F395127

General Info

Members Datasets Scaffolds Average Seq Length
299 228 598 143

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055266321|8055271260
Length 137
Sequence NEALLDRTFAALSDPTRRALLARLSKCELSVSELAEPFAMSLPAVMKHLDVLSTAGLITRSKNGRTVACRLSAKPMEEAMAWLDRYQRFWTESLDRLAAFVEEDEAPRARKPAARVAALSAPHPRKSSASARKRRDS

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
3 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
4 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
7 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
8 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
9 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
10 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
11 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
48 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
49 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
50 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
51 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
52 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
53 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
54 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
56 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
57 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
75 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
76 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
77 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
194 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
195 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
196 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
197 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
198 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
199 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
200 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
201 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
202 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
203 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
204 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
205 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
206 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
207 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
208 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
209 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
210 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
211 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
212 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
213 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
214 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
215 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
216 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
217 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
218 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
219 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
220 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
221 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
222 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
223 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
224 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
225 2922425934
226 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
227 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
228 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.26
Metatranscriptomes 0
Isolates 11.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 6.02
Rhizoplane 8.03
Rhizosphere 66.56
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100051325 3300005436 Bacteria 3410
2 Ga0070711_100010063 3300005439 Bacteria 5840
3 Ga0070665_100280313 3300005548 Bacteria 1669
4 Ga0081540_1011683 3300005983 Bacteria 5851
5 Ga0075363_100005648 3300006048 Bacteria 5594
6 Ga0070716_100448248 3300006173 Bacteria 940
7 Ga0075369_10018753 3300006186 Bacteria 2819
8 Ga0099824_1036359 3300006942 Bacteria 1434
9 Ga0099822_1062036 3300006943 Bacteria 1214
10 Ga0099794_10547629 3300007265 Bacteria 611
11 Ga0099795_10049111 3300007788 Bacteria 1530
12 Ga0105251_10086078 3300009011 Bacteria 1448
13 Ga0105244_10116620 3300009036 Bacteria 1295
14 Ga0105250_10138168 3300009092 Bacteria 1009
15 Ga0105240_10320248 3300009093 Bacteria 1768
16 Ga0105240_10734475 3300009093 Bacteria 1075
17 Ga0105245_10883816 3300009098 Bacteria 935
18 Ga0105247_10024234 3300009101 Bacteria 3656
19 Ga0105243_10028960 3300009148 Bacteria 4256
20 Ga0105243_11059481 3300009148 Bacteria 817
21 Ga0105243_11732088 3300009148 Bacteria 654
22 Ga0105242_10174545 3300009176 Bacteria 1891
23 Ga0105248_10082815 3300009177 Bacteria 3609
24 Ga0105248_10709865 3300009177 Bacteria 1135
25 Ga0105237_10015833 3300009545 Bacteria 7843
26 Ga0105237_10076838 3300009545 Bacteria 3329
27 Ga0105238_10030812 3300009551 Bacteria 5459
28 Ga0105249_10105342 3300009553 Bacteria 2659
29 Ga0099796_10069283 3300010159 Bacteria 1269
30 Ga0099796_10149390 3300010159 Bacteria 919
31 Ga0105239_10022119 3300010375 Bacteria 7008
32 Ga0105246_10061488 3300011119 Bacteria 2613
33 Ga0105246_10374674 3300011119 Bacteria 1174
34 Ga0157370_11782012 3300013104 Bacteria 552
35 Ga0157369_10015069 3300013105 Bacteria 8727
36 Ga0157374_10198530 3300013296 Bacteria 1964
37 Ga0157378_10191854 3300013297 Bacteria 1927
38 Ga0163162_10001295 3300013306 Bacteria 23374
39 Ga0163162_10001670 3300013306 Bacteria 20816
40 Ga0163162_10024350 3300013306 Bacteria 5972
41 Ga0163162_10124579 3300013306 Bacteria 2682
42 Ga0157375_10009152 3300013308 Bacteria 8680
43 Ga0157375_11208613 3300013308 Bacteria 887
44 Ga0157380_10139419 3300014326 Bacteria 2081
45 Ga0157380_10453129 3300014326 Bacteria 1233
46 Ga0157377_10106081 3300014745 Bacteria 1682
47 Ga0209025_1000084 3300025294 Bacteria 263812
48 Ga0209758_1002753 3300025297 Bacteria 17231
49 Ga0207426_1000113 3300025302 Bacteria 228304
50 Ga0207688_10084799 3300025901 Bacteria 1814
51 Ga0207699_10197086 3300025906 Bacteria 1362
52 Ga0207654_10249913 3300025911 Bacteria 1188
53 Ga0207671_11187320 3300025914 Bacteria 597
54 Ga0207700_10080329 3300025928 Bacteria 2543
55 Ga0207665_10339729 3300025939 Bacteria 1131
56 Ga0207691_10227473 3300025940 Bacteria 1616
57 Ga0207658_10213728 3300025986 Bacteria 1618
