F395004

General Info

Members Datasets Scaffolds Average Seq Length
299 204 289 317

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0000294|Ga0495669_0000294_12521_13573
Length 350
Sequence MLKFVPAPALARKPELWRLDPETQAADLGAMTVVIDTLGGAGRPRHPEKQGRPDTPLLRKPEWLRVRAPGSPGYAATKAIVKEHGLVTVCEEAACPNIGECWTQSHATMMIMGDVCTRACAFCNVATGLPGPLDPTEPVRVADAVAKMGLKHVVITSVDRDDLPDGGAEHFAQVVRAIRVAAPGTTIEILTPDFLRKAGAAEVVIESKPDVFNHNLETVPRLYLSIRPGARYYHSLRLLERVKEQDPVQFTKSGVMVGLGEAKEEVMQVMDDMRSAGVDFITIGQYLQPTRKHAPIDRFVTPDEFRAYEEIARAKGFLMVASSPLTRSSHHAGEDFARLQAARRAKDSAA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2842694124 Methylopila sp. R-72369 Isolate Unclassified
6 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
7 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
8 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
9 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
10 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 0
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0
Rhizoplane 2.34
Rhizosphere 81.27
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021354 3300001979 Bacteria 2246
2 Ga0055524_1021494 3300003775 Bacteria 2135
3 Ga0065712_10070766 3300005290 Bacteria 5727
4 Ga0065712_10078550 3300005290 Bacteria 3331
5 Ga0070658_10150849 3300005327 Bacteria 1946
6 Ga0070670_100032414 3300005331 Bacteria 4501
7 Ga0070680_100098401 3300005336 Bacteria 2426
8 Ga0070680_100236474 3300005336 Bacteria 1543
9 Ga0070691_10000580 3300005341 Bacteria 14004
10 Ga0070668_100010260 3300005347 Bacteria 6952
11 Ga0070668_100010392 3300005347 Bacteria 6916
12 Ga0070668_100098112 3300005347 Bacteria 2318
13 Ga0070669_100031889 3300005353 Bacteria 3807
14 Ga0070669_100321118 3300005353 Bacteria 1250
15 Ga0070671_100012757 3300005355 Bacteria 6776
16 Ga0070671_100072617 3300005355 Bacteria 2874
17 Ga0070674_100004826 3300005356 Bacteria 7726
18 Ga0070659_100000206 3300005366 Bacteria 45867
19 Ga0070659_100004222 3300005366 Bacteria 10260
20 Ga0070709_10304635 3300005434 Bacteria 1165
21 Ga0070710_10114146 3300005437 Bacteria 1626
22 Ga0070708_100000008 3300005445 Bacteria 146021
23 Ga0070708_100017843 3300005445 Bacteria 5929
24 Ga0070681_10016924 3300005458 Bacteria 7284
25 Ga0070681_10051870 3300005458 Bacteria 4091
26 Ga0070706_100000160 3300005467 Bacteria 85799
27 Ga0070706_100000372 3300005467 Bacteria 53887
28 Ga0070707_100000004 3300005468 Bacteria 265003
29 Ga0070707_100000566 3300005468 Bacteria 37191
30 Ga0070698_100173288 3300005471 Bacteria 2098
31 Ga0070698_100475322 3300005471 Bacteria 1186
32 Ga0070699_100000006 3300005518 Bacteria 363492
33 Ga0070699_100000084 3300005518 Bacteria 89070
34 Ga0070699_100159620 3300005518 Bacteria 1995
35 Ga0070679_100449814 3300005530 Bacteria 1233
36 Ga0070684_100031522 3300005535 Bacteria 4514
37 Ga0070697_100145032 3300005536 Bacteria 1998
38 Ga0068853_100012010 3300005539 Bacteria 7044
39 Ga0068853_100012248 3300005539 Bacteria 6974
40 Ga0070665_100000116 3300005548 Bacteria 150141
41 Ga0070704_100001432 3300005549 Bacteria 12748
42 Ga0068855_100021204 3300005563 Bacteria 7790
43 Ga0068855_100025315 3300005563 Bacteria 7101
44 Ga0068855_100604117 3300005563 Bacteria 1183
45 Ga0070664_100116142 3300005564 Bacteria 2340
46 Ga0068857_100008808 3300005577 Bacteria 8737
47 Ga0068857_100042032 3300005577 Bacteria 4053
48 Ga0068854_100026764 3300005578 Bacteria 3967
49 Ga0068856_100017571 3300005614 Bacteria 6931
50 Ga0068856_100332341 3300005614 Bacteria 1537
51 Ga0068852_100020749 3300005616 Bacteria 5228
52 Ga0068864_100011680 3300005618 Bacteria 7250
53 Ga0068851_10001023 3300005834 Bacteria 12145
54 Ga0068863_100017150 3300005841 Bacteria 6946
55 Ga0068863_100029789 3300005841 Bacteria 5212
56 Ga0068863_100048438 3300005841 Bacteria 4030
57 Ga0068860_100000145 3300005843 Bacteria 115830
58 Ga0068860_100005851 3300005843 Bacteria 12380
59 Ga0068862_100026812 3300005844 Bacteria 4846
60 Ga0068862_100035830 3300005844 Bacteria 4204
61 Ga0068862_100044379 3300005844 Bacteria 3791
62 Ga0081538_10004974 3300005981 Bacteria 12105
63 Ga0070717_10000043 3300006028 Bacteria 109696
64 Ga0075363_100106539 3300006048 Bacteria 1555
65 Ga0075364_10181672 3300006051 Bacteria 1424
66 Ga0070712_100157108 3300006175 Bacteria 1752
67 Ga0075362_10001151 3300006177 Bacteria 8267
68 Ga0075369_10007154 3300006186 Bacteria 4240
