F395004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 204 | 289 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300046684|Ga0495669_0000294|Ga0495669_0000294_12521_13573 |
| Length | 350 |
| Sequence | MLKFVPAPALARKPELWRLDPETQAADLGAMTVVIDTLGGAGRPRHPEKQGRPDTPLLRKPEWLRVRAPGSPGYAATKAIVKEHGLVTVCEEAACPNIGECWTQSHATMMIMGDVCTRACAFCNVATGLPGPLDPTEPVRVADAVAKMGLKHVVITSVDRDDLPDGGAEHFAQVVRAIRVAAPGTTIEILTPDFLRKAGAAEVVIESKPDVFNHNLETVPRLYLSIRPGARYYHSLRLLERVKEQDPVQFTKSGVMVGLGEAKEEVMQVMDDMRSAGVDFITIGQYLQPTRKHAPIDRFVTPDEFRAYEEIARAKGFLMVASSPLTRSSHHAGEDFARLQAARRAKDSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 6 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 7 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 8 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 9 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 10 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 125 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 137 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 138 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 196 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 198 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 199 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 200 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 201 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 202 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 203 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.66 |
| Metatranscriptomes | 0 |
| Isolates | 3.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.36 |
| Nodule | 0 |
| Rhizoplane | 2.34 |
| Rhizosphere | 81.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10021354 | 3300001979 | Bacteria | 2246 |
| 2 | Ga0055524_1021494 | 3300003775 | Bacteria | 2135 |
| 3 | Ga0065712_10070766 | 3300005290 | Bacteria | 5727 |
| 4 | Ga0065712_10078550 | 3300005290 | Bacteria | 3331 |
| 5 | Ga0070658_10150849 | 3300005327 | Bacteria | 1946 |
| 6 | Ga0070670_100032414 | 3300005331 | Bacteria | 4501 |
| 7 | Ga0070680_100098401 | 3300005336 | Bacteria | 2426 |
| 8 | Ga0070680_100236474 | 3300005336 | Bacteria | 1543 |
| 9 | Ga0070691_10000580 | 3300005341 | Bacteria | 14004 |
| 10 | Ga0070668_100010260 | 3300005347 | Bacteria | 6952 |
| 11 | Ga0070668_100010392 | 3300005347 | Bacteria | 6916 |
| 12 | Ga0070668_100098112 | 3300005347 | Bacteria | 2318 |
| 13 | Ga0070669_100031889 | 3300005353 | Bacteria | 3807 |
| 14 | Ga0070669_100321118 | 3300005353 | Bacteria | 1250 |
| 15 | Ga0070671_100012757 | 3300005355 | Bacteria | 6776 |
| 16 | Ga0070671_100072617 | 3300005355 | Bacteria | 2874 |
| 17 | Ga0070674_100004826 | 3300005356 | Bacteria | 7726 |
| 18 | Ga0070659_100000206 | 3300005366 | Bacteria | 45867 |
| 19 | Ga0070659_100004222 | 3300005366 | Bacteria | 10260 |
| 20 | Ga0070709_10304635 | 3300005434 | Bacteria | 1165 |