58 Ga0207683_10555039 3300026121 Bacteria 1062
59 Ga0209389_1034200 3300027296 Bacteria 4165
60 Ga0209589_1033610 3300027357 Bacteria 2384
61 Ga0209489_119149 3300027361 Bacteria 2402
62 Ga0307517_10198107 3300028786 Bacteria 1261
63 Ga0265332_10090307 3300031238 Bacteria 1296
64 Ga0373940_0127569 3300035088 Bacteria 794
65 Ga0373944_0025636 3300035089 Bacteria 1737
66 Ga0373923_0168801 3300035111 Bacteria 1001
67 Ga0373936_0078272 3300035113 Bacteria 1373
68 Ga0373939_0011759 3300035114 Bacteria 2216
69 Ga0373939_0171142 3300035114 Bacteria 804
70 Ga0373941_0057704 3300035115 Bacteria 1254
71 Ga0373953_0017788 3300035117 Bacteria 2619
72 Ga0373954_0065230 3300035118 Bacteria 1723
73 Ga0373956_0083689 3300035119 Bacteria 1466
74 Ga0373943_0059959 3300035170 Bacteria 1898
75 Ga0373955_0016160 3300035172 Bacteria 3669
76 Ga0373924_0025933 3300035410 Bacteria 2320
77 Ga0373924_0149785 3300035410 Bacteria 1020
78 Ga0373933_0004728 3300035724 Bacteria 7447
79 Ga0373933_0511188 3300035724 Bacteria 787
80 Ga0373937_0236256 3300036401 Bacteria 1721
81 Ga0373925_1258732 3300037068 Bacteria 607
82 Ga0373925_1349006 3300037068 Bacteria 585
83 Ga0395899_0314042 3300037312 Bacteria 1057
84 Ga0395900_0071395 3300037418 Bacteria 3569
85 Ga0395905_0000107 3300037471 Bacteria 138710
86 Ga0395905_0059179 3300037471 Bacteria 3582
87 Ga0395905_0246208 3300037471 Bacteria 1670
88 Ga0395905_1094643 3300037471 Bacteria 700
89 Ga0395901_0218051 3300038443 Bacteria 1995
90 Ga0436365_0711391 3300039437 Bacteria 2493
91 Ga0436361_0201117 3300039447 Bacteria 5845
92 Ga0436363_0754403 3300039450 Bacteria 578
93 Ga0436363_1177061 3300039450 Bacteria 818
94 Ga0451833_1385063 3300041491 Bacteria 732
95 Ga0451835_0310322 3300041492 Bacteria 810
96 Ga0451849_0719427 3300041505 Bacteria 618
97 Ga0439458_0053642 3300042157 Bacteria 998
98 Ga0466963_0140318 3300044694 Bacteria 1674
99 Ga0466971_0148573 3300044719 Bacteria 1093
100 Ga0466968_0374167 3300044735 Bacteria 695
101 Ga0466958_0070742 3300045836 Bacteria 2136
102 Ga0466967_0293870 3300045976 Bacteria 1561
103 Ga0495592_0001825 3300046454 Bacteria 14963
104 Ga0495592_0031478 3300046454 Bacteria 4009
105 Ga0495603_0040582 3300046455 Bacteria 2785
106 Ga0495603_0624638 3300046455 Bacteria 617
107 Ga0495638_0001885 3300046460 Bacteria 18135
108 Ga0495641_0092517 3300046461 Bacteria 1351
109 Ga0495651_0016735 3300046462 Bacteria 5678
110 Ga0495651_0041232 3300046462 Bacteria 3586
111 Ga0495651_0055847 3300046462 Bacteria 3033
112 Ga0495653_0071631 3300046463 Bacteria 2590
113 Ga0495653_0100331 3300046463 Bacteria 2099
114 Ga0495605_0003208 3300046474 Bacteria 9808
115 Ga0495639_0071379 3300046475 Bacteria 1604
116 Ga0495662_0143560 3300046476 Bacteria 1175
117 Ga0495662_0257751 3300046476 Bacteria 859
118 Ga0495664_0132916 3300046477 Bacteria 1507
119 Ga0495585_0094334 3300046492 Bacteria 1608
120 Ga0495594_0191722 3300046499 Bacteria 1164
121 Ga0495596_0130839 3300046500 Bacteria 974
122 Ga0495607_0026332 3300046501 Bacteria 3608
123 Ga0495606_0359358 3300046507 Bacteria 770
124 Ga0495606_0561862 3300046507 Bacteria 566
125 Ga0495608_0026547 3300046511 Bacteria 3947
126 Ga0495610_0015979 3300046512 Bacteria 4341
127 Ga0495610_0058976 3300046512 Bacteria 1834
128 Ga0495616_0198122 3300046513 Bacteria 884
129 Ga0495618_0054519 3300046514 Bacteria 2530
130 Ga0495618_0406509 3300046514 Bacteria 832
131 Ga0495628_0001666 3300046516 Bacteria 20271
132 Ga0495628_0348801 3300046516 Bacteria 1088
133 Ga0495630_0443824 3300046517 Bacteria 994
134 Ga0495631_0071155 3300046518 Bacteria 1503
135 Ga0495666_0212357 3300046526 Bacteria 887
136 Ga0495666_0546896 3300046526 Bacteria 516
137 Ga0495642_0414300 3300046528 Bacteria 594
138 Ga0495652_0010081 3300046529 Bacteria 8566
139 Ga0495652_0255491 3300046529 Bacteria 1296
140 Ga0495640_0092857 3300046533 Bacteria 1990
141 Ga0495587_0012903 3300046536 Bacteria 5254
142 Ga0495587_0255214 3300046536 Bacteria 985
143 Ga0495645_0023825 3300046543 Bacteria 4436
144 Ga0495645_0101937 3300046543 Bacteria 2040
145 Ga0495622_0076429 3300046557 Bacteria 1543
146 Ga0495667_0034912 3300046559 Bacteria 3363
147 Ga0495668_0118595 3300046616 Bacteria 1447
148 Ga0495668_0354657 3300046616 Bacteria 805
149 Ga0495634_0058468 3300046642 Bacteria 2569
150 Ga0495635_0054279 3300046663 Bacteria 2760
151 Ga0495635_0272290 3300046663 Bacteria 1138
152 Ga0495659_0065657 3300046664 Bacteria 1350
153 Ga0495657_0017940 3300046675 Bacteria 5132
154 Ga0495599_0004772 3300046678 Bacteria 8058
155 Ga0495599_0030109 3300046678 Bacteria 3404
156 Ga0495623_0129688 3300046679 Bacteria 1511
157 Ga0495646_0322479 3300046680 Bacteria 813
158 Ga0495647_0068297 3300046681 Bacteria 1417
159 Ga0495669_0021629 3300046684 Bacteria 2793
160 Ga0495670_0067148 3300046691 Bacteria 1810
161 Ga0495670_0177827 3300046691 Bacteria 1123
162 Ga0495589_0026118 3300046794 Bacteria 2960
163 Ga0495600_0068535 3300046809 Bacteria 2318
164 Ga0495604_0062125 3300047317 Bacteria 2855
165 Ga0495674_0075313 3300047319 Bacteria 2904
166 Ga0495672_0066225 3300047320 Bacteria 2062
167 Ga0495680_0050907 3300047322 Bacteria 3237
168 Ga0495680_0240907 3300047322 Bacteria 1285
169 Ga0495683_0261718 3300047323 Bacteria 755
170 Ga0495675_0016040 3300047444 Bacteria 4737
171 Ga0495675_0108222 3300047444 Bacteria 1736
172 Ga0495675_0673440 3300047444 Bacteria 581
173 Ga0495684_0155168 3300047471 Bacteria 1710
174 Ga0495684_0365785 3300047471 Bacteria 1020
175 Ga0495686_0000099 3300047472 Bacteria 180546
176 Ga0495686_0031763 3300047472 Bacteria 3421
177 Ga0495593_0053416 3300047673 Bacteria 2133
178 Ga0495602_0010155 3300048088 Bacteria 9775
179 Ga0495602_0071515 3300048088 Bacteria 2962
180 Ga0495602_0479605 3300048088 Bacteria 873
181 Ga0495614_0231766 3300048089 Bacteria 841
182 Ga0496100_0041570 3300048903 Bacteria 2931
183 Ga0496100_0058544 3300048903 Bacteria 2529
184 Ga0496101_0059921 3300048904 Bacteria 2760
185 Ga0496102_0019481 3300048905 Bacteria 5976
186 Ga0496102_0214520 3300048905 Bacteria 1814
187 Ga0496102_0220265 3300048905 Bacteria 1789
188 Ga0496103_0644169 3300048906 Bacteria 673
189 Ga0496104_0000140 3300048907 Bacteria 67259
190 Ga0496104_0227469 3300048907 Bacteria 1777
191 Ga0496105_0002370 3300048908 Bacteria 13650
192 Ga0496105_0123279 3300048908 Bacteria 2136
