga08y16_257324_c1 | nmdc:mga08y16_257324_c1_913_1764 | 242 |
| 295 | 3300053098 | Ga0500650_0139793 | Ga0500650_0139793_156_887 | 242 |
| 296 | 3300053134 | Ga0500658_0033778 | Ga0500658_0033778_587_1318 | 242 |
| 297 | 3300053147 | Ga0500589_060566 | Ga0500589_060566_378_1109 | 242 |
| 298 | 3300053151 | Ga0500604_0042107 | Ga0500604_0042107_444_1214 | 242 |
| 299 | 3300053153 | Ga0500616_0011519 | Ga0500616_0011519_555_1295 | 242 |
| 300 | 3300053156 | Ga0500622_0161355 | Ga0500622_0161355_277_1008 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpq-assembly1.cif.gz_A | crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution | 0.9087 | 5 | 241 |
| 1vpq-assembly1.cif.gz_A | crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution | 0.8873 | 5 | 241 |
| 1ztv-assembly1.cif.gz_B | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution | 0.8488 | 5 | 241 |
| 1ztv-assembly1.cif.gz_B | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution | 0.8291 | 5 | 241 |
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.8254 | 4 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vpqA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.9087 | 5 | 241 | 3.20.20.410 |
| 1vpqA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8873 | 5 | 241 | 3.20.20.410 |
| af_Q4E4B4_140_369_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8704 | 70 | 241 | 3.20.20.410 |
| af_Q2FZX7_1_282_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8556 | 5 | 241 | 3.20.20.410 |
| 1ztvA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8396 | 1 | 241 | 3.20.20.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y7U3X3-F1-model_v4 | DUF72 domain-containing protein | 0.9971 | 49 | 167 |
|
| AF-A0A4Q5YM53-F1-model_v4 | deleted | 0.9956 | 3 | 242 |
|
| AF-A0A1G6ZD48-F1-model_v4 | Uncharacterized conserved protein YecE, DUF72 family | 0.9933 | 5 | 240 |
|
| AF-A0A841JCV5-F1-model_v4 | Uncharacterized protein YecE (DUF72 family) | 0.993 | 5 | 242 |
|
| AF-A0A6N4SUT3-F1-model_v4 | DUF72 domain-containing protein | 0.9927 | 5 | 241 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar