F395241

General Info

Members Datasets Scaffolds Average Seq Length
300 168 600 189

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100372346|Ga0070708_1003723462
Length 200
Sequence MNPRSINRCISEGLRLLVVLGAICVPALHGQEPRAPQMPAPPPLKVIPKDERAQLTDAKDAKARLRKTVELAEIHLQHAEALTSQEKYEEVLIELGGYLALIDDALKFLGQMNRDSTKTRDLYKHLEIDLRGDGPRLTSMRRITPLEYAIRIKEIEDFARDSRTEALDSFYGHTVVREGKKKAADEKPKNPPNKPESKQP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
137 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
149 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
150 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
151 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
154 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100372346 3300005445 Bacteria 1346
2 SwRhRL2b_contig_2561436 2162886007 Bacteria 1255
3 MBSR1b_contig_6742468 2162886012 Unclassified 846
4 JGI24751J29686_10000050 3300002459 Bacteria 68540
5 Ga0065714_10002297 3300005288 Bacteria 27065
6 Ga0065704_10012728 3300005289 Bacteria 1710
7 Ga0065712_10067792 3300005290 Bacteria 34297
8 Ga0065715_10003325 3300005293 Bacteria 4575
9 Ga0065715_10091712 3300005293 Bacteria 5593
10 Ga0065707_10087513 3300005295 Bacteria 4996
11 Ga0065707_10096203 3300005295 Bacteria 3293
12 Ga0065707_10473009 3300005295 Bacteria 780
13 Ga0070670_100000439 3300005331 Bacteria 33957
14 Ga0070670_100281656 3300005331 Unclassified 1451
15 Ga0070670_100321267 3300005331 Bacteria 1356
16 Ga0068869_100111389 3300005334 Bacteria 2083
17 Ga0068869_100315843 3300005334 Unclassified 1266
18 Ga0070680_100035014 3300005336 Bacteria 4052
19 Ga0070680_100260932 3300005336 Bacteria 1466
20 Ga0070682_100976423 3300005337 Unclassified 701
21 Ga0070689_100003193 3300005340 Bacteria 10850
22 Ga0070687_100004529 3300005343 Bacteria 5551
23 Ga0070687_100396838 3300005343 Unclassified 903
24 Ga0070692_10004936 3300005345 Bacteria 5626
25 Ga0070692_10052782 3300005345 Bacteria 2118
26 Ga0070669_100020030 3300005353 Bacteria 4777
27 Ga0070669_100244412 3300005353 Bacteria 1427
28 Ga0070673_100138433 3300005364 Unclassified 2051
29 Ga0070659_100013176 3300005366 Bacteria 6150
30 Ga0070703_10000940 3300005406 Bacteria 9284
31 Ga0070701_10042087 3300005438 Unclassified 2330
32 Ga0070701_10205187 3300005438 Unclassified 1167
33 Ga0070705_100364026 3300005440 Bacteria 1059
34 Ga0070700_100040580 3300005441 Bacteria 2850
35 Ga0070700_100164377 3300005441 Unclassified 1531
36 Ga0070700_100168573 3300005441 Bacteria 1515
37 Ga0070694_100006283 3300005444 Bacteria 7210
38 Ga0070694_100135528 3300005444 Bacteria 1784
39 Ga0070708_100000149 3300005445 Bacteria 48348
40 Ga0070708_100269316 3300005445 Unclassified 1602
41 Ga0070681_10041906 3300005458 Bacteria 4589
42 Ga0068867_100123154 3300005459 Bacteria 2006
43 Ga0068867_100363178 3300005459 Bacteria 1212
44 Ga0070706_100020620 3300005467 Bacteria 6074
45 Ga0070706_100687517 3300005467 Bacteria 949
46 Ga0070707_100000134 3300005468 Bacteria 69611
47 Ga0070707_100023833 3300005468 Bacteria 5790
