F395117

General Info

Members Datasets Scaffolds Average Seq Length
299 221 262 424

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2883577096|2883578776
Length 469
Sequence TFALLLLVLLCVFLGAGLWIAMALAAVGYVAMAAAHPSPGLYLASSFWEATGSWTLAALPMFVWMGEILFRTKLSEELFNGLAPWVRRLPGGLLHVNILACGIFGSVSGSSAATCATVSKIALPELKKRGYDEDVAVGSLATSGTLGILIPPSIIMVVYAVAAEVSIVRVFIAGCIPGLLVMLLFSAYIAIWAKMNPAKQPRPEPPIPFAEKLRQSSKLIPCAVLIVVVIGTMFVGWATATEAAAFGVLGSLLMAAGRWTGLGLLVLDLIAWAVGLIPFSQFWPIAFFALLGLAAGERVLTWQSFLDSVKGATRLSCMIMFILAGAAFLTKAMALTGIPAALAEGVTHLNLGPYGLIAILTVVYVVLGTALDGVSMIVLTTSIVIPLVQHAGFDLVWFGIFIVLLVEIAEITPPVGFNLFVMQTMTGKEQLEVAKASMPFFLMLVLTVVLVTLFPVTLVTGLPDWLLSR

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221733 Bosea sp. Root381 Isolate Unclassified
8 2643221734 Bosea sp. Root670 Isolate Unclassified
9 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
10 2738543024 Aminobacter sp. AP02 Isolate Unclassified
11 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
12 2818991467 Bosea vestrisii 3192 Isolate Unclassified
13 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
14 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
15 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
16 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
17 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
18 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
19 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
20 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
23 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
24 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
25 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
26 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
27 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
28 2952252522 Salinicola sp. DM10 Isolate Unclassified
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
215 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
216 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
217 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
218 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
219 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
220 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
221 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.63
Metatranscriptomes 0
Isolates 12.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.73
Nodule 2.68
Rhizoplane 0.67
Rhizosphere 66.22
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1001147 3300002774 Bacteria 7936
2 JGI25150J39212_1004640 3300002774 Bacteria 3028
3 JGI25151J46595_10001148 3300003187 Bacteria 19196
4 JGI25151J46595_10001220 3300003187 Bacteria 18383
5 JGI25151J46595_10007414 3300003187 Bacteria 5379
6 JGI25151J46595_10022897 3300003187 Bacteria 2584
7 JGI25406J46586_10000140 3300003203 Bacteria 31662
8 JGI25153J46596_10005666 3300003215 Bacteria 6519
9 Ga0055526_1000614 3300003771 Bacteria 27632
10 Ga0055526_1002549 3300003771 Bacteria 12236
11 Ga0055526_1002553 3300003771 Bacteria 12225
12 Ga0055537_1002917 3300003773 Bacteria 5449
13 Ga0055524_1000023 3300003775 Bacteria 221408
14 Ga0055524_1000401 3300003775 Bacteria 37009
15 Ga0055536_1000365 3300003781 Bacteria 33614
16 Ga0055536_1001522 3300003781 Bacteria 13907
17 Ga0055534_1001121 3300003784 Bacteria 11364
18 Ga0055534_1004170 3300003784 Bacteria 4276
19 JGI25405J52794_10003799 3300003911 Bacteria 2670
20 Ga0065704_10073866 3300005289 Bacteria 6722
21 Ga0065715_10015836 3300005293 Bacteria 3226
22 Ga0070676_10015942 3300005328 Bacteria 4147
23 Ga0070676_10026739 3300005328 Bacteria 3267
24 Ga0070683_100047706 3300005329 Bacteria 3958
25 Ga0070690_100000381 3300005330 Bacteria 22582
26 Ga0070670_100000316 3300005331 Bacteria 41464
27 Ga0070677_10000457 3300005333 Bacteria 13976
28 Ga0068869_100000209 3300005334 Bacteria 30398
29 Ga0068869_100041063 3300005334 Bacteria 3311
30 Ga0070680_100001700 3300005336 Bacteria 16129
31 Ga0068868_100004126 3300005338 Bacteria 10150
32 Ga0068868_100004726 3300005338 Bacteria 9566
33 Ga0070689_100000287 3300005340 Bacteria 29278
34 Ga0070691_10000369 3300005341 Bacteria 16306
35 Ga0070687_100000179 3300005343 Bacteria 22014
36 Ga0070661_100055044 3300005344 Bacteria 2913
37 Ga0070669_100027316 3300005353 Bacteria 4106
38 Ga0070675_100000480 3300005354 Bacteria 27286
39 Ga0070675_100074115 3300005354 Bacteria 2827
40 Ga0070671_100000734 3300005355 Bacteria 23452
41 Ga0070671_100096617 3300005355 Bacteria 2477
42 Ga0070674_100041484 3300005356 Bacteria 3119
43 Ga0070673_100001230 3300005364 Bacteria 14824
44 Ga0070659_100008351 3300005366 Bacteria 7561
45 Ga0070701_10001329 3300005438 Bacteria 9110
46 Ga0070705_100000659 3300005440 Bacteria 19742
47 Ga0070694_100000090 3300005444 Bacteria 43268
48 Ga0070681_10011522 3300005458 Bacteria 8751
49 Ga0068867_100000668 3300005459 Bacteria 22750
50 Ga0068867_100000712 3300005459 Bacteria 22179
51 Ga0070699_100094440 3300005518 Bacteria 2618
52 Ga0070679_100287590 3300005530 Bacteria 1596
53 Ga0070684_100042848 3300005535 Bacteria 3908
54 Ga0070684_100061912 3300005535 Bacteria 3277
55 Ga0070697_100231964 3300005536 Bacteria 1575
56 Ga0068853_100027098 3300005539 Bacteria 4816
57 Ga0070672_100000206 3300005543 Bacteria 32562
58 Ga0070686_100000493 3300005544 Bacteria 23885
59 Ga0070695_100000079 3300005545 Bacteria 39939
60 Ga0070696_100000170 3300005546 Bacteria 37218
61 Ga0070693_100000171 3300005547 Bacteria 29969
62 Ga0070704_100000178 3300005549 Bacteria 25603
63 Ga0068855_100001801 3300005563 Bacteria 26787
64 Ga0068856_100145702 3300005614 Bacteria 2376
65 Ga0070702_100000068 3300005615 Bacteria 29170
66 Ga0068852_100017057 3300005616 Bacteria 5687
67 Ga0068859_100000935 3300005617 Bacteria 29960
68 Ga0068864_100010783 3300005618 Bacteria 7552
69 Ga0068866_10000239 3300005718 Bacteria 25871
70 Ga0068861_100000070 3300005719 Bacteria 49394
71 Ga0068861_100004400 3300005719 Bacteria 9442
72 Ga0068863_100132645 3300005841 Bacteria 2378
73 Ga0068858_100001685 3300005842 Bacteria 22601
74 Ga0068858_100033193 3300005842 Bacteria 4792
75 Ga0068860_100001743 3300005843 Bacteria 23193
76 Ga0068862_100000975 3300005844 Bacteria 27450
77 Ga0081455_10007815 3300005937 Bacteria 11201
78 Ga0081539_10001292 3300005985 Bacteria 43995
79 Ga0081539_10020902 3300005985 Bacteria 4397
80 Ga0075364_10020854 3300006051 Bacteria 4125
81 Ga0075364_10023834 3300006051 Bacteria 3878
82 Ga0075432_10001770 3300006058 Bacteria 7111
83 Ga0097621_100000468 3300006237 Bacteria 28316
84 Ga0097621_100037610 3300006237 Bacteria 3880
85 Ga0068871_100000188 3300006358 Bacteria 42040
86 Ga0068871_100000461 3300006358 Bacteria 27922
87 Ga0075428_100011131 3300006844 Bacteria 10010
88 Ga0075430_100019060 3300006846 Bacteria 5837
89 Ga0075430_100121905 3300006846 Bacteria 2173
90 Ga0075431_100018000 3300006847 Bacteria 7185
91 Ga0075431_100071597 3300006847 Bacteria 3577
92 Ga0075433_10005285 3300006852 Bacteria 10127
93 Ga0075433_10005410 3300006852 Bacteria 10030
94 Ga0075434_100000349 3300006871 Bacteria 33394
95 Ga0075434_100023357 3300006871 Bacteria 6024
96 Ga0075429_100006665 3300006880 Bacteria 10010
97 Ga0075429_100117594 3300006880 Bacteria 2323
98 Ga0068865_100000242 3300006881 Bacteria 30369
99 Ga0075436_100000075 3300006914 Bacteria 59554
100 Ga0097620_100000935 3300006931 Bacteria 29960
101 Ga0099825_1020999 3300006941 Bacteria 4522
102 Ga0099826_10000004 3300006948 Bacteria 802669
103 Ga0075435_100000116 3300007076 Bacteria 44259
104 Ga0075435_100017389 3300007076 Bacteria 5443
105 Ga0111539_10000787 3300009094 Bacteria 41244
106 Ga0111539_10012566 3300009094 Bacteria 10609
107 Ga0105245_10001199 3300009098 Bacteria 23456
108 Ga0114129_10007828 3300009147 Bacteria 15204
109 Ga0114129_10039615 3300009147 Bacteria 6644
110 Ga0105242_10000161 3300009176 Bacteria 50082
111 Ga0105248_10244923 3300009177 Bacteria 2018
112 Ga0105238_10178933 3300009551 Bacteria 2097
113 Ga0105249_10003947 3300009553 Bacteria 12806
114 Ga0157374_10085509 3300013296 Bacteria 2999
115 Ga0157378_10002026 3300013297 Bacteria 18132
116 Ga0163162_10033703 3300013306 Bacteria 5090
117 Ga0163162_10077050 3300013306 Bacteria 3397
118 Ga0163162_10091922 3300013306 Bacteria 3117
119 Ga0157380_10040881 3300014326 Bacteria 3615
120 Ga0157379_10153408 3300014968 Bacteria 2078
121 Ga0157376_10001329 3300014969 Bacteria 16309
122 Ga0157376_10066727 3300014969 Bacteria 3042
123 Ga0207425_1000985 3300025245 Bacteria 13396
124 Ga0209565_1000066 3300025263 Bacteria 173062
125 Ga0209565_1000573 3300025263 Bacteria 24963