| 21 | Ga0070710_10114146 | 3300005437 | Bacteria | 1626 |
| 22 | Ga0070708_100000008 | 3300005445 | Bacteria | 146021 |
| 23 | Ga0070708_100017843 | 3300005445 | Bacteria | 5929 |
| 24 | Ga0070681_10016924 | 3300005458 | Bacteria | 7284 |
| 25 | Ga0070681_10051870 | 3300005458 | Bacteria | 4091 |
| 26 | Ga0070706_100000160 | 3300005467 | Bacteria | 85799 |
| 27 | Ga0070706_100000372 | 3300005467 | Bacteria | 53887 |
| 28 | Ga0070707_100000004 | 3300005468 | Bacteria | 265003 |
| 29 | Ga0070707_100000566 | 3300005468 | Bacteria | 37191 |
| 30 | Ga0070698_100173288 | 3300005471 | Bacteria | 2098 |
| 31 | Ga0070698_100475322 | 3300005471 | Bacteria | 1186 |
| 32 | Ga0070699_100000006 | 3300005518 | Bacteria | 363492 |
| 33 | Ga0070699_100000084 | 3300005518 | Bacteria | 89070 |
| 34 | Ga0070699_100159620 | 3300005518 | Bacteria | 1995 |
| 35 | Ga0070679_100449814 | 3300005530 | Bacteria | 1233 |
| 36 | Ga0070684_100031522 | 3300005535 | Bacteria | 4514 |
| 37 | Ga0070697_100145032 | 3300005536 | Bacteria | 1998 |
| 38 | Ga0068853_100012010 | 3300005539 | Bacteria | 7044 |
| 39 | Ga0068853_100012248 | 3300005539 | Bacteria | 6974 |
| 40 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 41 | Ga0070704_100001432 | 3300005549 | Bacteria | 12748 |
| 42 | Ga0068855_100021204 | 3300005563 | Bacteria | 7790 |
| 43 | Ga0068855_100025315 | 3300005563 | Bacteria | 7101 |
| 44 | Ga0068855_100604117 | 3300005563 | Bacteria | 1183 |
| 45 | Ga0070664_100116142 | 3300005564 | Bacteria | 2340 |
| 46 | Ga0068857_100008808 | 3300005577 | Bacteria | 8737 |
| 47 | Ga0068857_100042032 | 3300005577 | Bacteria | 4053 |
| 48 | Ga0068854_100026764 | 3300005578 | Bacteria | 3967 |
| 49 | Ga0068856_100017571 | 3300005614 | Bacteria | 6931 |
| 50 | Ga0068856_100332341 | 3300005614 | Bacteria | 1537 |
| 51 | Ga0068852_100020749 | 3300005616 | Bacteria | 5228 |
| 52 | Ga0068864_100011680 | 3300005618 | Bacteria | 7250 |
| 53 | Ga0068851_10001023 | 3300005834 | Bacteria | 12145 |
| 54 | Ga0068863_100017150 | 3300005841 | Bacteria | 6946 |
| 55 | Ga0068863_100029789 | 3300005841 | Bacteria | 5212 |
| 56 | Ga0068863_100048438 | 3300005841 | Bacteria | 4030 |
| 57 | Ga0068860_100000145 | 3300005843 | Bacteria | 115830 |
| 58 | Ga0068860_100005851 | 3300005843 | Bacteria | 12380 |
| 59 | Ga0068862_100026812 | 3300005844 | Bacteria | 4846 |
| 60 | Ga0068862_100035830 | 3300005844 | Bacteria | 4204 |
| 61 | Ga0068862_100044379 | 3300005844 | Bacteria | 3791 |
| 62 | Ga0081538_10004974 | 3300005981 | Bacteria | 12105 |
| 63 | Ga0070717_10000043 | 3300006028 | Bacteria | 109696 |
| 64 | Ga0075363_100106539 | 3300006048 | Bacteria | 1555 |
| 65 | Ga0075364_10181672 | 3300006051 | Bacteria | 1424 |
| 66 | Ga0070712_100157108 | 3300006175 | Bacteria | 1752 |
| 67 | Ga0075362_10001151 | 3300006177 | Bacteria | 8267 |
| 68 | Ga0075369_10007154 | 3300006186 | Bacteria | 4240 |