48 Ga0070707_100131797 3300005468 Unclassified 2431
49 Ga0070707_100777553 3300005468 Unclassified 921
50 Ga0070698_100001512 3300005471 Bacteria 25768
51 Ga0070698_100044260 3300005471 Bacteria 4559
52 Ga0070698_100288237 3300005471 Bacteria 1573
53 Ga0070699_100000287 3300005518 Bacteria 48358
54 Ga0070699_100008905 3300005518 Bacteria 8694
55 Ga0070699_100072295 3300005518 Bacteria 3000
56 Ga0070699_100396244 3300005518 Unclassified 1248
57 Ga0070699_101061771 3300005518 Unclassified 743
58 Ga0070697_100008643 3300005536 Bacteria 7953
59 Ga0068853_100464109 3300005539 Bacteria 1192
60 Ga0070672_100429056 3300005543 Bacteria 1136
61 Ga0070695_100205914 3300005545 Unclassified 1409
62 Ga0070695_100347161 3300005545 Unclassified 1111
63 Ga0070695_100391035 3300005545 Unclassified 1052
64 Ga0070693_100013220 3300005547 Bacteria 4201
65 Ga0070704_100002365 3300005549 Bacteria 10581
66 Ga0070704_100499909 3300005549 Unclassified 1055
67 Ga0068855_100418141 3300005563 Bacteria 1467
68 Ga0070664_100009418 3300005564 Bacteria 7917
69 Ga0068857_100000167 3300005577 Bacteria 41275
70 Ga0068857_100585201 3300005577 Bacteria 1054
71 Ga0068854_100676126 3300005578 Unclassified 889
72 Ga0070702_100042211 3300005615 Bacteria 2563
73 Ga0068859_100051590 3300005617 Bacteria 4135
74 Ga0068859_100065538 3300005617 Bacteria 3666
75 Ga0068859_100226270 3300005617 Unclassified 1959
76 Ga0068859_100399290 3300005617 Bacteria 1471
77 Ga0068859_100495790 3300005617 Bacteria 1316
78 Ga0068859_101141601 3300005617 Unclassified 858
79 Ga0068864_100083735 3300005618 Bacteria 2801
80 Ga0068864_100125746 3300005618 Bacteria 2297
81 Ga0068866_10272362 3300005718 Unclassified 1045
82 Ga0068866_10395237 3300005718 Bacteria 890
83 Ga0068861_100013577 3300005719 Bacteria 5701
84 Ga0068861_100102931 3300005719 Bacteria 2274
85 Ga0068861_100171150 3300005719 Unclassified 1800
86 Ga0068870_10168047 3300005840 Bacteria 1306
87 Ga0068870_10366813 3300005840 Unclassified 928
88 Ga0068863_100080952 3300005841 Bacteria 3076
89 Ga0068863_100604533 3300005841 Bacteria 1085
90 Ga0068858_100132501 3300005842 Bacteria 2338
91 Ga0068858_100204162 3300005842 Bacteria 1870
92 Ga0068858_100331933 3300005842 Bacteria 1454
93 Ga0068858_100697563 3300005842 Unclassified 988
94 Ga0068860_100062209 3300005843 Unclassified 3546
95 Ga0068860_100170609 3300005843 Bacteria 2101
96 Ga0068860_100439176 3300005843 Unclassified 1296
97 Ga0068860_100580141 3300005843 Unclassified 1125
98 Ga0068862_100001166 3300005844 Bacteria 24791
99 Ga0068862_100007039 3300005844 Bacteria 9339
100 Ga0068862_100056097 3300005844 Bacteria 3374
101 Ga0068862_100234599 3300005844 Bacteria 1665
102 Ga0081539_10101901 3300005985 Bacteria 1461
103 Ga0075428_100251595 3300006844 Bacteria 1904
104 Ga0075430_100492570 3300006846 Bacteria 1011
105 Ga0075431_101084982 3300006847 Unclassified 765
106 Ga0075433_10018987 3300006852 Bacteria 5721
107 Ga0075433_10596040 3300006852 Bacteria 970
108 Ga0075434_100186046 3300006871 Bacteria 2097