193 Ga0496105_0724726 3300048908 Bacteria 761
194 Ga0496106_0073399 3300048909 Bacteria 2618
195 Ga0496106_0133034 3300048909 Bacteria 1951
196 Ga0496106_0687412 3300048909 Bacteria 816
197 Ga0496107_0017793 3300048910 Bacteria 5001
198 Ga0496107_0023317 3300048910 Bacteria 4376
199 Ga0496107_0031295 3300048910 Bacteria 3796
200 Ga0496109_0087532 3300048912 Bacteria 2877
201 Ga0496112_0246712 3300048915 Bacteria 1737
202 Ga0496114_0046478 3300048917 Bacteria 3608
203 Ga0496115_0077115 3300048918 Bacteria 2710
204 Ga0496115_0325048 3300048918 Bacteria 1257
205 Ga0496115_0372404 3300048918 Bacteria 1162
206 Ga0496117_0051598 3300048920 Bacteria 2906
207 Ga0496118_0094954 3300048921 Bacteria 2037
208 Ga0496118_0193111 3300048921 Bacteria 1215
209 Ga0496118_0265415 3300048921 Bacteria 966
210 Ga0496121_0001325 3300048924 Bacteria 42402
211 Ga0496121_0170073 3300048924 Bacteria 1584
212 Ga0496121_0487802 3300048924 Bacteria 785
213 Ga0496124_0630058 3300048927 Bacteria 692
214 Ga0496126_0000176 3300048929 Bacteria 145407
215 Ga0501031_0248423 3300049568 Bacteria 1156
216 Ga0501033_0117311 3300049570 Bacteria 1933
217 Ga0501034_0924771 3300049571 Bacteria 759
218 Ga0501036_0204266 3300049572 Bacteria 1661
219 Ga0501038_0970519 3300049574 Bacteria 625
220 Ga0501046_0050636 3300049580 Bacteria 3280
221 Ga0501047_0463318 3300049581 Bacteria 1096
222 Ga0501069_0224443 3300049585 Bacteria 1093
223 Ga0501071_0709353 3300049587 Bacteria 775
224 Ga0501073_0632712 3300049589 Bacteria 739
225 Ga0501074_0613991 3300049590 Bacteria 769
226 Ga0501077_0032664 3300049593 Bacteria 3313
227 Ga0501035_0651810 3300049822 Bacteria 853
228 Ga0501044_0202280 3300049823 Bacteria 1944
229 Ga0501044_0576357 3300049823 Bacteria 1020
230 nmdc:mga03n38_45521_c1 3300050490 Bacteria 1932
231 nmdc:mga00v17_16317_c1 3300050491 Bacteria 4186
232 nmdc:mga0yw44_197148_c1 3300050492 Bacteria 1329
233 nmdc:mga0yw44_343906_c1 3300050492 Bacteria 1003
234 nmdc:mga0yw44_65291_c1 3300050492 Bacteria 2243
235 nmdc:mga0yw44_7359_c1 3300050492 Bacteria 5409
236 nmdc:mga0k408_42624_c1 3300050493 Bacteria 2614
237 nmdc:mga09592_324_c1 3300050508 Bacteria 34853
238 nmdc:mga09592_542381_c1 3300050508 Bacteria 999
239 nmdc:mga0qj67_6890_c1 3300050509 Bacteria 8361
240 nmdc:mga06r32_7006_c1 3300050510 Bacteria 10141
241 nmdc:mga08y16_697_c1 3300050511 Bacteria 31905
242 nmdc:mga0n895_609_c1 3300050512 Bacteria 24818
243 nmdc:mga0rr50_4488_c1 3300050513 Bacteria 8220
244 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
245 nmdc:mga0a205_967_c1 3300050515 Bacteria 23723
246 Ga0495601_0004357 3300053077 Bacteria 8179
247 Ga0495612_0001680 3300053078 Bacteria 9110
248 Ga0495612_0076220 3300053078 Bacteria 1404
249 Ga0495612_0147541 3300053078 Bacteria 1022
250 Ga0495619_0000421 3300053085 Bacteria 28651
251 Ga0500651_0336375 3300053093 Bacteria 859
252 Ga0500556_0010842 3300053104 Bacteria 2684
253 Ga0500595_025570 3300053119 Bacteria 2044
254 Ga0500642_0449559 3300053130 Bacteria 553
255 Ga0500655_002625 3300053133 Bacteria 3260
256 Ga0500568_0005157 3300053139 Bacteria 6813
257 Ga0500568_0308787 3300053139 Bacteria 574
258 Ga0500616_0000408 3300053153 Bacteria 58453