| 69 | Ga0075370_10243010 | 3300006353 | Bacteria | 1066 |
| 70 | Ga0075430_100147872 | 3300006846 | Bacteria | 1957 |
| 71 | Ga0075431_100012229 | 3300006847 | Bacteria | 8665 |
| 72 | Ga0075431_100177859 | 3300006847 | Bacteria | 2184 |
| 73 | Ga0075433_10020565 | 3300006852 | Bacteria | 5522 |
| 74 | Ga0075434_100084225 | 3300006871 | Bacteria | 3178 |
| 75 | Ga0075429_100018062 | 3300006880 | Bacteria | 6101 |
| 76 | Ga0068865_100004207 | 3300006881 | Bacteria | 8672 |
| 77 | Ga0068865_100079557 | 3300006881 | Bacteria | 2348 |
| 78 | Ga0075436_100006664 | 3300006914 | Bacteria | 7910 |
| 79 | Ga0075435_100011824 | 3300007076 | Bacteria | 6443 |
| 80 | Ga0075435_100558766 | 3300007076 | Bacteria | 991 |
| 81 | Ga0105240_10009914 | 3300009093 | Bacteria | 13434 |
| 82 | Ga0105240_10028781 | 3300009093 | Bacteria | 7248 |
| 83 | Ga0105240_10252947 | 3300009093 | Bacteria | 2037 |
| 84 | Ga0114129_10017292 | 3300009147 | Bacteria | 10271 |
| 85 | Ga0114129_10610040 | 3300009147 | Bacteria | 1413 |
| 86 | Ga0105248_10000154 | 3300009177 | Bacteria | 80081 |
| 87 | Ga0105248_10107115 | 3300009177 | Bacteria | 3152 |
| 88 | Ga0105238_10000072 | 3300009551 | Bacteria | 112436 |
| 89 | Ga0105238_10021668 | 3300009551 | Bacteria | 6547 |
| 90 | Ga0105238_10149578 | 3300009551 | Bacteria | 2310 |
| 91 | Ga0105249_10311110 | 3300009553 | Bacteria | 1583 |
| 92 | Ga0105239_10013880 | 3300010375 | Bacteria | 8940 |
| 93 | Ga0105239_10442001 | 3300010375 | Bacteria | 1475 |
| 94 | Ga0105246_10001758 | 3300011119 | Bacteria | 12961 |
| 95 | Ga0213876_10000108 | 3300021384 | Bacteria | 91222 |
| 96 | Ga0209026_1002404 | 3300025250 | Bacteria | 7057 |
| 97 | Ga0209026_1010061 | 3300025250 | Bacteria | 1794 |
| 98 | Ga0209233_1000937 | 3300025261 | Bacteria | 12666 |
| 99 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 100 | Ga0209676_1001335 | 3300025292 | Bacteria | 24868 |
| 101 | Ga0209050_1001221 | 3300025298 | Bacteria | 29961 |
| 102 | Ga0209256_1002873 | 3300025299 | Bacteria | 13085 |
| 103 | Ga0209051_1007128 | 3300025303 | Bacteria | 6167 |
| 104 | Ga0209257_1001883 | 3300025304 | Bacteria | 22693 |
| 105 | Ga0207699_10070823 | 3300025906 | Bacteria | 2130 |
| 106 | Ga0207705_10002109 | 3300025909 | Bacteria | 15460 |
| 107 | Ga0207705_10062655 | 3300025909 | Bacteria | 2686 |
| 108 | Ga0207684_10000014 | 3300025910 | Bacteria | 440027 |
| 109 | Ga0207684_10000034 | 3300025910 | Bacteria | 291009 |
| 110 | Ga0207654_10001364 | 3300025911 | Bacteria | 12968 |
| 111 | Ga0207695_10001670 | 3300025913 | Bacteria | 35733 |
| 112 | Ga0207695_10001727 | 3300025913 | Bacteria | 34901 |
| 113 | Ga0207695_10017258 | 3300025913 | Bacteria | 8405 |
| 114 | Ga0207695_10045033 | 3300025913 | Bacteria | 4687 |
| 115 | Ga0207695_10088226 | 3300025913 | Bacteria | 3123 |
| 116 | Ga0207671_10154862 | 3300025914 | Bacteria | 1772 |