126 Ga0209673_1009466 3300025273 Bacteria 4215
127 Ga0209130_1013406 3300025284 Bacteria 2099
128 Ga0209675_1000084 3300025291 Bacteria 152066
129 Ga0209675_1001045 3300025291 Bacteria 17234
130 Ga0209675_1001106 3300025291 Bacteria 16496
131 Ga0209675_1001144 3300025291 Bacteria 16175
132 Ga0209675_1010231 3300025291 Bacteria 3221
133 Ga0209676_1000014 3300025292 Bacteria 793514
134 Ga0209676_1005054 3300025292 Bacteria 7054
135 Ga0209025_1000365 3300025294 Bacteria 95783
136 Ga0209025_1000437 3300025294 Bacteria 82190
137 Ga0209025_1002968 3300025294 Bacteria 16847
138 Ga0209025_1003111 3300025294 Bacteria 16264
139 Ga0209025_1004492 3300025294 Bacteria 12074
140 Ga0209025_1004613 3300025294 Bacteria 11788
141 Ga0209025_1007624 3300025294 Bacteria 8009
142 Ga0209564_1000076 3300025295 Bacteria 283602
143 Ga0209564_1000539 3300025295 Bacteria 61208
144 Ga0209564_1000901 3300025295 Bacteria 38935
145 Ga0209564_1002826 3300025295 Bacteria 12866
146 Ga0209564_1006283 3300025295 Bacteria 6470
147 Ga0209758_1014488 3300025297 Bacteria 4187
148 Ga0209256_1000083 3300025299 Bacteria 221460
149 Ga0209256_1000331 3300025299 Bacteria 79942
150 Ga0209256_1003371 3300025299 Bacteria 11302
151 Ga0209257_1005355 3300025304 Bacteria 9068
152 Ga0207682_10000269 3300025893 Bacteria 23507
153 Ga0207642_10000149 3300025899 Bacteria 19758
154 Ga0207688_10008960 3300025901 Bacteria 5446
155 Ga0207688_10093060 3300025901 Bacteria 1733
156 Ga0207645_10007282 3300025907 Bacteria 7825
157 Ga0207707_10112024 3300025912 Bacteria 2385
158 Ga0207660_10000833 3300025917 Bacteria 20354
159 Ga0207662_10000064 3300025918 Bacteria 46399
160 Ga0207681_10007388 3300025923 Bacteria 6731
161 Ga0207650_10000172 3300025925 Bacteria 76270
162 Ga0207659_10000066 3300025926 Bacteria 66468
163 Ga0207659_10023895 3300025926 Bacteria 4087
164 Ga0207659_10037982 3300025926 Bacteria 3347
165 Ga0207687_10000267 3300025927 Bacteria 35541
166 Ga0207687_10112857 3300025927 Bacteria 2020
167 Ga0207690_10022184 3300025932 Bacteria 3946
168 Ga0207706_10100019 3300025933 Bacteria 2551
169 Ga0207686_10007778 3300025934 Bacteria 5776
170 Ga0207709_10000473 3300025935 Bacteria 36885
171 Ga0207670_10007868 3300025936 Bacteria 5983
172 Ga0207669_10003908 3300025937 Bacteria 6500
173 Ga0207704_10005400 3300025938 Bacteria 5891
174 Ga0207704_10024765 3300025938 Bacteria 3262
175 Ga0207691_10000265 3300025940 Bacteria 51755
176 Ga0207689_10000200 3300025942 Bacteria 52703
177 Ga0207689_10024677 3300025942 Bacteria 5041
178 Ga0207661_10026849 3300025944 Bacteria 4393
179 Ga0207667_10083861 3300025949 Bacteria 3299
180 Ga0207667_10152804 3300025949 Bacteria 2376
181 Ga0207651_10000267 3300025960 Bacteria 22292
182 Ga0207712_10001270 3300025961 Bacteria 17369
183 Ga0207677_10001218 3300026023 Bacteria 13876
184 Ga0207703_10001427 3300026035 Bacteria 21805
185 Ga0207639_10011699 3300026041 Bacteria 6102
186 Ga0207708_10001252 3300026075 Bacteria 19130
187 Ga0207702_10270463 3300026078 Bacteria 1603
188 Ga0207641_10160368 3300026088 Bacteria 2044
189 Ga0207648_10000309 3300026089 Bacteria 53487
190 Ga0207648_10045587 3300026089 Bacteria 3845
191 Ga0207648_10117173 3300026089 Bacteria 2341
192 Ga0207676_10017497 3300026095 Bacteria 5196
193 Ga0207675_100000089 3300026118 Bacteria 71258
194 Ga0207675_100013279 3300026118 Bacteria 7689
195 Ga0207683_10014997 3300026121 Bacteria 6595
196 Ga0207698_10009254 3300026142 Bacteria 6269
197 Ga0209282_1000035 3300027666 Bacteria 137066
198 Ga0209974_10015612 3300027876 Bacteria 2522
199 Ga0207428_10000058 3300027907 Bacteria 158579
200 Ga0207428_10030536 3300027907 Bacteria 4454
201 Ga0268265_10006139 3300028380 Bacteria 8152
202 Ga0268264_10001651 3300028381 Bacteria 20603
203 Ga0307515_10000066 3300028794 Bacteria 244076
204 Ga0265325_10049134 3300031241 Bacteria 2178
205 Ga0307513_10000915 3300031456 Bacteria 42641
206 Ga0307408_100000195 3300031548 Bacteria 65727
207 Ga0307408_100015988 3300031548 Bacteria 5003
208 Ga0307406_10024412 3300031901 Bacteria 3611
209 Ga0307412_10000647 3300031911 Bacteria 20240
210 Ga0307414_10198015 3300032004 Bacteria 1631
211 Ga0373929_0010174 3300035085 Bacteria 1755
212 Ga0373951_0004267 3300035091 Bacteria 3402
213 Ga0373941_0007345 3300035115 Bacteria 2693
214 Ga0373962_0052771 3300035242 Bacteria 1175