259 Ga0500616_0001148 3300053153 Bacteria 27138
260 Ga0500645_024306 3300053730 Bacteria 1852
261 Ga0500609_001391 3300053731 Bacteria 3548
262 Ga0501084_0872292 3300054114 Unclassified 757
263 Ga0501084_1030641 3300054114 Bacteria 691
264 8055271260 8055266321 Bacteria 7999742
265 2501072807 2501025501 Bacteria 7768574
266 2501408576 2501025504 Bacteria 8008976
267 2511096313 2510917014 Bacteria 8296963
268 2513556478 2513237082 Bacteria 8640282
269 2513564498 2513237083 Bacteria 8410967
270 2513623318 2513237092 Bacteria 8341956
271 2516024333 2515154189 Bacteria 9629850
272 2524435876 2524023205 Bacteria 8918781
273 2713477476 2711768613 Bacteria 11048459
274 2745081472 2744054633 Bacteria 8678936
275 2793067423 2791355197 Bacteria 8420563
276 2824685611 2824679649 Bacteria 8248951
277 2842351597 2842348783 Bacteria 9002918
278 2844539508 2844533157 Bacteria 7517899
279 2856292580 2856287931 Bacteria 7223934
280 2857360794 2857357740 Bacteria 9937880
281 2874618735 2874612657 Bacteria 8252029
282 2876765668 2876761206 Bacteria 10111113
283 2876810205 2876808645 Bacteria 8824342
284 2879112944 2879110137 Bacteria 8907982
285 2881665847 2881665667 Bacteria 8175609
286 2883095090 2883087390 Bacteria 9532701
287 2885381775 2885374607 Bacteria 8927485
288 2885387934 2885383462 Bacteria 9473874
289 2903758901 2903748898 Bacteria 9972761
290 2903771165 2903768456 Bacteria 9749579
291 2904618423 2904615490 Bacteria 10047340
292 2906626571 2906626472 Bacteria 8826946
293 2906637718 2906635258 Bacteria 8601019
294 2906668286 2906660503 Bacteria 8595048
295 2908747137 2908739725 Bacteria 8628932
296 2922434530
297 2928137746 2928135762 Bacteria 7259641
298 2928507484 2928503688 Bacteria 7268108
299 8003960819 8003955200 Bacteria 8601927
300 Ga0070713_100051325
301 Ga0070711_100010063
302 Ga0070665_100280313
303 Ga0081540_1011683
304 Ga0075363_100005648
305 Ga0070716_100448248
306 Ga0075369_10018753
307 Ga0099824_1036359
308 Ga0099822_1062036
309 Ga0099794_10547629
310 Ga0099795_10049111
311 Ga0105251_10086078
312 Ga0105244_10116620
313 Ga0105250_10138168
314 Ga0105240_10320248
315 Ga0105240_10734475
316 Ga0105245_10883816
317 Ga0105247_10024234
318 Ga0105243_10028960
319 Ga0105243_11059481
320 Ga0105243_11732088
321 Ga0105242_10174545
322 Ga0105248_10082815
323 Ga0105248_10709865
324 Ga0105237_10015833
325 Ga0105237_10076838
326 Ga0105238_10030812
327 Ga0105249_10105342
328 Ga0099796_10069283
329 Ga0099796_10149390
330 Ga0105239_10022119
331 Ga0105246_10061488
332 Ga0105246_10374674
333 Ga0157370_11782012
334 Ga0157369_10015069
335 Ga0157374_10198530
336 Ga0157378_10191854
337 Ga0163162_10001295
338 Ga0163162_10001670
339 Ga0163162_10024350
340 Ga0163162_10124579
341 Ga0157375_10009152
342 Ga0157375_11208613
343 Ga0157380_10139419
344 Ga0157380_10453129
345 Ga0157377_10106081
346 Ga0209025_1000084
347 Ga0209758_1002753
348 Ga0207426_1000113
349 Ga0207688_10084799
350 Ga0207699_10197086
351 Ga0207654_10249913
352 Ga0207671_11187320
353 Ga0207700_10080329
354 Ga0207665_10339729
355 Ga0207691_10227473
356 Ga0207658_10213728
357 Ga0207683_10555039
358 Ga0209389_1034200
359 Ga0209589_1033610