| 117 | Ga0207660_10006636 | 3300025917 | Bacteria | 7504 |
| 118 | Ga0207657_10007960 | 3300025919 | Bacteria | 10808 |
| 119 | Ga0207652_10012704 | 3300025921 | Bacteria | 6810 |
| 120 | Ga0207646_10000018 | 3300025922 | Bacteria | 291009 |
| 121 | Ga0207646_10000524 | 3300025922 | Bacteria | 51084 |
| 122 | Ga0207646_10073488 | 3300025922 | Bacteria | 3054 |
| 123 | Ga0207694_10000504 | 3300025924 | Bacteria | 35370 |
| 124 | Ga0207694_10002233 | 3300025924 | Bacteria | 15888 |
| 125 | Ga0207694_10054899 | 3300025924 | Bacteria | 3092 |
| 126 | Ga0207650_10233012 | 3300025925 | Bacteria | 1486 |
| 127 | Ga0207644_10017521 | 3300025931 | Bacteria | 4839 |
| 128 | Ga0207690_10000129 | 3300025932 | Bacteria | 62350 |
| 129 | Ga0207690_10035123 | 3300025932 | Bacteria | 3235 |
| 130 | Ga0207709_10395563 | 3300025935 | Bacteria | 1055 |
| 131 | Ga0207704_10000836 | 3300025938 | Bacteria | 13639 |
| 132 | Ga0207711_10000887 | 3300025941 | Bacteria | 28843 |
| 133 | Ga0207667_10012057 | 3300025949 | Bacteria | 9997 |
| 134 | Ga0207667_10019640 | 3300025949 | Bacteria | 7536 |
| 135 | Ga0207667_10045788 | 3300025949 | Bacteria | 4632 |
| 136 | Ga0207651_10010453 | 3300025960 | Bacteria | 5146 |
| 137 | Ga0207668_10020100 | 3300025972 | Bacteria | 4235 |
| 138 | Ga0207668_10199769 | 3300025972 | Bacteria | 1591 |
| 139 | Ga0207640_10156569 | 3300025981 | Bacteria | 1680 |
| 140 | Ga0207639_10034375 | 3300026041 | Bacteria | 3746 |
| 141 | Ga0207678_10121787 | 3300026067 | Bacteria | 2226 |
| 142 | Ga0207702_10000093 | 3300026078 | Bacteria | 103678 |
| 143 | Ga0207702_10411483 | 3300026078 | Bacteria | 1306 |
| 144 | Ga0207641_10041949 | 3300026088 | Bacteria | 3837 |
| 145 | Ga0207676_10213245 | 3300026095 | Bacteria | 1714 |
| 146 | Ga0207683_10166835 | 3300026121 | Bacteria | 1992 |
| 147 | Ga0207698_10026177 | 3300026142 | Bacteria | 4124 |
| 148 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 149 | Ga0268266_10152215 | 3300028379 | Bacteria | 2086 |
| 150 | Ga0268265_10001646 | 3300028380 | Bacteria | 18291 |
| 151 | Ga0268265_10128528 | 3300028380 | Bacteria | 2101 |
| 152 | Ga0268265_10136030 | 3300028380 | Bacteria | 2050 |
| 153 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 154 | Ga0265334_10013640 | 3300028573 | Bacteria | 3401 |
| 155 | Ga0307517_10000497 | 3300028786 | Bacteria | 67390 |
| 156 | Ga0307515_10047013 | 3300028794 | Bacteria | 6578 |
| 157 | Ga0265338_10009737 | 3300028800 | Bacteria | 11403 |
| 158 | Ga0265338_10018621 | 3300028800 | Bacteria | 7420 |
| 159 | Ga0265338_10047121 | 3300028800 | Bacteria | 3941 |
| 160 | Ga0307511_10045869 | 3300030521 | Bacteria | 3605 |
| 161 | Ga0265339_10085501 | 3300031249 | Bacteria | 1660 |
| 162 | Ga0265327_10000166 | 3300031251 | Bacteria | 141539 |
| 163 | Ga0265327_10005314 | 3300031251 | Bacteria | 10799 |
| 164 | Ga0265327_10007283 | 3300031251 | Bacteria | 8581 |