215 Ga0316574_0002220 3300035398 Bacteria 9662
216 Ga0373931_0000278 3300035691 Bacteria 21421
217 Ga0373931_0002923 3300035691 Bacteria 7623
218 Ga0395900_0001080 3300037418 Bacteria 34679
219 Ga0395900_0082189 3300037418 Bacteria 3310
220 Ga0395898_0008858 3300037466 Bacteria 10605
221 Ga0395898_0351643 3300037466 Bacteria 1405
222 Ga0395905_0002322 3300037471 Bacteria 21290
223 Ga0400483_026403 3300039062 Bacteria 4391
224 Ga0400483_034905 3300039062 Bacteria 1892
225 Ga0453684_0198562 3300044712 Bacteria 2340
226 Ga0451576_0049991 3300045051 Bacteria 4386
227 Ga0495621_0029282 3300046539 Bacteria 1877
228 Ga0496109_0026669 3300048912 Bacteria 5155
229 Ga0496110_0224921 3300048913 Bacteria 1706
230 Ga0496116_0004291 3300048919 Bacteria 13666
231 Ga0496121_0078278 3300048924 Bacteria 2629
232 Ga0496122_0000021 3300048925 Bacteria 391363
233 Ga0496122_0003093 3300048925 Bacteria 22367
234 Ga0496123_0000426 3300048926 Bacteria 76093
235 Ga0496123_0002770 3300048926 Bacteria 20934
236 Ga0496123_0108152 3300048926 Bacteria 1597
237 Ga0496125_0005318 3300048928 Bacteria 14393
238 Ga0496125_0013064 3300048928 Bacteria 8189
239 Ga0496125_0035263 3300048928 Bacteria 4393
240 Ga0501031_0009207 3300049568 Bacteria 6420
241 Ga0501034_0001082 3300049571 Bacteria 38490
242 Ga0501039_0189858 3300049575 Bacteria 1616
243 Ga0501035_0246934 3300049822 Bacteria 1517
244 nmdc:mga00v17_61081_c1 3300050491 Bacteria 2316
245 nmdc:mga0yw44_55965_c1 3300050492 Bacteria 2401
246 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
247 nmdc:mga09592_163_c1 3300050508 Bacteria 46620
248 nmdc:mga0qj67_143_c1 3300050509 Bacteria 48269
249 nmdc:mga0qj67_69416_c1 3300050509 Bacteria 2811
250 nmdc:mga06r32_936_c1 3300050510 Bacteria 25964
251 nmdc:mga08y16_19732_c1 3300050511 Bacteria 7108
252 nmdc:mga08y16_2671_c1 3300050511 Bacteria 18327
253 nmdc:mga0n895_2984_c1 3300050512 Bacteria 13428
254 nmdc:mga0n895_3620_c1 3300050512 Bacteria 12486
255 nmdc:mga0rr50_12072_c1 3300050513 Bacteria 5564
256 nmdc:mga0rr50_374_c1 3300050513 Bacteria 24484
257 nmdc:mga08x19_590_c1 3300050514 Bacteria 23512
258 nmdc:mga0a205_687_c1 3300050515 Bacteria 27032
259 nmdc:mga0a205_7196_c1 3300050515 Bacteria 10060
260 Ga0500651_0003005 3300053093 Bacteria 9101
261 Ga0500595_000024 3300053119 Bacteria 144160
262 Ga0500616_0043752 3300053153 Bacteria 2392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0108152 Ga0496123_0108152_21_1109 362
2 3300035242 Ga0373962_0052771 Ga0373962_0052771_18_1127 369
3 3300027876 Ga0209974_10015612 Ga0209974_100156123 381
4 3300006051 Ga0075364_10020854 Ga0075364_100208544 384
5 3300050491 nmdc:mga00v17_61081_c1 nmdc:mga00v17_61081_c1_491_1786 384
6 3300026089 Ga0207648_10045587 Ga0207648_100455872 393
7 3300027666 Ga0209282_1000035 Ga0209282_100003584 397
8 3300005293 Ga0065715_10015836 Ga0065715_100158362 398
9 3300005331 Ga0070670_100000316 Ga0070670_10000031630 398
10 3300005333 Ga0070677_10000457 Ga0070677_100004573 398
11 3300005353 Ga0070669_100027316 Ga0070669_1000273162 398
12 3300005354 Ga0070675_100000480 Ga0070675_10000048011 398
13 3300005355 Ga0070671_100000734 Ga0070671_10000073411 398
14 3300005356 Ga0070674_100041484 Ga0070674_1000414842 398
15 3300005364 Ga0070673_100001230 Ga0070673_1000012304 398
16 3300005459 Ga0068867_100000712 Ga0068867_10000071220 398
17 3300005543 Ga0070672_100000206 Ga0070672_1000002062 398
18 3300005618 Ga0068864_100010783 Ga0068864_1000107836 398
19 3300006846 Ga0075430_100121905 Ga0075430_1001219052 398
20 3300013306 Ga0163162_10091922 Ga0163162_100919222 398
21 3300025893 Ga0207682_10000269 Ga0207682_100002694 398
22 3300025923 Ga0207681_10007388 Ga0207681_100073883 398
23 3300025925 Ga0207650_10000172 Ga0207650_1000017244 398
24 3300025926 Ga0207659_10000066 Ga0207659_1000006639 398
25 3300025937 Ga0207669_10003908 Ga0207669_100039083 398
26 3300025938 Ga0207704_10024765 Ga0207704_100247653 398
27 3300025940 Ga0207691_10000265 Ga0207691_1000026539 398
28 3300025960 Ga0207651_10000267 Ga0207651_1000026710 398
29 3300026095 Ga0207676_10017497 Ga0207676_100174973 398
30 3300026121 Ga0207683_10014997 Ga0207683_100149976 398
31 3300037418 Ga0395900_0082189 Ga0395900_0082189_1567_2871 398
32 3300037466 Ga0395898_0351643 Ga0395898_0351643_63_1367 404