360 Ga0209489_119149
361 Ga0307517_10198107
362 Ga0265332_10090307
363 Ga0373940_0127569
364 Ga0373944_0025636
365 Ga0373923_0168801
366 Ga0373936_0078272
367 Ga0373939_0011759
368 Ga0373939_0171142
369 Ga0373941_0057704
370 Ga0373953_0017788
371 Ga0373954_0065230
372 Ga0373956_0083689
373 Ga0373943_0059959
374 Ga0373955_0016160
375 Ga0373924_0025933
376 Ga0373924_0149785
377 Ga0373933_0004728
378 Ga0373933_0511188
379 Ga0373937_0236256
380 Ga0373925_1258732
381 Ga0373925_1349006
382 Ga0395899_0314042
383 Ga0395900_0071395
384 Ga0395905_0000107
385 Ga0395905_0059179
386 Ga0395905_0246208
387 Ga0395905_1094643
388 Ga0395901_0218051
389 Ga0436365_0711391
390 Ga0436361_0201117
391 Ga0436363_0754403
392 Ga0436363_1177061
393 Ga0451833_1385063
394 Ga0451835_0310322
395 Ga0451849_0719427
396 Ga0439458_0053642
397 Ga0466963_0140318
398 Ga0466971_0148573
399 Ga0466968_0374167
400 Ga0466958_0070742
401 Ga0466967_0293870
402 Ga0495592_0001825
403 Ga0495592_0031478
404 Ga0495603_0040582
405 Ga0495603_0624638
406 Ga0495638_0001885
407 Ga0495641_0092517
408 Ga0495651_0016735
409 Ga0495651_0041232
410 Ga0495651_0055847
411 Ga0495653_0071631
412 Ga0495653_0100331
413 Ga0495605_0003208
414 Ga0495639_0071379
415 Ga0495662_0143560
416 Ga0495662_0257751
417 Ga0495664_0132916
418 Ga0495585_0094334
419 Ga0495594_0191722
420 Ga0495596_0130839
421 Ga0495607_0026332
422 Ga0495606_0359358
423 Ga0495606_0561862
424 Ga0495608_0026547
425 Ga0495610_0015979
426 Ga0495610_0058976
427 Ga0495616_0198122
428 Ga0495618_0054519
429 Ga0495618_0406509
430 Ga0495628_0001666
431 Ga0495628_0348801
432 Ga0495630_0443824
433 Ga0495631_0071155
434 Ga0495666_0212357
435 Ga0495666_0546896
436 Ga0495642_0414300
437 Ga0495652_0010081
438 Ga0495652_0255491
439 Ga0495640_0092857
440 Ga0495587_0012903
441 Ga0495587_0255214
442 Ga0495645_0023825
443 Ga0495645_0101937
444 Ga0495622_0076429
445 Ga0495667_0034912
446 Ga0495668_0118595
447 Ga0495668_0354657
448 Ga0495634_0058468
449 Ga0495635_0054279
450 Ga0495635_0272290
451 Ga0495659_0065657
452 Ga0495657_0017940
453 Ga0495599_0004772
454 Ga0495599_0030109
455 Ga0495623_0129688
456 Ga0495646_0322479
457 Ga0495647_0068297
458 Ga0495669_0021629
459 Ga0495670_0067148
460 Ga0495670_0177827
461 Ga0495589_0026118
462 Ga0495600_0068535
463 Ga0495604_0062125
464 Ga0495674_0075313
465 Ga0495672_0066225
466 Ga0495680_0050907
467 Ga0495680_0240907
468 Ga0495683_0261718
469 Ga0495675_0016040
470 Ga0495675_0108222
471 Ga0495675_0673440
472 Ga0495684_0155168
473 Ga0495684_0365785
474 Ga0495686_0000099
475 Ga0495686_0031763
476 Ga0495593_0053416
477 Ga0495602_0010155
478 Ga0495602_0071515
479 Ga0495602_0479605
480 Ga0495614_0231766
481 Ga0496100_0041570
482 Ga0496100_0058544
483 Ga0496101_0059921
484 Ga0496102_0019481
485 Ga0496102_0214520
486 Ga0496102_0220265
487 Ga0496103_0644169
488 Ga0496104_0000140
489 Ga0496104_0227469
490 Ga0496105_0002370
491 Ga0496105_0123279
492 Ga0496105_0724726
493 Ga0496106_0073399
494 Ga0496106_0133034
495 Ga0496106_0687412
496 Ga0496107_0017793
497 Ga0496107_0023317
498 Ga0496107_0031295
499 Ga0496109_0087532
500 Ga0496112_0246712
501 Ga0496114_0046478
502 Ga0496115_0077115