69 Ga0075370_10243010 3300006353 Bacteria 1066
70 Ga0075430_100147872 3300006846 Bacteria 1957
71 Ga0075431_100012229 3300006847 Bacteria 8665
72 Ga0075431_100177859 3300006847 Bacteria 2184
73 Ga0075433_10020565 3300006852 Bacteria 5522
74 Ga0075434_100084225 3300006871 Bacteria 3178
75 Ga0075429_100018062 3300006880 Bacteria 6101
76 Ga0068865_100004207 3300006881 Bacteria 8672
77 Ga0068865_100079557 3300006881 Bacteria 2348
78 Ga0075436_100006664 3300006914 Bacteria 7910
79 Ga0075435_100011824 3300007076 Bacteria 6443
80 Ga0075435_100558766 3300007076 Bacteria 991
81 Ga0105240_10009914 3300009093 Bacteria 13434
82 Ga0105240_10028781 3300009093 Bacteria 7248
83 Ga0105240_10252947 3300009093 Bacteria 2037
84 Ga0114129_10017292 3300009147 Bacteria 10271
85 Ga0114129_10610040 3300009147 Bacteria 1413
86 Ga0105248_10000154 3300009177 Bacteria 80081
87 Ga0105248_10107115 3300009177 Bacteria 3152
88 Ga0105238_10000072 3300009551 Bacteria 112436
89 Ga0105238_10021668 3300009551 Bacteria 6547
90 Ga0105238_10149578 3300009551 Bacteria 2310
91 Ga0105249_10311110 3300009553 Bacteria 1583
92 Ga0105239_10013880 3300010375 Bacteria 8940
93 Ga0105239_10442001 3300010375 Bacteria 1475
94 Ga0105246_10001758 3300011119 Bacteria 12961
95 Ga0213876_10000108 3300021384 Bacteria 91222
96 Ga0209026_1002404 3300025250 Bacteria 7057
97 Ga0209026_1010061 3300025250 Bacteria 1794
98 Ga0209233_1000937 3300025261 Bacteria 12666
99 Ga0209676_1000057 3300025292 Bacteria 361061
100 Ga0209676_1001335 3300025292 Bacteria 24868
101 Ga0209050_1001221 3300025298 Bacteria 29961
102 Ga0209256_1002873 3300025299 Bacteria 13085
103 Ga0209051_1007128 3300025303 Bacteria 6167
104 Ga0209257_1001883 3300025304 Bacteria 22693
105 Ga0207699_10070823 3300025906 Bacteria 2130
106 Ga0207705_10002109 3300025909 Bacteria 15460
107 Ga0207705_10062655 3300025909 Bacteria 2686
108 Ga0207684_10000014 3300025910 Bacteria 440027
109 Ga0207684_10000034 3300025910 Bacteria 291009
110 Ga0207654_10001364 3300025911 Bacteria 12968
111 Ga0207695_10001670 3300025913 Bacteria 35733
112 Ga0207695_10001727 3300025913 Bacteria 34901
113 Ga0207695_10017258 3300025913 Bacteria 8405
114 Ga0207695_10045033 3300025913 Bacteria 4687
115 Ga0207695_10088226 3300025913 Bacteria 3123
116 Ga0207671_10154862 3300025914 Bacteria 1772
117 Ga0207660_10006636 3300025917 Bacteria 7504
118 Ga0207657_10007960 3300025919 Bacteria 10808
119 Ga0207652_10012704 3300025921 Bacteria 6810
120 Ga0207646_10000018 3300025922 Bacteria 291009
121 Ga0207646_10000524 3300025922 Bacteria 51084
122 Ga0207646_10073488 3300025922 Bacteria 3054
123 Ga0207694_10000504 3300025924 Bacteria 35370
124 Ga0207694_10002233 3300025924 Bacteria 15888
125 Ga0207694_10054899 3300025924 Bacteria 3092
126 Ga0207650_10233012 3300025925 Bacteria 1486
127 Ga0207644_10017521 3300025931 Bacteria 4839
128 Ga0207690_10000129 3300025932 Bacteria 62350
129 Ga0207690_10035123 3300025932 Bacteria 3235
130 Ga0207709_10395563 3300025935 Bacteria 1055
131 Ga0207704_10000836 3300025938 Bacteria 13639
132 Ga0207711_10000887 3300025941 Bacteria 28843
133 Ga0207667_10012057 3300025949 Bacteria 9997
134 Ga0207667_10019640 3300025949 Bacteria 7536
135 Ga0207667_10045788 3300025949 Bacteria 4632
136 Ga0207651_10010453 3300025960 Bacteria 5146
137 Ga0207668_10020100 3300025972 Bacteria 4235
138 Ga0207668_10199769 3300025972 Bacteria 1591
139 Ga0207640_10156569 3300025981 Bacteria 1680
140 Ga0207639_10034375 3300026041 Bacteria 3746
141 Ga0207678_10121787 3300026067 Bacteria 2226
142 Ga0207702_10000093 3300026078 Bacteria 103678
143 Ga0207702_10411483 3300026078 Bacteria 1306
144 Ga0207641_10041949 3300026088 Bacteria 3837
145 Ga0207676_10213245 3300026095 Bacteria 1714
146 Ga0207683_10166835 3300026121 Bacteria 1992
147 Ga0207698_10026177 3300026142 Bacteria 4124
148 Ga0268266_10000064 3300028379 Bacteria 249533
149 Ga0268266_10152215 3300028379 Bacteria 2086
150 Ga0268265_10001646 3300028380 Bacteria 18291
151 Ga0268265_10128528 3300028380 Bacteria 2101
152 Ga0268265_10136030 3300028380 Bacteria 2050
153 Ga0268264_10000046 3300028381 Bacteria 364597
154 Ga0265334_10013640 3300028573 Bacteria 3401
155 Ga0307517_10000497 3300028786 Bacteria 67390
156 Ga0307515_10047013 3300028794 Bacteria 6578
157 Ga0265338_10009737 3300028800 Bacteria 11403
158 Ga0265338_10018621 3300028800 Bacteria 7420