33 3300005328 Ga0070676_10015942 Ga0070676_100159422 407
34 3300005355 Ga0070671_100096617 Ga0070671_1000966172 407
35 3300025907 Ga0207645_10007282 Ga0207645_100072825 407
36 3300026089 Ga0207648_10117173 Ga0207648_101171732 407
37 3300035691 Ga0373931_0002923 Ga0373931_0002923_311_1621 412
38 3300005458 Ga0070681_10011522 Ga0070681_100115222 414
39 3300025912 Ga0207707_10112024 Ga0207707_101120242 414
40 3300025927 Ga0207687_10112857 Ga0207687_101128572 414
41 3300005530 Ga0070679_100287590 Ga0070679_1002875902 416
42 3300050492 nmdc:mga0yw44_55965_c1 nmdc:mga0yw44_55965_c1_278_1585 416
43 3300003911 JGI25405J52794_10003799 JGI25405J52794_100037992 417
44 3300005937 Ga0081455_10007815 Ga0081455_100078154 417
45 3300006058 Ga0075432_10001770 Ga0075432_100017702 417
46 3300006844 Ga0075428_100011131 Ga0075428_10001113110 417
47 3300006846 Ga0075430_100019060 Ga0075430_1000190606 417
48 3300006847 Ga0075431_100018000 Ga0075431_1000180002 417
49 3300006852 Ga0075433_10005285 Ga0075433_100052856 417
50 3300006871 Ga0075434_100023357 Ga0075434_1000233573 417
51 3300006880 Ga0075429_100006665 Ga0075429_1000066653 417
52 3300007076 Ga0075435_100017389 Ga0075435_1000173894 417
53 3300027907 Ga0207428_10000058 Ga0207428_1000005858 417
54 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_59986_61296 417
55 3300050508 nmdc:mga09592_163_c1 nmdc:mga09592_163_c1_7675_8985 417
56 3300050509 nmdc:mga0qj67_143_c1 nmdc:mga0qj67_143_c1_7674_8984 417
57 3300050510 nmdc:mga06r32_936_c1 nmdc:mga06r32_936_c1_5962_7272 417
58 3300050511 nmdc:mga08y16_2671_c1 nmdc:mga08y16_2671_c1_6787_8097 417
59 3300050512 nmdc:mga0n895_2984_c1 nmdc:mga0n895_2984_c1_5427_6737 417
60 3300050513 nmdc:mga0rr50_12072_c1 nmdc:mga0rr50_12072_c1_1547_2857 417
61 3300050515 nmdc:mga0a205_687_c1 nmdc:mga0a205_687_c1_1024_2334 417
62 3300002774 JGI25150J39212_1004640 JGI25150J39212_10046403 418
63 3300003187 JGI25151J46595_10007414 JGI25151J46595_100074145 418
64 3300005842 Ga0068858_100033193 Ga0068858_1000331934 418
65 3300006051 Ga0075364_10023834 Ga0075364_100238344 418
66 3300006852 Ga0075433_10005410 Ga0075433_100054106 418
67 3300006871 Ga0075434_100000349 Ga0075434_10000034936 418
68 3300006914 Ga0075436_100000075 Ga0075436_10000007568 418
69 3300007076 Ga0075435_100000116 Ga0075435_1000001166 418
70 3300009094 Ga0111539_10012566 Ga0111539_100125663 418
71 3300014326 Ga0157380_10040881 Ga0157380_100408813 418
72 3300025245 Ga0207425_1000985 Ga0207425_100098513 418
73 3300025292 Ga0209676_1005054 Ga0209676_10050545 418
74 3300025294 Ga0209025_1003111 Ga0209025_10031113 418
75 3300025294 Ga0209025_1004492 Ga0209025_10044928 418
76 3300025294 Ga0209025_1004613 Ga0209025_100461312 418
77 3300025295 Ga0209564_1006283 Ga0209564_10062834 418
78 3300025304 Ga0209257_1005355 Ga0209257_10053555 418
79 3300027907 Ga0207428_10030536 Ga0207428_100305365 418
80 3300031456 Ga0307513_10000915 Ga0307513_1000091534 418
81 3300031548 Ga0307408_100015988 Ga0307408_1000159886 418
82 3300031901 Ga0307406_10024412 Ga0307406_100244122 418
83 3300050511 nmdc:mga08y16_19732_c1 nmdc:mga08y16_19732_c1_4563_5876 418
84 3300050512 nmdc:mga0n895_3620_c1 nmdc:mga0n895_3620_c1_7648_8961 418
85 3300050513 nmdc:mga0rr50_374_c1 nmdc:mga0rr50_374_c1_4947_6260 418
86 3300050514 nmdc:mga08x19_590_c1 nmdc:mga08x19_590_c1_9748_11061 418
87 3300050515 nmdc:mga0a205_7196_c1 nmdc:mga0a205_7196_c1_4426_5739 418
88 3300006948 Ga0099826_10000004 Ga0099826_10000004185 419
89 3300009094 Ga0111539_10000787 Ga0111539_1000078736 419
90 3300009147 Ga0114129_10007828 Ga0114129_100078285 419
91 3300048925 Ga0496122_0003093 Ga0496122_0003093_9730_11040 419
92 3300048926 Ga0496123_0002770 Ga0496123_0002770_10670_11980 419
93 3300009551 Ga0105238_10178933 Ga0105238_101789332 420
94 3300025263 Ga0209565_1000573 Ga0209565_100057315 420
95 3300025291 Ga0209675_1001106 Ga0209675_100110613 420
96 3300035091 Ga0373951_0004267 Ga0373951_0004267_279_1592 420
97 3300035115 Ga0373941_0007345 Ga0373941_0007345_361_1674 420
98 3300035691 Ga0373931_0000278 Ga0373931_0000278_3545_4858 420
99 3300037418 Ga0395900_0001080 Ga0395900_0001080_18280_19593 420
100 3300037466 Ga0395898_0008858 Ga0395898_0008858_6378_7691 420
101 3300039062 Ga0400483_034905 Ga0400483_034905_534_1841 420
102 3300045051 Ga0451576_0049991 Ga0451576_0049991_2600_3913 420