109 Ga0075434_100377830 3300006871 Bacteria 1438
110 Ga0097620_100051590 3300006931 Bacteria 4135
111 Ga0097620_100065540 3300006931 Bacteria 3666
112 Ga0097620_100226277 3300006931 Unclassified 1959
113 Ga0097620_100399301 3300006931 Bacteria 1471
114 Ga0097620_100495791 3300006931 Bacteria 1316
115 Ga0097620_101141602 3300006931 Unclassified 858
116 Ga0105240_10398019 3300009093 Bacteria 1552
117 Ga0111539_10008932 3300009094 Bacteria 12687
118 Ga0111539_10187725 3300009094 Unclassified 2413
119 Ga0111539_11128401 3300009094 Bacteria 911
120 Ga0105245_10861116 3300009098 Unclassified 947
121 Ga0105247_10020607 3300009101 Unclassified 3964
122 Ga0114129_10197459 3300009147 Bacteria 2727
123 Ga0114129_11273212 3300009147 Unclassified 913
124 Ga0105243_10000932 3300009148 Bacteria 27435
125 Ga0105243_10103145 3300009148 Unclassified 2371
126 Ga0105243_10594246 3300009148 Bacteria 1065
127 Ga0105241_10099334 3300009174 Unclassified 2311
128 Ga0105241_10406292 3300009174 Bacteria 1196
129 Ga0105242_10000226 3300009176 Bacteria 44435
130 Ga0105248_10026679 3300009177 Bacteria 6423
131 Ga0105248_10030459 3300009177 Bacteria 6024
132 Ga0105248_10038045 3300009177 Bacteria 5383
133 Ga0105248_10069727 3300009177 Bacteria 3948
134 Ga0105248_10331027 3300009177 Unclassified 1715
135 Ga0105248_10420302 3300009177 Archaea 1505
136 Ga0105237_10260808 3300009545 Bacteria 1736
137 Ga0105238_10035816 3300009551 Bacteria 5045
138 Ga0105249_10003336 3300009553 Bacteria 13900
139 Ga0105249_10114733 3300009553 Unclassified 2551
140 Ga0105249_10172405 3300009553 Bacteria 2099
141 Ga0105239_10075708 3300010375 Unclassified 3701
142 Ga0105246_10018869 3300011119 Unclassified 4398
143 Ga0105246_10537609 3300011119 Unclassified 999
144 Ga0157373_10001056 3300013100 Bacteria 21207
145 Ga0157373_10042508 3300013100 Unclassified 3248
146 Ga0157373_10047973 3300013100 Unclassified 3045
147 Ga0157378_10204107 3300013297 Unclassified 1871
148 Ga0157378_10367186 3300013297 Bacteria 1410
149 Ga0163162_10125429 3300013306 Unclassified 2673
150 Ga0157372_10119054 3300013307 Bacteria 3031
151 Ga0157372_10792065 3300013307 Bacteria 1101
152 Ga0157375_10022608 3300013308 Bacteria 5788
153 Ga0163163_10004642 3300014325 Bacteria 11741
154 Ga0163163_10108017 3300014325 Unclassified 2809
155 Ga0157380_10004518 3300014326 Bacteria 9652
156 Ga0157380_10197487 3300014326 Bacteria 1782
157 Ga0182008_10167367 3300014497 Bacteria 1109
158 Ga0157377_10411138 3300014745 Unclassified 924
159 Ga0157379_10271560 3300014968 Bacteria 1542
160 Ga0163161_10347306 3300017792 Bacteria 1178
161 Ga0207642_10274866 3300025899 Unclassified 966
162 Ga0207710_10000753 3300025900 Bacteria 17806
163 Ga0207647_10123891 3300025904 Unclassified 1522
164 Ga0207645_10283345 3300025907 Unclassified 1101
165 Ga0207643_10001354 3300025908 Bacteria 14155
166 Ga0207643_10309770 3300025908 Unclassified 984
167 Ga0207643_10319118 3300025908 Unclassified 970
168 Ga0207643_10336509 3300025908 Unclassified 945
169 Ga0207684_10006170 3300025910 Bacteria 10959