159 Ga0265338_10047121 3300028800 Bacteria 3941
160 Ga0307511_10045869 3300030521 Bacteria 3605
161 Ga0265339_10085501 3300031249 Bacteria 1660
162 Ga0265327_10000166 3300031251 Bacteria 141539
163 Ga0265327_10005314 3300031251 Bacteria 10799
164 Ga0265327_10007283 3300031251 Bacteria 8581
165 Ga0265327_10011393 3300031251 Bacteria 6127
166 Ga0307513_10000181 3300031456 Bacteria 91264
167 Ga0307513_10011115 3300031456 Bacteria 11221
168 Ga0265313_10001659 3300031595 Bacteria 20615
169 Ga0265314_10023705 3300031711 Bacteria 4672
170 Ga0307516_10000004 3300031730 Bacteria 367451
171 Ga0307412_10266754 3300031911 Bacteria 1338
172 Ga0307411_10050488 3300032005 Bacteria 2709
173 Ga0373936_0019429 3300035113 Bacteria 2633
174 Ga0373939_0005567 3300035114 Bacteria 3001
175 Ga0316574_0156210 3300035398 Bacteria 1470
176 Ga0373937_0013600 3300036401 Bacteria 7171
177 Ga0373937_0127051 3300036401 Bacteria 2379
178 Ga0316584_0164134 3300036712 Bacteria 1649
179 Ga0373925_0000478 3300037068 Bacteria 39975
180 Ga0395899_0000213 3300037312 Bacteria 83403
181 Ga0395900_0000121 3300037418 Bacteria 135026
182 Ga0395900_0025375 3300037418 Bacteria 6068
183 Ga0395898_0000247 3300037466 Bacteria 135026
184 Ga0395905_0000112 3300037471 Bacteria 135010
185 Ga0436364_1317670 3300037853 Bacteria 2660
186 Ga0395901_0000078 3300038443 Bacteria 135026
187 Ga0395901_0090200 3300038443 Bacteria 3208
188 Ga0436365_1544656 3300039437 Bacteria 122419
189 Ga0436360_1124904 3300039438 Bacteria 1481
190 Ga0436361_0196619 3300039447 Bacteria 31824
191 Ga0436363_0732235 3300039450 Bacteria 4075
192 Ga0436363_1115256 3300039450 Bacteria 1371
193 Ga0495592_0083857 3300046454 Bacteria 2301
194 Ga0495603_0042519 3300046455 Bacteria 2716
195 Ga0495638_0000260 3300046460 Bacteria 71071
196 Ga0495583_0015880 3300046506 Bacteria 4074
197 Ga0495628_0051940 3300046516 Bacteria 3239
198 Ga0495630_0065851 3300046517 Bacteria 2723
199 Ga0495645_0033156 3300046543 Bacteria 3767
200 Ga0495622_0005503 3300046557 Bacteria 5875
201 Ga0495668_0000345 3300046616 Bacteria 61921
202 Ga0495611_0040954 3300046648 Bacteria 2066
203 Ga0495625_0000342 3300046660 Bacteria 71332
204 Ga0495625_0119778 3300046660 Bacteria 1792
205 Ga0495658_0042603 3300046683 Bacteria 2535
206 Ga0495658_0160299 3300046683 Bacteria 1387
207 Ga0495669_0000024 3300046684 Bacteria 113943
208 Ga0495669_0000294 3300046684 Bacteria 28302
209 Ga0495613_0032453 3300046689 Bacteria 3880
210 Ga0495649_0058285 3300046694 Bacteria 2081
211 Ga0495672_0014263 3300047320 Bacteria 5450
212 Ga0495672_0028221 3300047320 Bacteria 3553
213 Ga0495675_0164140 3300047444 Bacteria 1367
214 Ga0495677_0055591 3300047445 Bacteria 1461
215 Ga0495686_0091881 3300047472 Bacteria 1842
216 Ga0496106_0317901 3300048909 Bacteria 1250
217 Ga0496108_0070755 3300048911 Bacteria 2944
218 Ga0496109_0005745 3300048912 Bacteria 10382
219 Ga0496112_0070748 3300048915 Bacteria 3448
220 Ga0496112_0089451 3300048915 Bacteria 3047
221 Ga0496112_0463603 3300048915 Bacteria 1204
222 Ga0496115_0029381 3300048918 Bacteria 4317
223 Ga0496124_0015953 3300048927 Bacteria 7170
224 Ga0496125_0096951 3300048928 Bacteria 2187
225 Ga0501032_0000064 3300049569 Bacteria 91971
226 Ga0501032_0002338 3300049569 Bacteria 14870
227 Ga0501033_0000286 3300049570 Bacteria 48628
228 Ga0501033_0007597 3300049570 Bacteria 8429
229 Ga0501033_0163235 3300049570 Bacteria 1603
230 Ga0501034_0000174 3300049571 Bacteria 119615
231 Ga0501034_0021300 3300049571 Bacteria 6609
232 Ga0501034_0089453 3300049571 Bacteria 3077
233 Ga0501034_0150148 3300049571 Bacteria 2306
234 Ga0501036_0011420 3300049572 Bacteria 7352
235 Ga0501037_0000147 3300049573 Bacteria 65415
236 Ga0501037_0009152 3300049573 Bacteria 7255
237 Ga0501038_0000031 3300049574 Bacteria 132231
238 Ga0501039_0000057 3300049575 Bacteria 89756
239 Ga0501043_0000048 3300049579 Bacteria 109146
240 Ga0501046_0216928 3300049580 Bacteria 1418
241 Ga0501047_0116815 3300049581 Bacteria 2549
242 Ga0501047_0328026 3300049581 Bacteria 1369
243 Ga0501068_0205406 3300049584 Bacteria 1250
244 Ga0501069_0000018 3300049585 Bacteria 133550
245 Ga0501069_0079075 3300049585 Bacteria 1850
246 Ga0501070_0000048 3300049586 Bacteria 105951
247 Ga0501070_0245726 3300049586 Bacteria 1464
248 Ga0501073_0057847 3300049589 Bacteria 2710
249 Ga0501073_0073794 3300049589 Bacteria 2375