| 165 | Ga0265327_10011393 | 3300031251 | Bacteria | 6127 |
| 166 | Ga0307513_10000181 | 3300031456 | Bacteria | 91264 |
| 167 | Ga0307513_10011115 | 3300031456 | Bacteria | 11221 |
| 168 | Ga0265313_10001659 | 3300031595 | Bacteria | 20615 |
| 169 | Ga0265314_10023705 | 3300031711 | Bacteria | 4672 |
| 170 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 171 | Ga0307412_10266754 | 3300031911 | Bacteria | 1338 |
| 172 | Ga0307411_10050488 | 3300032005 | Bacteria | 2709 |
| 173 | Ga0373936_0019429 | 3300035113 | Bacteria | 2633 |
| 174 | Ga0373939_0005567 | 3300035114 | Bacteria | 3001 |
| 175 | Ga0316574_0156210 | 3300035398 | Bacteria | 1470 |
| 176 | Ga0373937_0013600 | 3300036401 | Bacteria | 7171 |
| 177 | Ga0373937_0127051 | 3300036401 | Bacteria | 2379 |
| 178 | Ga0316584_0164134 | 3300036712 | Bacteria | 1649 |
| 179 | Ga0373925_0000478 | 3300037068 | Bacteria | 39975 |
| 180 | Ga0395899_0000213 | 3300037312 | Bacteria | 83403 |
| 181 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 182 | Ga0395900_0025375 | 3300037418 | Bacteria | 6068 |
| 183 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 184 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 185 | Ga0436364_1317670 | 3300037853 | Bacteria | 2660 |
| 186 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 187 | Ga0395901_0090200 | 3300038443 | Bacteria | 3208 |
| 188 | Ga0436365_1544656 | 3300039437 | Bacteria | 122419 |
| 189 | Ga0436360_1124904 | 3300039438 | Bacteria | 1481 |
| 190 | Ga0436361_0196619 | 3300039447 | Bacteria | 31824 |
| 191 | Ga0436363_0732235 | 3300039450 | Bacteria | 4075 |
| 192 | Ga0436363_1115256 | 3300039450 | Bacteria | 1371 |
| 193 | Ga0495592_0083857 | 3300046454 | Bacteria | 2301 |
| 194 | Ga0495603_0042519 | 3300046455 | Bacteria | 2716 |
| 195 | Ga0495638_0000260 | 3300046460 | Bacteria | 71071 |
| 196 | Ga0495583_0015880 | 3300046506 | Bacteria | 4074 |
| 197 | Ga0495628_0051940 | 3300046516 | Bacteria | 3239 |
| 198 | Ga0495630_0065851 | 3300046517 | Bacteria | 2723 |
| 199 | Ga0495645_0033156 | 3300046543 | Bacteria | 3767 |
| 200 | Ga0495622_0005503 | 3300046557 | Bacteria | 5875 |
| 201 | Ga0495668_0000345 | 3300046616 | Bacteria | 61921 |
| 202 | Ga0495611_0040954 | 3300046648 | Bacteria | 2066 |
| 203 | Ga0495625_0000342 | 3300046660 | Bacteria | 71332 |
| 204 | Ga0495625_0119778 | 3300046660 | Bacteria | 1792 |
| 205 | Ga0495658_0042603 | 3300046683 | Bacteria | 2535 |
| 206 | Ga0495658_0160299 | 3300046683 | Bacteria | 1387 |
| 207 | Ga0495669_0000024 | 3300046684 | Bacteria | 113943 |
| 208 | Ga0495669_0000294 | 3300046684 | Bacteria | 28302 |
| 209 | Ga0495613_0032453 | 3300046689 | Bacteria | 3880 |
| 210 | Ga0495649_0058285 | 3300046694 | Bacteria | 2081 |
| 211 | Ga0495672_0014263 | 3300047320 | Bacteria | 5450 |
| 212 | Ga0495672_0028221 | 3300047320 | Bacteria | 3553 |
| 213 | Ga0495675_0164140 | 3300047444 | Bacteria | 1367 |