170 Ga0207654_10430207 3300025911 Bacteria 922
171 Ga0207654_10467808 3300025911 Unclassified 886
172 Ga0207707_10006929 3300025912 Bacteria 9885
173 Ga0207707_10050281 3300025912 Unclassified 3631
174 Ga0207695_10330462 3300025913 Bacteria 1413
175 Ga0207660_10298446 3300025917 Unclassified 1282
176 Ga0207660_10384047 3300025917 Bacteria 1129
177 Ga0207662_10108652 3300025918 Bacteria 1727
178 Ga0207662_10216385 3300025918 Unclassified 1246
179 Ga0207662_10426466 3300025918 Unclassified 903
180 Ga0207652_10965850 3300025921 Unclassified 750
181 Ga0207646_10015465 3300025922 Bacteria 7207
182 Ga0207646_10015568 3300025922 Bacteria 7178
183 Ga0207646_10170797 3300025922 Unclassified 1963
184 Ga0207646_10254568 3300025922 Bacteria 1587
185 Ga0207694_10008621 3300025924 Bacteria 7699
186 Ga0207650_10000022 3300025925 Bacteria 318878
187 Ga0207650_10368396 3300025925 Bacteria 1185
188 Ga0207650_10398513 3300025925 Unclassified 1139
189 Ga0207650_10764048 3300025925 Bacteria 818
190 Ga0207659_10034504 3300025926 Unclassified 3489
191 Ga0207690_10216375 3300025932 Unclassified 1463
192 Ga0207706_10033638 3300025933 Bacteria 4561
193 Ga0207706_10214773 3300025933 Bacteria 1685
194 Ga0207706_10538918 3300025933 Bacteria 1005
195 Ga0207686_10000055 3300025934 Bacteria 107128
196 Ga0207686_10229793 3300025934 Bacteria 1344
197 Ga0207709_10000135 3300025935 Bacteria 107498
198 Ga0207709_10153446 3300025935 Bacteria 1598
199 Ga0207670_10045975 3300025936 Bacteria 2897
200 Ga0207670_10575900 3300025936 Unclassified 922
201 Ga0207691_10322900 3300025940 Unclassified 1323
202 Ga0207691_10647414 3300025940 Unclassified 893
203 Ga0207711_10282546 3300025941 Bacteria 1529
204 Ga0207711_10435731 3300025941 Bacteria 1220
205 Ga0207711_10568936 3300025941 Unclassified 1057
206 Ga0207689_10100642 3300025942 Bacteria 2374
207 Ga0207689_10152361 3300025942 Bacteria 1906
208 Ga0207689_10438757 3300025942 Unclassified 1091
209 Ga0207661_10321508 3300025944 Bacteria 1391
210 Ga0207679_10007430 3300025945 Bacteria 6950
211 Ga0207667_10264514 3300025949 Bacteria 1759
212 Ga0207651_10098302 3300025960 Unclassified 2164
213 Ga0207651_10372276 3300025960 Unclassified 1209
214 Ga0207712_10054810 3300025961 Unclassified 2802
215 Ga0207640_10168674 3300025981 Unclassified 1628
216 Ga0207640_10194733 3300025981 Bacteria 1531
217 Ga0207640_10294378 3300025981 Bacteria 1281
218 Ga0207703_10030432 3300026035 Bacteria 4267
219 Ga0207703_10100174 3300026035 Unclassified 2454
220 Ga0207703_10130180 3300026035 Unclassified 2172
221 Ga0207703_10239570 3300026035 Bacteria 1630
222 Ga0207639_10008660 3300026041 Bacteria 6983
223 Ga0207639_10434494 3300026041 Bacteria 1189
224 Ga0207708_10000340 3300026075 Bacteria 36852
225 Ga0207708_10058875 3300026075 Bacteria 2932
226 Ga0207708_10163748 3300026075 Bacteria 1757
227 Ga0207708_10187943 3300026075 Bacteria 1643
228 Ga0207708_10245809 3300026075 Bacteria 1440
229 Ga0207641_10015454 3300026088 Bacteria 6254
230 Ga0207641_10083212 3300026088 Bacteria 2783