103 3300003203 JGI25406J46586_10000140 JGI25406J46586_100001408 421
104 3300005985 Ga0081539_10001292 Ga0081539_100012928 421
105 3300035085 Ga0373929_0010174 Ga0373929_0010174_165_1478 422
106 3300048919 Ga0496116_0004291 Ga0496116_0004291_9487_10848 422
107 3300003187 JGI25151J46595_10022897 JGI25151J46595_100228971 423
108 3300025294 Ga0209025_1000365 Ga0209025_100036560 423
109 3300049568 Ga0501031_0009207 Ga0501031_0009207_1074_2378 423
110 3300037471 Ga0395905_0002322 Ga0395905_0002322_7921_9225 425
111 3300025291 Ga0209675_1010231 Ga0209675_10102313 426
112 3300028794 Ga0307515_10000066 Ga0307515_1000006610 426
113 iso_pu_bacteria 2840878972 2840883952 426
114 3300003187 JGI25151J46595_10001148 JGI25151J46595_1000114810 427
115 3300003187 JGI25151J46595_10001220 JGI25151J46595_100012205 427
116 3300003771 Ga0055526_1000614 Ga0055526_100061419 427
117 3300003771 Ga0055526_1002549 Ga0055526_10025493 427
118 3300003771 Ga0055526_1002553 Ga0055526_10025538 427
119 3300003773 Ga0055537_1002917 Ga0055537_10029172 427
120 3300003775 Ga0055524_1000023 Ga0055524_1000023172 427
121 3300003775 Ga0055524_1000401 Ga0055524_100040114 427
122 3300003781 Ga0055536_1000365 Ga0055536_100036524 427
123 3300003784 Ga0055534_1001121 Ga0055534_10011218 427
124 3300003784 Ga0055534_1004170 Ga0055534_10041702 427
125 3300005338 Ga0068868_100004726 Ga0068868_1000047266 427
126 3300005344 Ga0070661_100055044 Ga0070661_1000550442 427
127 3300005535 Ga0070684_100061912 Ga0070684_1000619122 427
128 3300005614 Ga0068856_100145702 Ga0068856_1001457022 427
129 3300005616 Ga0068852_100017057 Ga0068852_1000170575 427
130 3300006237 Ga0097621_100037610 Ga0097621_1000376102 427
131 3300006358 Ga0068871_100000461 Ga0068871_10000046114 427
132 3300006847 Ga0075431_100071597 Ga0075431_1000715972 427
133 3300006880 Ga0075429_100117594 Ga0075429_1001175942 427
134 3300009147 Ga0114129_10039615 Ga0114129_100396152 427
135 3300013296 Ga0157374_10085509 Ga0157374_100855092 427
136 3300013306 Ga0163162_10033703 Ga0163162_100337035 427
137 3300014968 Ga0157379_10153408 Ga0157379_101534082 427
138 3300014969 Ga0157376_10066727 Ga0157376_100667272 427
139 3300025263 Ga0209565_1000066 Ga0209565_100006695 427
140 3300025273 Ga0209673_1009466 Ga0209673_10094663 427
141 3300025284 Ga0209130_1013406 Ga0209130_10134062 427
142 3300025291 Ga0209675_1000084 Ga0209675_1000084107 427
143 3300025291 Ga0209675_1001045 Ga0209675_10010457 427
144 3300025291 Ga0209675_1001144 Ga0209675_100114411 427
145 3300025292 Ga0209676_1000014 Ga0209676_1000014402 427
146 3300025294 Ga0209025_1000437 Ga0209025_100043728 427
147 3300025294 Ga0209025_1002968 Ga0209025_10029683 427
148 3300025294 Ga0209025_1007624 Ga0209025_10076246 427
149 3300025295 Ga0209564_1000076 Ga0209564_100007644 427
150 3300025295 Ga0209564_1000539 Ga0209564_100053940 427
151 3300025295 Ga0209564_1000901 Ga0209564_10009018 427
152 3300025295 Ga0209564_1002826 Ga0209564_10028263 427
153 3300025297 Ga0209758_1014488 Ga0209758_10144882 427
154 3300025299 Ga0209256_1000083 Ga0209256_100008344 427
155 3300025299 Ga0209256_1000331 Ga0209256_100033170 427
156 3300025299 Ga0209256_1003371 Ga0209256_10033714 427
157 3300025944 Ga0207661_10026849 Ga0207661_100268492 427
158 3300026078 Ga0207702_10270463 Ga0207702_102704632 427
159 3300026142 Ga0207698_10009254 Ga0207698_100092545 427
160 3300048912 Ga0496109_0026669 Ga0496109_0026669_3176_4489 427
161 3300048924 Ga0496121_0078278 Ga0496121_0078278_1101_2414 427
162 3300048925 Ga0496122_0000021 Ga0496122_0000021_147452_148765 427
163 3300048926 Ga0496123_0000426 Ga0496123_0000426_71989_73302 427
164 3300048928 Ga0496125_0035263 Ga0496125_0035263_2422_3735 427
165 3300049571 Ga0501034_0001082 Ga0501034_0001082_28034_29344 427
166 iso_pu_bacteria 2739367655 2739611265 427
167 iso_pu_bacteria 2919704043 2919705212 427
168 iso_pu_bacteria 2932422444 2932425237 427
169 iso_pu_bacteria 2952252522 2952254468 427
170 3300050509 nmdc:mga0qj67_69416_c1 nmdc:mga0qj67_69416_c1_282_1589 428
171 iso_pu_bacteria 2547132374 2548501089 428
172 iso_pu_bacteria 2738543024 2739310730 428
173 iso_pu_bacteria 2883577096 2883578776 428
174 iso_pu_bacteria 2929199973 2929204246 428
175 iso_pu_bacteria 8055909800 8055915135 428