503 Ga0496115_0325048
504 Ga0496115_0372404
505 Ga0496117_0051598
506 Ga0496118_0094954
507 Ga0496118_0193111
508 Ga0496118_0265415
509 Ga0496121_0001325
510 Ga0496121_0170073
511 Ga0496121_0487802
512 Ga0496124_0630058
513 Ga0496126_0000176
514 Ga0501031_0248423
515 Ga0501033_0117311
516 Ga0501034_0924771
517 Ga0501036_0204266
518 Ga0501038_0970519
519 Ga0501046_0050636
520 Ga0501047_0463318
521 Ga0501069_0224443
522 Ga0501071_0709353
523 Ga0501073_0632712
524 Ga0501074_0613991
525 Ga0501077_0032664
526 Ga0501035_0651810
527 Ga0501044_0202280
528 Ga0501044_0576357
529 nmdc:mga03n38_45521_c1
530 nmdc:mga00v17_16317_c1
531 nmdc:mga0yw44_197148_c1
532 nmdc:mga0yw44_343906_c1
533 nmdc:mga0yw44_65291_c1
534 nmdc:mga0yw44_7359_c1
535 nmdc:mga0k408_42624_c1
536 nmdc:mga09592_324_c1
537 nmdc:mga09592_542381_c1
538 nmdc:mga0qj67_6890_c1
539 nmdc:mga06r32_7006_c1
540 nmdc:mga08y16_697_c1
541 nmdc:mga0n895_609_c1
542 nmdc:mga0rr50_4488_c1
543 nmdc:mga08x19_6_c2
544 nmdc:mga0a205_967_c1
545 Ga0495601_0004357
546 Ga0495612_0001680
547 Ga0495612_0076220
548 Ga0495612_0147541
549 Ga0495619_0000421
550 Ga0500651_0336375
551 Ga0500556_0010842
552 Ga0500595_025570
553 Ga0500642_0449559
554 Ga0500655_002625
555 Ga0500568_0005157
556 Ga0500568_0308787
557 Ga0500616_0000408
558 Ga0500616_0001148
559 Ga0500645_024306
560 Ga0500609_001391
561 Ga0501084_0872292
562 Ga0501084_1030641
563 8055271260
564 2501072807
565 2501408576
566 2511096313
567 2513556478
568 2513564498
569 2513623318
570 2516024333
571 2524435876
572 2713477476
573 2745081472
574 2793067423
575 2824685611
576 2842351597
577 2844539508
578 2856292580
579 2857360794
580 2874618735
581 2876765668
582 2876810205
583 2879112944
584 2881665847
585 2883095090
586 2885381775
587 2885387934
588 2903758901
589 2903771165
590 2904618423
591 2906626571
592 2906637718
593 2906668286
594 2908747137
595 2922434530
596 2928137746
597 2928507484
598 8003960819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

14

60

0.98

PF12840

HTH_20

Helix-turn-helix domain

12

61

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9476 8 91
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9453 8 96
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9307 6 94
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.928 7 108
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9163 4 88
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.951 8 89 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9453 8 96 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9417 18 75 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9333 6 88 1.10.10.10
af_Q58651_380_469_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9262 18 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C2FGD0-F1-model_v4 Transcriptional regulator 0.9896 8 91 GO:0003700
AF-A0A537YDF5-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9809 8 104 GO:0003700
AF-F1TFY7-F1-model_v4 Regulatory protein ArsR 0.9806 10 91 GO:0003700
AF-A0A7W1QAH9-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9804 8 108 GO:0003700
AF-A0A1W9QG17-F1-model_v4 Transcriptional regulator 0.976 8 106 GO:0003700

Map