231 Ga0207641_10214201 3300026088 Bacteria 1783
232 Ga0207648_10158702 3300026089 Bacteria 1997
233 Ga0207648_10698650 3300026089 Unclassified 940
234 Ga0207676_10009163 3300026095 Bacteria 7046
235 Ga0207676_10137467 3300026095 Bacteria 2087
236 Ga0207676_10573964 3300026095 Bacteria 1080
237 Ga0207676_10600398 3300026095 Unclassified 1057
238 Ga0207674_10510676 3300026116 Unclassified 1161
239 Ga0207675_100023346 3300026118 Bacteria 5752
240 Ga0207675_100047237 3300026118 Bacteria 4020
241 Ga0207675_100048375 3300026118 Bacteria 3969
242 Ga0207683_10512308 3300026121 Bacteria 1108
243 Ga0207428_10021437 3300027907 Bacteria 5471
244 Ga0268265_10049956 3300028380 Bacteria 3149
245 Ga0268265_10948333 3300028380 Unclassified 847
246 Ga0268265_11499689 3300028380 Unclassified 678
247 Ga0268264_10256307 3300028381 Archaea 1627
248 Ga0268264_10398523 3300028381 Bacteria 1322
249 Ga0268264_10846083 3300028381 Unclassified 916
250 Ga0307405_10029827 3300031731 Bacteria 3191
251 Ga0307410_10168216 3300031852 Unclassified 1649
252 Ga0307406_10119006 3300031901 Unclassified 1833
253 Ga0307406_10436533 3300031901 Unclassified 1047
254 Ga0307407_10227228 3300031903 Unclassified 1265
255 Ga0307412_10124562 3300031911 Bacteria 1861
256 Ga0307409_100227617 3300031995 Unclassified 1688
257 Ga0307414_10060422 3300032004 Unclassified 2680
258 Ga0307414_10243207 3300032004 Bacteria 1491
259 Ga0307411_10016679 3300032005 Unclassified 4162
260 Ga0307415_100119379 3300032126 Bacteria 1974
261 Ga0307415_100122399 3300032126 Bacteria 1953
262 Ga0373940_0034112 3300035088 Unclassified 1371
263 Ga0395901_0410306 3300038443 Unclassified 1391
264 Ga0242422_00943 3300038699 Bacteria 1972
265 Ga0242420_004520 3300038996 Bacteria 2108
266 Ga0495659_0187472 3300046664 Unclassified 844
267 Ga0496102_0019245 3300048905 Bacteria 6014
268 Ga0496104_0064308 3300048907 Unclassified 3480
269 Ga0496106_0334294 3300048909 Unclassified 1216
270 Ga0496108_0111114 3300048911 Bacteria 2344
271 Ga0496112_0190364 3300048915 Bacteria 2014
272 Ga0496113_0166622 3300048916 Bacteria 1744
273 Ga0501292_014388 3300049515 Bacteria 1226
274 Ga0501296_005259 3300049519 Unclassified 1438
275 Ga0501298_015204 3300049521 Bacteria 1384
276 Ga0501299_004949 3300049522 Bacteria 2022
277 Ga0501303_009766 3300049526 Unclassified 890
278 Ga0501206_026890 3300049653 Unclassified 842
279 Ga0501217_020819 3300049661 Bacteria 1544
280 Ga0501223_031875 3300049663 Unclassified 1026
281 Ga0501227_037387 3300049665 Unclassified 1188
282 Ga0501228_005071 3300049666 Unclassified 1154
283 Ga0501235_013635 3300049669 Unclassified 1790
284 Ga0501240_007855 3300049673 Bacteria 1352
285 Ga0501257_021013 3300049686 Unclassified 1537
286 Ga0501245_023675 3300049708 Unclassified 977
287 Ga0501272_006180 3300049769 Unclassified 1277
288 Ga0501212_001162 3300049851 Unclassified 2903
289 nmdc:mga05p37_1103469_c1 3300050507 Bacteria 830
290 nmdc:mga05p37_97325_c1 3300050507 Unclassified 3625
291 nmdc:mga09592_33066_c1 3300050508 Unclassified 3602