| 214 | Ga0495677_0055591 | 3300047445 | Bacteria | 1461 |
| 215 | Ga0495686_0091881 | 3300047472 | Bacteria | 1842 |
| 216 | Ga0496106_0317901 | 3300048909 | Bacteria | 1250 |
| 217 | Ga0496108_0070755 | 3300048911 | Bacteria | 2944 |
| 218 | Ga0496109_0005745 | 3300048912 | Bacteria | 10382 |
| 219 | Ga0496112_0070748 | 3300048915 | Bacteria | 3448 |
| 220 | Ga0496112_0089451 | 3300048915 | Bacteria | 3047 |
| 221 | Ga0496112_0463603 | 3300048915 | Bacteria | 1204 |
| 222 | Ga0496115_0029381 | 3300048918 | Bacteria | 4317 |
| 223 | Ga0496124_0015953 | 3300048927 | Bacteria | 7170 |
| 224 | Ga0496125_0096951 | 3300048928 | Bacteria | 2187 |
| 225 | Ga0501032_0000064 | 3300049569 | Bacteria | 91971 |
| 226 | Ga0501032_0002338 | 3300049569 | Bacteria | 14870 |
| 227 | Ga0501033_0000286 | 3300049570 | Bacteria | 48628 |
| 228 | Ga0501033_0007597 | 3300049570 | Bacteria | 8429 |
| 229 | Ga0501033_0163235 | 3300049570 | Bacteria | 1603 |
| 230 | Ga0501034_0000174 | 3300049571 | Bacteria | 119615 |
| 231 | Ga0501034_0021300 | 3300049571 | Bacteria | 6609 |
| 232 | Ga0501034_0089453 | 3300049571 | Bacteria | 3077 |
| 233 | Ga0501034_0150148 | 3300049571 | Bacteria | 2306 |
| 234 | Ga0501036_0011420 | 3300049572 | Bacteria | 7352 |
| 235 | Ga0501037_0000147 | 3300049573 | Bacteria | 65415 |
| 236 | Ga0501037_0009152 | 3300049573 | Bacteria | 7255 |
| 237 | Ga0501038_0000031 | 3300049574 | Bacteria | 132231 |
| 238 | Ga0501039_0000057 | 3300049575 | Bacteria | 89756 |
| 239 | Ga0501043_0000048 | 3300049579 | Bacteria | 109146 |
| 240 | Ga0501046_0216928 | 3300049580 | Bacteria | 1418 |
| 241 | Ga0501047_0116815 | 3300049581 | Bacteria | 2549 |
| 242 | Ga0501047_0328026 | 3300049581 | Bacteria | 1369 |
| 243 | Ga0501068_0205406 | 3300049584 | Bacteria | 1250 |
| 244 | Ga0501069_0000018 | 3300049585 | Bacteria | 133550 |
| 245 | Ga0501069_0079075 | 3300049585 | Bacteria | 1850 |
| 246 | Ga0501070_0000048 | 3300049586 | Bacteria | 105951 |
| 247 | Ga0501070_0245726 | 3300049586 | Bacteria | 1464 |
| 248 | Ga0501073_0057847 | 3300049589 | Bacteria | 2710 |
| 249 | Ga0501073_0073794 | 3300049589 | Bacteria | 2375 |
| 250 | Ga0501074_0000001 | 3300049590 | Bacteria | 123588 |
| 251 | Ga0501080_0000197 | 3300049742 | Bacteria | 44169 |
| 252 | Ga0501080_0137934 | 3300049742 | Bacteria | 2256 |
| 253 | Ga0501083_0005530 | 3300049744 | Bacteria | 8955 |
| 254 | Ga0501083_0008221 | 3300049744 | Bacteria | 7377 |
| 255 | Ga0501035_0000048 | 3300049822 | Bacteria | 146466 |
| 256 | Ga0501035_0004746 | 3300049822 | Bacteria | 12904 |
| 257 | Ga0501035_0130236 | 3300049822 | Bacteria | 2194 |
| 258 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 259 | Ga0501044_0010560 | 3300049823 | Bacteria | 10015 |
| 260 | Ga0501044_0181045 | 3300049823 | Bacteria | 2074 |
| 261 | nmdc:mga03683_3737_c1 | 3300050489 | Bacteria | 4963 |