250 Ga0501074_0000001 3300049590 Bacteria 123588
251 Ga0501080_0000197 3300049742 Bacteria 44169
252 Ga0501080_0137934 3300049742 Bacteria 2256
253 Ga0501083_0005530 3300049744 Bacteria 8955
254 Ga0501083_0008221 3300049744 Bacteria 7377
255 Ga0501035_0000048 3300049822 Bacteria 146466
256 Ga0501035_0004746 3300049822 Bacteria 12904
257 Ga0501035_0130236 3300049822 Bacteria 2194
258 Ga0501044_0000003 3300049823 Bacteria 345647
259 Ga0501044_0010560 3300049823 Bacteria 10015
260 Ga0501044_0181045 3300049823 Bacteria 2074
261 nmdc:mga03683_3737_c1 3300050489 Bacteria 4963
262 nmdc:mga03n38_145412_c1 3300050490 Bacteria 1188
263 nmdc:mga05p37_13216_c2 3300050507 Bacteria 9030
264 nmdc:mga05p37_281594_c1 3300050507 Bacteria 1982
265 nmdc:mga05p37_65540_c1 3300050507 Bacteria 4469
266 nmdc:mga09592_144194_c1 3300050508 Bacteria 2053
267 nmdc:mga06r32_67936_c1 3300050510 Bacteria 3442
268 nmdc:mga08y16_258484_c1 3300050511 Bacteria 1799
269 nmdc:mga08y16_71113_c1 3300050511 Bacteria 3626
270 nmdc:mga0n895_161145_c1 3300050512 Bacteria 2275
271 nmdc:mga0n895_80240_c1 3300050512 Bacteria 3251
272 nmdc:mga0rr50_181720_c1 3300050513 Bacteria 1720
273 nmdc:mga08x19_55883_c1 3300050514 Bacteria 2546
274 nmdc:mga0a205_111557_c1 3300050515 Bacteria 2634
275 nmdc:mga0a205_90176_c1 3300050515 Bacteria 2962
276 nmdc:mga0sz30_16976_c1 3300050516 Bacteria 2898
277 Ga0500635_0008546 3300053080 Bacteria 2811
278 Ga0500555_058514 3300053103 Bacteria 1041
279 Ga0500556_0000552 3300053104 Bacteria 25172
280 Ga0500562_000288 3300053108 Bacteria 12326
281 Ga0500562_001429 3300053108 Bacteria 5875
282 Ga0500595_005331 3300053119 Bacteria 5627
283 Ga0500595_022099 3300053119 Bacteria 2258
284 Ga0500595_025298 3300053119 Bacteria 2060
285 Ga0500608_000025 3300053122 Bacteria 71403
286 Ga0500559_0001640 3300053136 Bacteria 12400
287 Ga0500622_0005488 3300053156 Bacteria 7610
288 Ga0500637_0050963 3300053178 Bacteria 2359
289 Ga0501082_0003165 3300060353 Bacteria 14346

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100000008 Ga0070708_10000000891 278
2 3300005467 Ga0070706_100000160 Ga0070706_10000016036 278
3 3300005518 Ga0070699_100000084 Ga0070699_10000008439 278
4 3300005518 Ga0070699_100159620 Ga0070699_1001596202 278
5 3300050511 nmdc:mga08y16_71113_c1 nmdc:mga08y16_71113_c1_10_858 282
6 3300007076 Ga0075435_100011824 Ga0075435_1000118242 289
7 3300050513 nmdc:mga0rr50_181720_c1 nmdc:mga0rr50_181720_c1_522_1394 289
8 3300006871 Ga0075434_100084225 Ga0075434_1000842253 290
9 3300006914 Ga0075436_100006664 Ga0075436_1000066642 290
10 3300050512 nmdc:mga0n895_80240_c1 nmdc:mga0n895_80240_c1_2079_2954 290
11 3300050514 nmdc:mga08x19_55883_c1 nmdc:mga08x19_55883_c1_808_1683 290
12 3300050515 nmdc:mga0a205_111557_c1 nmdc:mga0a205_111557_c1_1557_2432 290
13 3300049581 Ga0501047_0328026 Ga0501047_0328026_452_1351 292
14 3300050490 nmdc:mga03n38_145412_c1 nmdc:mga03n38_145412_c1_21_902 292
15 3300053103 Ga0500555_058514 Ga0500555_058514_82_975 292
16 3300005471 Ga0070698_100173288 Ga0070698_1001732881 294
17 3300005536 Ga0070697_100145032 Ga0070697_1001450322 294
18 3300025922 Ga0207646_10000524 Ga0207646_1000052423 294
19 3300005518 Ga0070699_100000006 Ga0070699_100000006316 296
20 3300005468 Ga0070707_100000004 Ga0070707_100000004206 297
21 3300005549 Ga0070704_100001432 Ga0070704_1000014323 297
22 3300006028 Ga0070717_10000043 Ga0070717_10000043123 297
23 3300006852 Ga0075433_10020565 Ga0075433_100205655 297
24 3300007076 Ga0075435_100558766 Ga0075435_1005587661 297
25 3300025910 Ga0207684_10000034 Ga0207684_10000034238 297
26 3300025922 Ga0207646_10000018 Ga0207646_10000018238 297
27 3300050507 nmdc:mga05p37_281594_c1 nmdc:mga05p37_281594_c1_361_1257 297
28 3300050512 nmdc:mga0n895_161145_c1 nmdc:mga0n895_161145_c1_664_1560 297
29 3300005445 Ga0070708_100017843 Ga0070708_1000178433 298
30 3300005467 Ga0070706_100000372 Ga0070706_10000037223 298
31 3300005468 Ga0070707_100000566 Ga0070707_10000056620 298
32 3300005471 Ga0070698_100475322 Ga0070698_1004753222 298
33 3300025910 Ga0207684_10000014 Ga0207684_10000014327 298
34 3300025922 Ga0207646_10073488 Ga0207646_100734883 298
35 3300049742 Ga0501080_0137934 Ga0501080_0137934_348_1247 298
36 3300009553 Ga0105249_10311110 Ga0105249_103111103 300
37 3300009093 Ga0105240_10252947 Ga0105240_102529474 301