292 nmdc:mga0qj67_67708_c1 3300050509 Bacteria 2845
293 nmdc:mga08y16_544108_c1 3300050511 Unclassified 1176
294 nmdc:mga08y16_69121_c1 3300050511 Bacteria 3683
295 nmdc:mga0n895_297415_c1 3300050512 Unclassified 1636
296 nmdc:mga0rr50_510_c1 3300050513 Bacteria 20724
297 nmdc:mga08x19_5_c1 3300050514 Bacteria 464292
298 nmdc:mga0a205_24974_c1 3300050515 Bacteria 5689
299 nmdc:mga0a205_264053_c1 3300050515 Bacteria 1599
300 nmdc:mga0a205_356887_c1 3300050515 Bacteria 1329
301 Ga0070708_100372346
302 SwRhRL2b_contig_2561436
303 MBSR1b_contig_6742468
304 JGI24751J29686_10000050
305 Ga0065714_10002297
306 Ga0065704_10012728
307 Ga0065712_10067792
308 Ga0065715_10003325
309 Ga0065715_10091712
310 Ga0065707_10087513
311 Ga0065707_10096203
312 Ga0065707_10473009
313 Ga0070670_100000439
314 Ga0070670_100281656
315 Ga0070670_100321267
316 Ga0068869_100111389
317 Ga0068869_100315843
318 Ga0070680_100035014
319 Ga0070680_100260932
320 Ga0070682_100976423
321 Ga0070689_100003193
322 Ga0070687_100004529
323 Ga0070687_100396838
324 Ga0070692_10004936
325 Ga0070692_10052782
326 Ga0070669_100020030
327 Ga0070669_100244412
328 Ga0070673_100138433
329 Ga0070659_100013176
330 Ga0070703_10000940
331 Ga0070701_10042087
332 Ga0070701_10205187
333 Ga0070705_100364026
334 Ga0070700_100040580
335 Ga0070700_100164377
336 Ga0070700_100168573
337 Ga0070694_100006283
338 Ga0070694_100135528
339 Ga0070708_100000149
340 Ga0070708_100269316
341 Ga0070681_10041906
342 Ga0068867_100123154
343 Ga0068867_100363178
344 Ga0070706_100020620
345 Ga0070706_100687517
346 Ga0070707_100000134
347 Ga0070707_100023833
348 Ga0070707_100131797
349 Ga0070707_100777553
350 Ga0070698_100001512
351 Ga0070698_100044260
352 Ga0070698_100288237
353 Ga0070699_100000287
354 Ga0070699_100008905
355 Ga0070699_100072295
356 Ga0070699_100396244
357 Ga0070699_101061771
358 Ga0070697_100008643
359 Ga0068853_100464109
360 Ga0070672_100429056
361 Ga0070695_100205914
362 Ga0070695_100347161
363 Ga0070695_100391035
364 Ga0070693_100013220
365 Ga0070704_100002365
366 Ga0070704_100499909
367 Ga0068855_100418141
368 Ga0070664_100009418
369 Ga0068857_100000167
370 Ga0068857_100585201
371 Ga0068854_100676126
372 Ga0070702_100042211
373 Ga0068859_100051590
374 Ga0068859_100065538
375 Ga0068859_100226270
376 Ga0068859_100399290
377 Ga0068859_100495790
378 Ga0068859_101141601
379 Ga0068864_100083735
380 Ga0068864_100125746
381 Ga0068866_10272362
382 Ga0068866_10395237
383 Ga0068861_100013577
384 Ga0068861_100102931
385 Ga0068861_100171150
386 Ga0068870_10168047
387 Ga0068870_10366813
388 Ga0068863_100080952
389 Ga0068863_100604533
390 Ga0068858_100132501
391 Ga0068858_100204162
392 Ga0068858_100331933
393 Ga0068858_100697563
394 Ga0068860_100062209
395 Ga0068860_100170609
396 Ga0068860_100439176
397 Ga0068860_100580141
398 Ga0068862_100001166
399 Ga0068862_100007039
400 Ga0068862_100056097
401 Ga0068862_100234599
402 Ga0081539_10101901
403 Ga0075428_100251595
404 Ga0075430_100492570
405 Ga0075431_101084982