176 iso_pu_bacteria 8057160832 8057161304 428
177 3300031241 Ga0265325_10049134 Ga0265325_100491342 429
178 3300053093 Ga0500651_0003005 Ga0500651_0003005_4101_5420 429
179 3300053153 Ga0500616_0043752 Ga0500616_0043752_78_1385 429
180 iso_pu_bacteria 2597490356 2599106375 429
181 iso_pu_bacteria 2687453129 2687577544 429
182 iso_pu_bacteria 2846952575 2846956173 429
183 iso_pu_bacteria 2848858292 2848861806 429
184 iso_pu_bacteria 8048746797 8048747581 429
185 iso_pu_bacteria 8054002106 8054005434 429
186 3300005330 Ga0070690_100000381 Ga0070690_10000038110 430
187 3300005334 Ga0068869_100000209 Ga0068869_1000002097 430
188 3300005336 Ga0070680_100001700 Ga0070680_10000170010 430
189 3300005338 Ga0068868_100004126 Ga0068868_10000412613 430
190 3300005340 Ga0070689_100000287 Ga0070689_1000002875 430
191 3300005341 Ga0070691_10000369 Ga0070691_100003699 430
192 3300005343 Ga0070687_100000179 Ga0070687_1000001799 430
193 3300005354 Ga0070675_100074115 Ga0070675_1000741152 430
194 3300005438 Ga0070701_10001329 Ga0070701_1000132910 430
195 3300005440 Ga0070705_100000659 Ga0070705_1000006597 430
196 3300005444 Ga0070694_100000090 Ga0070694_10000009010 430
197 3300005459 Ga0068867_100000668 Ga0068867_1000006687 430
198 3300005536 Ga0070697_100231964 Ga0070697_1002319642 430
199 3300005539 Ga0068853_100027098 Ga0068853_1000270984 430
200 3300005544 Ga0070686_100000493 Ga0070686_10000049311 430
201 3300005545 Ga0070695_100000079 Ga0070695_10000007930 430
202 3300005546 Ga0070696_100000170 Ga0070696_10000017013 430
203 3300005547 Ga0070693_100000171 Ga0070693_10000017122 430
204 3300005549 Ga0070704_100000178 Ga0070704_10000017813 430
205 3300005563 Ga0068855_100001801 Ga0068855_10000180116 430
206 3300005615 Ga0070702_100000068 Ga0070702_1000000683 430
207 3300005617 Ga0068859_100000935 Ga0068859_10000093522 430
208 3300005718 Ga0068866_10000239 Ga0068866_100002397 430
209 3300005719 Ga0068861_100000070 Ga0068861_10000007022 430
210 3300005841 Ga0068863_100132645 Ga0068863_1001326453 430
211 3300005842 Ga0068858_100001685 Ga0068858_10000168510 430
212 3300005843 Ga0068860_100001743 Ga0068860_1000017437 430
213 3300005844 Ga0068862_100000975 Ga0068862_1000009753 430
214 3300006237 Ga0097621_100000468 Ga0097621_10000046826 430
215 3300006358 Ga0068871_100000188 Ga0068871_10000018831 430
216 3300006881 Ga0068865_100000242 Ga0068865_1000002427 430
217 3300006931 Ga0097620_100000935 Ga0097620_1000009357 430
218 3300009098 Ga0105245_10001199 Ga0105245_1000119910 430
219 3300009176 Ga0105242_10000161 Ga0105242_1000016130 430
220 3300009553 Ga0105249_10003947 Ga0105249_1000394716 430
221 3300013297 Ga0157378_10002026 Ga0157378_100020269 430
222 3300013306 Ga0163162_10077050 Ga0163162_100770504 430
223 3300014969 Ga0157376_10001329 Ga0157376_100013296 430
224 3300025899 Ga0207642_10000149 Ga0207642_1000014910 430
225 3300025901 Ga0207688_10008960 Ga0207688_100089605 430
226 3300025917 Ga0207660_10000833 Ga0207660_1000083310 430
227 3300025918 Ga0207662_10000064 Ga0207662_1000006410 430
228 3300025926 Ga0207659_10037982 Ga0207659_100379823 430
229 3300025927 Ga0207687_10000267 Ga0207687_1000026713 430
230 3300025934 Ga0207686_10007778 Ga0207686_100077785 430
231 3300025935 Ga0207709_10000473 Ga0207709_1000047326 430
232 3300025936 Ga0207670_10007868 Ga0207670_100078685 430
233 3300025938 Ga0207704_10005400 Ga0207704_100054005 430
234 3300025942 Ga0207689_10000200 Ga0207689_1000020032 430
235 3300025949 Ga0207667_10083861 Ga0207667_100838612 430
236 3300025961 Ga0207712_10001270 Ga0207712_100012702 430
237 3300026023 Ga0207677_10001218 Ga0207677_100012184 430
238 3300026035 Ga0207703_10001427 Ga0207703_100014272 430
239 3300026041 Ga0207639_10011699 Ga0207639_100116994 430
240 3300026075 Ga0207708_10001252 Ga0207708_1000125211 430
241 3300026088 Ga0207641_10160368 Ga0207641_101603682 430
242 3300026089 Ga0207648_10000309 Ga0207648_1000030933 430
243 3300026118 Ga0207675_100000089 Ga0207675_10000008933 430
244 3300028380 Ga0268265_10006139 Ga0268265_100061395 430
245 3300028381 Ga0268264_10001651 Ga0268264_1000165123 430
246 iso_pu_bacteria 2643221733 2644731558 430
247 iso_pu_bacteria 2643221734 2644738079 430
248 iso_pu_bacteria 2818991467 2819718062 430
249 iso_pu_bacteria 2837651117 2837654502 430