38 3300009551 Ga0105238_10000072 Ga0105238_100000729 301
39 3300025924 Ga0207694_10002233 Ga0207694_100022335 301
40 3300036712 Ga0316584_0164134 Ga0316584_0164134_263_1180 301
41 3300031251 Ga0265327_10005314 Ga0265327_100053144 302
42 3300053104 Ga0500556_0000552 Ga0500556_0000552_8907_9821 304
43 3300005327 Ga0070658_10150849 Ga0070658_101508492 308
44 3300046683 Ga0495658_0042603 Ga0495658_0042603_1590_2519 309
45 3300005353 Ga0070669_100321118 Ga0070669_1003211182 311
46 3300005356 Ga0070674_100004826 Ga0070674_1000048269 311
47 3300005844 Ga0068862_100026812 Ga0068862_1000268128 311
48 3300005981 Ga0081538_10004974 Ga0081538_100049749 311
49 3300006881 Ga0068865_100079557 Ga0068865_1000795573 311
50 3300025935 Ga0207709_10395563 Ga0207709_103955631 311
51 3300028380 Ga0268265_10136030 Ga0268265_101360303 311
52 3300046683 Ga0495658_0160299 Ga0495658_0160299_93_1031 311
53 3300028800 Ga0265338_10047121 Ga0265338_100471213 312
54 3300049571 Ga0501034_0021300 Ga0501034_0021300_943_1881 312
55 3300005347 Ga0070668_100098112 Ga0070668_1000981123 313
56 3300031911 Ga0307412_10266754 Ga0307412_102667542 313
57 3300047472 Ga0495686_0091881 Ga0495686_0091881_37_981 313
58 iso_pu_bacteria 2643221598 2644000224 313
59 iso_pu_bacteria 2643221614 2644085014 313
60 iso_pu_bacteria 2643221661 2644342566 313
61 iso_pu_bacteria 2643221666 2644365866 313
62 3300006847 Ga0075431_100012229 Ga0075431_1000122297 314
63 3300006880 Ga0075429_100018062 Ga0075429_1000180624 314
64 3300009147 Ga0114129_10017292 Ga0114129_100172923 314
65 3300025261 Ga0209233_1000937 Ga0209233_10009376 314
66 3300028573 Ga0265334_10013640 Ga0265334_100136403 314
67 3300028800 Ga0265338_10018621 Ga0265338_100186215 314
68 3300031711 Ga0265314_10023705 Ga0265314_100237052 314
69 3300046517 Ga0495630_0065851 Ga0495630_0065851_1697_2680 314
70 3300050507 nmdc:mga05p37_13216_c2 nmdc:mga05p37_13216_c2_4159_5103 314
71 3300050508 nmdc:mga09592_144194_c1 nmdc:mga09592_144194_c1_451_1395 314
72 3300050510 nmdc:mga06r32_67936_c1 nmdc:mga06r32_67936_c1_447_1391 314
73 3300053108 Ga0500562_000288 Ga0500562_000288_10689_11639 314
74 iso_pu_bacteria 2842694124 2842694225 314
75 iso_pu_bacteria 2917554339 2917555531 314
76 3300005290 Ga0065712_10078550 Ga0065712_100785504 315
77 3300005336 Ga0070680_100098401 Ga0070680_1000984012 315
78 3300005437 Ga0070710_10114146 Ga0070710_101141461 315
79 3300005530 Ga0070679_100449814 Ga0070679_1004498141 315
80 3300005535 Ga0070684_100031522 Ga0070684_1000315222 315
81 3300005563 Ga0068855_100604117 Ga0068855_1006041172 315
82 3300006175 Ga0070712_100157108 Ga0070712_1001571082 315
83 3300009147 Ga0114129_10610040 Ga0114129_106100402 315
84 3300031249 Ga0265339_10085501 Ga0265339_100855012 315
85 3300031595 Ga0265313_10001659 Ga0265313_100016595 315
86 3300035114 Ga0373939_0005567 Ga0373939_0005567_19_981 315
87 3300035398 Ga0316574_0156210 Ga0316574_0156210_179_1150 315
88 3300039447 Ga0436361_0196619 Ga0436361_0196619_1977_2930 315
89 3300046455 Ga0495603_0042519 Ga0495603_0042519_1514_2476 315
90 3300046557 Ga0495622_0005503 Ga0495622_0005503_2885_3847 315
91 3300046694 Ga0495649_0058285 Ga0495649_0058285_667_1629 315
92 3300048915 Ga0496112_0463603 Ga0496112_0463603_75_1022 315
93 3300053080 Ga0500635_0008546 Ga0500635_0008546_990_1952 315
94 3300053178 Ga0500637_0050963 Ga0500637_0050963_686_1648 315
95 iso_pu_bacteria 2884960567 2884964999 315
96 iso_pu_bacteria 2919450847 2919451230 315
97 iso_pu_bacteria 2939669807 2939670880 315
98 3300005290 Ga0065712_10070766 Ga0065712_100707662 316
99 3300005434 Ga0070709_10304635 Ga0070709_103046351 316
100 3300005564 Ga0070664_100116142 Ga0070664_1001161422 316
101 3300005614 Ga0068856_100332341 Ga0068856_1003323412 316
102 3300006048 Ga0075363_100106539 Ga0075363_1001065392 316
103 3300006177 Ga0075362_10001151 Ga0075362_100011515 316
104 3300006353 Ga0075370_10243010 Ga0075370_102430101 316
105 3300009177 Ga0105248_10107115 Ga0105248_101071152 316
106 3300009551 Ga0105238_10149578 Ga0105238_101495782 316
107 3300021384 Ga0213876_10000108 Ga0213876_1000010835 316
108 3300025906 Ga0207699_10070823 Ga0207699_100708232 316
109 3300025913 Ga0207695_10088226 Ga0207695_100882264 316
110 3300026078 Ga0207702_10411483 Ga0207702_104114831 316
111 3300030521 Ga0307511_10045869 Ga0307511_100458692 316
112 3300031456 Ga0307513_10000181 Ga0307513_100001816 316