406 Ga0075433_10018987
407 Ga0075433_10596040
408 Ga0075434_100186046
409 Ga0075434_100377830
410 Ga0097620_100051590
411 Ga0097620_100065540
412 Ga0097620_100226277
413 Ga0097620_100399301
414 Ga0097620_100495791
415 Ga0097620_101141602
416 Ga0105240_10398019
417 Ga0111539_10008932
418 Ga0111539_10187725
419 Ga0111539_11128401
420 Ga0105245_10861116
421 Ga0105247_10020607
422 Ga0114129_10197459
423 Ga0114129_11273212
424 Ga0105243_10000932
425 Ga0105243_10103145
426 Ga0105243_10594246
427 Ga0105241_10099334
428 Ga0105241_10406292
429 Ga0105242_10000226
430 Ga0105248_10026679
431 Ga0105248_10030459
432 Ga0105248_10038045
433 Ga0105248_10069727
434 Ga0105248_10331027
435 Ga0105248_10420302
436 Ga0105237_10260808
437 Ga0105238_10035816
438 Ga0105249_10003336
439 Ga0105249_10114733
440 Ga0105249_10172405
441 Ga0105239_10075708
442 Ga0105246_10018869
443 Ga0105246_10537609
444 Ga0157373_10001056
445 Ga0157373_10042508
446 Ga0157373_10047973
447 Ga0157378_10204107
448 Ga0157378_10367186
449 Ga0163162_10125429
450 Ga0157372_10119054
451 Ga0157372_10792065
452 Ga0157375_10022608
453 Ga0163163_10004642
454 Ga0163163_10108017
455 Ga0157380_10004518
456 Ga0157380_10197487
457 Ga0182008_10167367
458 Ga0157377_10411138
459 Ga0157379_10271560
460 Ga0163161_10347306
461 Ga0207642_10274866
462 Ga0207710_10000753
463 Ga0207647_10123891
464 Ga0207645_10283345
465 Ga0207643_10001354
466 Ga0207643_10309770
467 Ga0207643_10319118
468 Ga0207643_10336509
469 Ga0207684_10006170
470 Ga0207654_10430207
471 Ga0207654_10467808
472 Ga0207707_10006929
473 Ga0207707_10050281
474 Ga0207695_10330462
475 Ga0207660_10298446
476 Ga0207660_10384047
477 Ga0207662_10108652
478 Ga0207662_10216385
479 Ga0207662_10426466
480 Ga0207652_10965850
481 Ga0207646_10015465
482 Ga0207646_10015568
483 Ga0207646_10170797
484 Ga0207646_10254568
485 Ga0207694_10008621
486 Ga0207650_10000022
487 Ga0207650_10368396
488 Ga0207650_10398513
489 Ga0207650_10764048
490 Ga0207659_10034504
491 Ga0207690_10216375
492 Ga0207706_10033638
493 Ga0207706_10214773
494 Ga0207706_10538918
495 Ga0207686_10000055
496 Ga0207686_10229793
497 Ga0207709_10000135
498 Ga0207709_10153446
499 Ga0207670_10045975
500 Ga0207670_10575900
501 Ga0207691_10322900
502 Ga0207691_10647414
503 Ga0207711_10282546
504 Ga0207711_10435731
505 Ga0207711_10568936
506 Ga0207689_10100642
507 Ga0207689_10152361
508 Ga0207689_10438757
509 Ga0207661_10321508
510 Ga0207679_10007430
511 Ga0207667_10264514
512 Ga0207651_10098302
513 Ga0207651_10372276
514 Ga0207712_10054810
515 Ga0207640_10168674
516 Ga0207640_10194733
517 Ga0207640_10294378
518 Ga0207703_10030432
519 Ga0207703_10100174
520 Ga0207703_10130180
521 Ga0207703_10239570
522 Ga0207639_10008660
523 Ga0207639_10434494
524 Ga0207708_10000340
525 Ga0207708_10058875
526 Ga0207708_10163748
527 Ga0207708_10187943
528 Ga0207708_10245809
529 Ga0207641_10015454
530 Ga0207641_10083212
531 Ga0207641_10214201
532 Ga0207648_10158702
533 Ga0207648_10698650
534 Ga0207676_10009163
535 Ga0207676_10137467
536 Ga0207676_10573964