250 iso_pu_bacteria 2904479285 2904482158 430
251 iso_pu_bacteria 8057529695 8057535614 430
252 3300005289 Ga0065704_10073866 Ga0065704_100738665 431
253 3300005334 Ga0068869_100041063 Ga0068869_1000410633 431
254 3300005366 Ga0070659_100008351 Ga0070659_1000083514 431
255 3300005719 Ga0068861_100004400 Ga0068861_1000044004 431
256 3300025901 Ga0207688_10093060 Ga0207688_100930603 431
257 3300025926 Ga0207659_10023895 Ga0207659_100238953 431
258 3300025932 Ga0207690_10022184 Ga0207690_100221844 431
259 3300025933 Ga0207706_10100019 Ga0207706_101000193 431
260 3300025942 Ga0207689_10024677 Ga0207689_100246772 431
261 3300025949 Ga0207667_10152804 Ga0207667_101528043 431
262 3300026118 Ga0207675_100013279 Ga0207675_1000132793 431
263 3300035398 Ga0316574_0002220 Ga0316574_0002220_6072_7367 431
264 3300046539 Ga0495621_0029282 Ga0495621_0029282_158_1468 431
265 3300048913 Ga0496110_0224921 Ga0496110_0224921_141_1454 431
266 3300048928 Ga0496125_0005318 Ga0496125_0005318_5128_6423 431
267 3300048928 Ga0496125_0013064 Ga0496125_0013064_2760_4055 431
268 3300053119 Ga0500595_000024 Ga0500595_000024_137310_138629 431
269 iso_pu_bacteria 2513237150 2513956862 431
270 iso_pu_bacteria 2513237165 2514043394 431
271 iso_pu_bacteria 2513237351 2514590727 431
272 iso_pu_bacteria 2643221611 2644076339 431
273 iso_pu_bacteria 2837678835 2837679047 431
274 iso_pu_bacteria 2881927736 2881928497 431
275 iso_pu_bacteria 2901300506 2901304241 431
276 iso_pu_bacteria 644736347 644747752 431
277 iso_pu_bacteria 8045864390 8045868553 431
278 iso_pu_bacteria 8054563764 8054567056 431
279 3300032004 Ga0307414_10198015 Ga0307414_101980151 432
280 iso_pu_bacteria 2547132374 2548500918 432
281 iso_pu_bacteria 2842718218 2842719663 432
282 iso_pu_bacteria 2885192300 2885193377 432
283 iso_pu_bacteria 2889790730 2889794463 432
284 3300049822 Ga0501035_0246934 Ga0501035_0246934_185_1489 433
285 3300005518 Ga0070699_100094440 Ga0070699_1000944402 434
286 3300031548 Ga0307408_100000195 Ga0307408_10000019536 434
287 3300031911 Ga0307412_10000647 Ga0307412_1000064712 434
288 3300044712 Ga0453684_0198562 Ga0453684_0198562_473_1777 434
289 3300003215 JGI25153J46596_10005666 JGI25153J46596_100056665 435
290 3300005985 Ga0081539_10020902 Ga0081539_100209024 435
291 3300006941 Ga0099825_1020999 Ga0099825_10209994 435
292 3300009177 Ga0105248_10244923 Ga0105248_102449232 435
293 3300005328 Ga0070676_10026739 Ga0070676_100267392 436
294 3300005329 Ga0070683_100047706 Ga0070683_1000477063 436
295 3300005535 Ga0070684_100042848 Ga0070684_1000428484 436
296 3300039062 Ga0400483_026403 Ga0400483_026403_414_1727 436
297 3300049575 Ga0501039_0189858 Ga0501039_0189858_54_1373 436
298 3300002774 JGI25150J39212_1001147 JGI25150J39212_10011473 437
299 3300003781 Ga0055536_1001522 Ga0055536_100152211 437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

5

457

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.923 1 437
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.9209 1 437
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.9054 9 432
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8724 9 432
4f35-assembly2.cif.gz_B crystal structure of a bacterial dicarboxylate/sodium symporter 0.7278 1 421
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6914 7 417 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6813 7 417 1.20.1530.20
af_X1WE62_46_437_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3012 63 250 1.20.1070.10
af_Q57875_1_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2933 47 258 1.20.1250.20
af_Q2FVK7_9_206_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.2838 96 277 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A7V5R4Z9-F1-model_v4 TRAP transporter large permease subunit 0.9803 3 339 GO:0005886
GO:0022857
AF-A0A7X8K2V9-F1-model_v4 TRAP transporter large permease 0.9718 11 435 GO:0005886
GO:0022857
AF-A0A7C4SD77-F1-model_v4 TRAP transporter large permease subunit 0.9717 4 433 GO:0005886
GO:0022857
AF-A0A2N5I257-F1-model_v4 TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein 0.9694 4 430 GO:0005886
GO:0022857
AF-A0A352Z624-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.968 7 432 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
82.11 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map