113 3300039437 Ga0436365_1544656 Ga0436365_1544656_71904_72854 316
114 3300039438 Ga0436360_1124904 Ga0436360_1124904_388_1350 316
115 3300039450 Ga0436363_0732235 Ga0436363_0732235_2976_3926 316
116 3300046684 Ga0495669_0000024 Ga0495669_0000024_5949_6908 316
117 3300048909 Ga0496106_0317901 Ga0496106_0317901_118_1068 316
118 3300049581 Ga0501047_0116815 Ga0501047_0116815_986_1960 316
119 3300050489 nmdc:mga03683_3737_c1 nmdc:mga03683_3737_c1_2887_3837 316
120 3300050515 nmdc:mga0a205_90176_c1 nmdc:mga0a205_90176_c1_1002_1952 316
121 3300053108 Ga0500562_001429 Ga0500562_001429_2746_3705 316
122 3300053119 Ga0500595_022099 Ga0500595_022099_797_1753 316
123 3300005331 Ga0070670_100032414 Ga0070670_1000324144 317
124 3300005347 Ga0070668_100010260 Ga0070668_1000102605 317
125 3300005347 Ga0070668_100010392 Ga0070668_1000103926 317
126 3300005353 Ga0070669_100031889 Ga0070669_1000318892 317
127 3300005355 Ga0070671_100012757 Ga0070671_1000127575 317
128 3300005355 Ga0070671_100072617 Ga0070671_1000726172 317
129 3300005618 Ga0068864_100011680 Ga0068864_1000116802 317
130 3300005841 Ga0068863_100017150 Ga0068863_1000171506 317
131 3300005841 Ga0068863_100029789 Ga0068863_1000297892 317
132 3300005841 Ga0068863_100048438 Ga0068863_1000484383 317
133 3300005843 Ga0068860_100000145 Ga0068860_10000014575 317
134 3300005843 Ga0068860_100005851 Ga0068860_1000058519 317
135 3300005844 Ga0068862_100035830 Ga0068862_1000358304 317
136 3300005844 Ga0068862_100044379 Ga0068862_1000443793 317
137 3300006051 Ga0075364_10181672 Ga0075364_101816722 317
138 3300006846 Ga0075430_100147872 Ga0075430_1001478722 317
139 3300006847 Ga0075431_100177859 Ga0075431_1001778593 317
140 3300009093 Ga0105240_10009914 Ga0105240_100099143 317
141 3300010375 Ga0105239_10013880 Ga0105239_100138804 317
142 3300011119 Ga0105246_10001758 Ga0105246_100017584 317
143 3300025250 Ga0209026_1002404 Ga0209026_10024046 317
144 3300025250 Ga0209026_1010061 Ga0209026_10100612 317
145 3300025925 Ga0207650_10233012 Ga0207650_102330122 317
146 3300025931 Ga0207644_10017521 Ga0207644_100175212 317
147 3300025960 Ga0207651_10010453 Ga0207651_100104533 317
148 3300025972 Ga0207668_10020100 Ga0207668_100201004 317
149 3300025972 Ga0207668_10199769 Ga0207668_101997692 317
150 3300026088 Ga0207641_10041949 Ga0207641_100419493 317
151 3300026095 Ga0207676_10213245 Ga0207676_102132453 317
152 3300026121 Ga0207683_10166835 Ga0207683_101668352 317
153 3300028379 Ga0268266_10152215 Ga0268266_101522152 317
154 3300028380 Ga0268265_10001646 Ga0268265_100016467 317
155 3300028380 Ga0268265_10128528 Ga0268265_101285282 317
156 3300028381 Ga0268264_10000046 Ga0268264_10000046124 317
157 3300028800 Ga0265338_10009737 Ga0265338_100097376 317
158 3300031251 Ga0265327_10000166 Ga0265327_1000016614 317
159 3300031251 Ga0265327_10007283 Ga0265327_100072836 317
160 3300031251 Ga0265327_10011393 Ga0265327_100113932 317
161 3300031456 Ga0307513_10011115 Ga0307513_100111153 317
162 3300031730 Ga0307516_10000004 Ga0307516_10000004328 317
163 3300032005 Ga0307411_10050488 Ga0307411_100504882 317
164 3300036401 Ga0373937_0013600 Ga0373937_0013600_2827_3780 317
165 3300036401 Ga0373937_0127051 Ga0373937_0127051_75_1028 317
166 3300037068 Ga0373925_0000478 Ga0373925_0000478_28049_29014 317
167 3300037418 Ga0395900_0025375 Ga0395900_0025375_3266_4222 317
168 3300037853 Ga0436364_1317670 Ga0436364_1317670_416_1372 317
169 3300038443 Ga0395901_0090200 Ga0395901_0090200_674_1630 317
170 3300039450 Ga0436363_1115256 Ga0436363_1115256_341_1294 317
171 3300046506 Ga0495583_0015880 Ga0495583_0015880_2498_3460 317
172 3300046648 Ga0495611_0040954 Ga0495611_0040954_1027_1989 317
173 3300046660 Ga0495625_0119778 Ga0495625_0119778_459_1421 317
174 3300046684 Ga0495669_0000294 Ga0495669_0000294_12521_13573 317
175 3300046689 Ga0495613_0032453 Ga0495613_0032453_1300_2259 317
176 3300047320 Ga0495672_0014263 Ga0495672_0014263_2337_3299 317
177 3300047320 Ga0495672_0028221 Ga0495672_0028221_2581_3543 317
178 3300047444 Ga0495675_0164140 Ga0495675_0164140_59_1054 317
179 3300047445 Ga0495677_0055591 Ga0495677_0055591_328_1380 317
180 3300048911 Ga0496108_0070755 Ga0496108_0070755_1284_2246 317
181 3300048912 Ga0496109_0005745 Ga0496109_0005745_7486_8448 317
182 3300048915 Ga0496112_0089451 Ga0496112_0089451_558_1520 317