537 Ga0207676_10600398
538 Ga0207674_10510676
539 Ga0207675_100023346
540 Ga0207675_100047237
541 Ga0207675_100048375
542 Ga0207683_10512308
543 Ga0207428_10021437
544 Ga0268265_10049956
545 Ga0268265_10948333
546 Ga0268265_11499689
547 Ga0268264_10256307
548 Ga0268264_10398523
549 Ga0268264_10846083
550 Ga0307405_10029827
551 Ga0307410_10168216
552 Ga0307406_10119006
553 Ga0307406_10436533
554 Ga0307407_10227228
555 Ga0307412_10124562
556 Ga0307409_100227617
557 Ga0307414_10060422
558 Ga0307414_10243207
559 Ga0307411_10016679
560 Ga0307415_100119379
561 Ga0307415_100122399
562 Ga0373940_0034112
563 Ga0395901_0410306
564 Ga0242422_00943
565 Ga0242420_004520
566 Ga0495659_0187472
567 Ga0496102_0019245
568 Ga0496104_0064308
569 Ga0496106_0334294
570 Ga0496108_0111114
571 Ga0496112_0190364
572 Ga0496113_0166622
573 Ga0501292_014388
574 Ga0501296_005259
575 Ga0501298_015204
576 Ga0501299_004949
577 Ga0501303_009766
578 Ga0501206_026890
579 Ga0501217_020819
580 Ga0501223_031875
581 Ga0501227_037387
582 Ga0501228_005071
583 Ga0501235_013635
584 Ga0501240_007855
585 Ga0501257_021013
586 Ga0501245_023675
587 Ga0501272_006180
588 Ga0501212_001162
589 nmdc:mga05p37_1103469_c1
590 nmdc:mga05p37_97325_c1
591 nmdc:mga09592_33066_c1
592 nmdc:mga0qj67_67708_c1
593 nmdc:mga08y16_544108_c1
594 nmdc:mga08y16_69121_c1
595 nmdc:mga0n895_297415_c1
596 nmdc:mga0rr50_510_c1
597 nmdc:mga08x19_5_c1
598 nmdc:mga0a205_24974_c1
599 nmdc:mga0a205_264053_c1
600 nmdc:mga0a205_356887_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u1s-assembly1.cif.gz_A cryo-em structure of a de novo designed 16-helix transmembrane nanopore, tmhc8_r. 0.7321 55 175
5uhp-assembly1.cif.gz_F crystal structure of the core catalytic domain of human o-glcnacase 0.6681 104 180
8e0m-assembly2.cif.gz_D homotrimeric variant of tctrp9, bgl15 0.6558 55 171
5m7s-assembly1.cif.gz_B structure of human o-glcnac hydrolase with bound transition state analog thiametg 0.6394 104 174
8f6q-assembly1.cif.gz_A cryoem structure of designed modular protein oligomer c8-71 0.6297 55 173
ID Description Score Start End Superfamily
af_A0A0G2KB60_233_309_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6653 72 147 1.20.58.80
af_Q5JMS0_2_105_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6242 98 177 1.20.58.90
af_A0A1P8AX50_55_144_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6146 62 176 1.20.58.80
af_I1N3G3_52_142_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6045 62 176 1.20.58.80
af_K7KZY7_587_674_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.603 76 179 1.20.58.120
ID Description Score Start End GO Terms
AF-F7XL18-F1-model_v4 DUF5667 domain-containing protein 0.9376 55 176
AF-A0A2V8QYJ4-F1-model_v4 Uncharacterized protein 0.9322 44 181
AF-A0A2V9MRJ0-F1-model_v4 Uncharacterized protein 0.9227 54 176
AF-A0A7C0ZUC6-F1-model_v4 Peptidase S8/S53 domain-containing protein 0.9113 54 176 GO:0004252
GO:0006508
AF-A0A523VPA4-F1-model_v4 DUF5667 domain-containing protein 0.9096 54 174 GO:0016020

Map