183 3300050507 nmdc:mga05p37_65540_c1 nmdc:mga05p37_65540_c1_2884_3840 317
184 3300050511 nmdc:mga08y16_258484_c1 nmdc:mga08y16_258484_c1_206_1162 317
185 3300053119 Ga0500595_005331 Ga0500595_005331_2498_3460 317
186 3300053119 Ga0500595_025298 Ga0500595_025298_1053_2009 317
187 3300005336 Ga0070680_100236474 Ga0070680_1002364742 318
188 3300005341 Ga0070691_10000580 Ga0070691_100005806 318
189 3300005366 Ga0070659_100000206 Ga0070659_10000020628 318
190 3300005366 Ga0070659_100004222 Ga0070659_1000042226 318
191 3300005458 Ga0070681_10016924 Ga0070681_100169247 318
192 3300005458 Ga0070681_10051870 Ga0070681_100518702 318
193 3300005539 Ga0068853_100012010 Ga0068853_1000120102 318
194 3300005548 Ga0070665_100000116 Ga0070665_10000011653 318
195 3300005563 Ga0068855_100021204 Ga0068855_1000212042 318
196 3300005563 Ga0068855_100025315 Ga0068855_1000253155 318
197 3300005577 Ga0068857_100042032 Ga0068857_1000420325 318
198 3300006881 Ga0068865_100004207 Ga0068865_1000042073 318
199 3300009093 Ga0105240_10028781 Ga0105240_100287817 318
200 3300009177 Ga0105248_10000154 Ga0105248_1000015454 318
201 3300010375 Ga0105239_10442001 Ga0105239_104420011 318
202 3300025909 Ga0207705_10002109 Ga0207705_100021092 318
203 3300025909 Ga0207705_10062655 Ga0207705_100626552 318
204 3300025913 Ga0207695_10001670 Ga0207695_1000167018 318
205 3300025913 Ga0207695_10001727 Ga0207695_1000172718 318
206 3300025913 Ga0207695_10045033 Ga0207695_100450335 318
207 3300025914 Ga0207671_10154862 Ga0207671_101548622 318
208 3300025917 Ga0207660_10006636 Ga0207660_100066366 318
209 3300025919 Ga0207657_10007960 Ga0207657_100079606 318
210 3300025921 Ga0207652_10012704 Ga0207652_100127045 318
211 3300025924 Ga0207694_10054899 Ga0207694_100548994 318
212 3300025932 Ga0207690_10000129 Ga0207690_1000012938 318
213 3300025932 Ga0207690_10035123 Ga0207690_100351232 318
214 3300025938 Ga0207704_10000836 Ga0207704_100008363 318
215 3300025941 Ga0207711_10000887 Ga0207711_100008876 318
216 3300025949 Ga0207667_10012057 Ga0207667_100120572 318
217 3300025949 Ga0207667_10019640 Ga0207667_100196401 318
218 3300026041 Ga0207639_10034375 Ga0207639_100343751 318
219 3300028379 Ga0268266_10000064 Ga0268266_10000064159 318
220 3300028786 Ga0307517_10000497 Ga0307517_100004975 318
221 3300035113 Ga0373936_0019429 Ga0373936_0019429_326_1291 318
222 3300037312 Ga0395899_0000213 Ga0395899_0000213_79131_80102 318
223 3300037418 Ga0395900_0000121 Ga0395900_0000121_130754_131725 318
224 3300037466 Ga0395898_0000247 Ga0395898_0000247_3302_4273 318
225 3300037471 Ga0395905_0000112 Ga0395905_0000112_3286_4257 318
226 3300038443 Ga0395901_0000078 Ga0395901_0000078_130754_131725 318
227 3300046454 Ga0495592_0083857 Ga0495592_0083857_1206_2171 318
228 3300046516 Ga0495628_0051940 Ga0495628_0051940_1081_2046 318
229 3300046543 Ga0495645_0033156 Ga0495645_0033156_1649_2614 318
230 3300048915 Ga0496112_0070748 Ga0496112_0070748_687_1664 318
231 3300048918 Ga0496115_0029381 Ga0496115_0029381_1228_2193 318
232 3300049569 Ga0501032_0000064 Ga0501032_0000064_33862_34839 318
233 3300049569 Ga0501032_0002338 Ga0501032_0002338_566_1531 318
234 3300049570 Ga0501033_0000286 Ga0501033_0000286_588_1565 318
235 3300049570 Ga0501033_0007597 Ga0501033_0007597_7361_8326 318
236 3300049570 Ga0501033_0163235 Ga0501033_0163235_74_1039 318
237 3300049571 Ga0501034_0000174 Ga0501034_0000174_38456_39433 318
238 3300049571 Ga0501034_0089453 Ga0501034_0089453_1975_2943 318
239 3300049571 Ga0501034_0150148 Ga0501034_0150148_1077_2036 318
240 3300049572 Ga0501036_0011420 Ga0501036_0011420_5840_6817 318
241 3300049573 Ga0501037_0000147 Ga0501037_0000147_96_1061 318
242 3300049573 Ga0501037_0009152 Ga0501037_0009152_542_1519 318
243 3300049574 Ga0501038_0000031 Ga0501038_0000031_117081_118058 318
244 3300049575 Ga0501039_0000057 Ga0501039_0000057_31647_32624 318
245 3300049579 Ga0501043_0000048 Ga0501043_0000048_38456_39433 318
246 3300049580 Ga0501046_0216928 Ga0501046_0216928_238_1215 318
247 3300049584 Ga0501068_0205406 Ga0501068_0205406_267_1226 318
248 3300049585 Ga0501069_0000018 Ga0501069_0000018_11790_12755 318
249 3300049585 Ga0501069_0079075 Ga0501069_0079075_878_1837 318
250 3300049586 Ga0501070_0000048 Ga0501070_0000048_12426_13391 318
251 3300049586 Ga0501070_0245726 Ga0501070_0245726_165_1124 318
252 3300049589 Ga0501073_0057847 Ga0501073_0057847_829_1788 318
253 3300049590 Ga0501074_0000001 Ga0501074_0000001_56956_57921 318
254 3300049742 Ga0501080_0000197 Ga0501080_0000197_28151_29116 318
255 3300049744 Ga0501083_0005530 Ga0501083_0005530_5465_6430 318
256 3300049744 Ga0501083_0008221 Ga0501083_0008221_4778_5737 318
257 3300049822 Ga0501035_0000048 Ga0501035_0000048_24183_25148 318
258 3300049822 Ga0501035_0004746 Ga0501035_0004746_9258_10223 318
259 3300049822 Ga0501035_0130236 Ga0501035_0130236_656_1633 318
260 3300049823 Ga0501044_0000003 Ga0501044_0000003_228830_229795 318
261 3300049823 Ga0501044_0010560 Ga0501044_0010560_3478_4455 318
262 3300049823 Ga0501044_0181045 Ga0501044_0181045_1088_2053 318
263 3300060353 Ga0501082_0003165 Ga0501082_0003165_285_1244 318
264 3300001979 JGI24740J21852_10021354 JGI24740J21852_100213541 319
265 3300003775 Ga0055524_1021494 Ga0055524_10214942 319
266 3300005539 Ga0068853_100012248 Ga0068853_1000122484 319
267 3300005577 Ga0068857_100008808 Ga0068857_1000088083 319
268 3300005578 Ga0068854_100026764 Ga0068854_1000267642 319
269 3300005614 Ga0068856_100017571 Ga0068856_1000175713 319
270 3300005616 Ga0068852_100020749 Ga0068852_1000207493 319
271 3300005834 Ga0068851_10001023 Ga0068851_100010232 319
272 3300006186 Ga0075369_10007154 Ga0075369_100071543 319
273 3300009551 Ga0105238_10021668 Ga0105238_100216684 319
274 3300025292 Ga0209676_1000057 Ga0209676_100005720 319
275 3300025292 Ga0209676_1001335 Ga0209676_100133515 319
276 3300025298 Ga0209050_1001221 Ga0209050_100122113 319
277 3300025299 Ga0209256_1002873 Ga0209256_10028735 319
278 3300025303 Ga0209051_1007128 Ga0209051_10071285 319
279 3300025304 Ga0209257_1001883 Ga0209257_100188312 319
280 3300025911 Ga0207654_10001364 Ga0207654_100013642 319
281 3300025913 Ga0207695_10017258 Ga0207695_100172583 319
282 3300025924 Ga0207694_10000504 Ga0207694_1000050418 319
283 3300025949 Ga0207667_10045788 Ga0207667_100457882 319
284 3300025981 Ga0207640_10156569 Ga0207640_101565692 319
285 3300026067 Ga0207678_10121787 Ga0207678_101217873 319
286 3300026078 Ga0207702_10000093 Ga0207702_1000009345 319
287 3300026142 Ga0207698_10026177 Ga0207698_100261772 319
288 3300028794 Ga0307515_10047013 Ga0307515_100470133 319
289 3300046460 Ga0495638_0000260 Ga0495638_0000260_53232_54224 319
290 3300046616 Ga0495668_0000345 Ga0495668_0000345_6609_7586 319
291 3300046660 Ga0495625_0000342 Ga0495625_0000342_7878_8855 319
292 3300048927 Ga0496124_0015953 Ga0496124_0015953_963_1940 319
293 3300048928 Ga0496125_0096951 Ga0496125_0096951_888_1865 319
294 3300049589 Ga0501073_0073794 Ga0501073_0073794_1024_1986 319
295 3300050516 nmdc:mga0sz30_16976_c1 nmdc:mga0sz30_16976_c1_838_1815 319
296 3300053122 Ga0500608_000025 Ga0500608_000025_54286_55302 319
297 3300053136 Ga0500559_0001640 Ga0500559_0001640_4088_5065 319
298 3300053156 Ga0500622_0005488 Ga0500622_0005488_3689_4666 319
299 iso_pu_bacteria 2857504554 2857506244 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

110

273

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9795 26 314
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9614 29 303
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.947 26 314
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9469 32 303
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9367 32 303
ID Description Score Start End Superfamily
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9928 76 288 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9863 27 283 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9849 80 288 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9802 80 288 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9726 70 278 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A531YMD4-F1-model_v4 deleted 0.9991 117 301
AF-A0A436B320-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9952 80 316 GO:0016992
GO:0046872
GO:0051539
AF-A0A535Q8R3-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) 0.9949 81 305 GO:0005737
GO:0016992
GO:0046872
GO:0051539
AF-X1G6A7-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9949 84 305 GO:0016992
GO:0046872
GO:0051539
AF-A0A2S6RRG8-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) 0.994 81 316 GO:0005737
GO:0016992
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
87.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map