| 262 | nmdc:mga03n38_145412_c1 | 3300050490 | Bacteria | 1188 |
| 263 | nmdc:mga05p37_13216_c2 | 3300050507 | Bacteria | 9030 |
| 264 | nmdc:mga05p37_281594_c1 | 3300050507 | Bacteria | 1982 |
| 265 | nmdc:mga05p37_65540_c1 | 3300050507 | Bacteria | 4469 |
| 266 | nmdc:mga09592_144194_c1 | 3300050508 | Bacteria | 2053 |
| 267 | nmdc:mga06r32_67936_c1 | 3300050510 | Bacteria | 3442 |
| 268 | nmdc:mga08y16_258484_c1 | 3300050511 | Bacteria | 1799 |
| 269 | nmdc:mga08y16_71113_c1 | 3300050511 | Bacteria | 3626 |
| 270 | nmdc:mga0n895_161145_c1 | 3300050512 | Bacteria | 2275 |
| 271 | nmdc:mga0n895_80240_c1 | 3300050512 | Bacteria | 3251 |
| 272 | nmdc:mga0rr50_181720_c1 | 3300050513 | Bacteria | 1720 |
| 273 | nmdc:mga08x19_55883_c1 | 3300050514 | Bacteria | 2546 |
| 274 | nmdc:mga0a205_111557_c1 | 3300050515 | Bacteria | 2634 |
| 275 | nmdc:mga0a205_90176_c1 | 3300050515 | Bacteria | 2962 |
| 276 | nmdc:mga0sz30_16976_c1 | 3300050516 | Bacteria | 2898 |
| 277 | Ga0500635_0008546 | 3300053080 | Bacteria | 2811 |
| 278 | Ga0500555_058514 | 3300053103 | Bacteria | 1041 |
| 279 | Ga0500556_0000552 | 3300053104 | Bacteria | 25172 |
| 280 | Ga0500562_000288 | 3300053108 | Bacteria | 12326 |
| 281 | Ga0500562_001429 | 3300053108 | Bacteria | 5875 |
| 282 | Ga0500595_005331 | 3300053119 | Bacteria | 5627 |
| 283 | Ga0500595_022099 | 3300053119 | Bacteria | 2258 |
| 284 | Ga0500595_025298 | 3300053119 | Bacteria | 2060 |
| 285 | Ga0500608_000025 | 3300053122 | Bacteria | 71403 |
| 286 | Ga0500559_0001640 | 3300053136 | Bacteria | 12400 |
| 287 | Ga0500622_0005488 | 3300053156 | Bacteria | 7610 |
| 288 | Ga0500637_0050963 | 3300053178 | Bacteria | 2359 |
| 289 | Ga0501082_0003165 | 3300060353 | Bacteria | 14346 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100000008 | Ga0070708_10000000891 | 278 |
| 2 | 3300005467 | Ga0070706_100000160 | Ga0070706_10000016036 | 278 |
| 3 | 3300005518 | Ga0070699_100000084 | Ga0070699_10000008439 | 278 |
| 4 | 3300005518 | Ga0070699_100159620 | Ga0070699_1001596202 | 278 |
| 5 | 3300050511 | nmdc:mga08y16_71113_c1 | nmdc:mga08y16_71113_c1_10_858 | 282 |
| 6 | 3300007076 | Ga0075435_100011824 | Ga0075435_1000118242 | 289 |
| 7 | 3300050513 | nmdc:mga0rr50_181720_c1 | nmdc:mga0rr50_181720_c1_522_1394 | 289 |
| 8 | 3300006871 | Ga0075434_100084225 | Ga0075434_1000842253 | 290 |
| 9 | 3300006914 | Ga0075436_100006664 | Ga0075436_1000066642 | 290 |
| 10 | 3300050512 | nmdc:mga0n895_80240_c1 | nmdc:mga0n895_80240_c1_2079_2954 | 290 |
| 11 | 3300050514 | nmdc:mga08x19_55883_c1 | nmdc:mga08x19_55883_c1_808_1683 | 290 |
| 12 | 3300050515 | nmdc:mga0a205_111557_c1 | nmdc:mga0a205_111557_c1_1557_2432 | 290 |
| 13 | 3300049581 | Ga0501047_0328026 | Ga0501047_0328026_452_1351 | 292 |
| 14 | 3300050490 | nmdc:mga03n38_145412_c1 | nmdc:mga03n38_145412_c1_21_902 | 292 |
| 15 | 3300053103 | Ga0500555_058514 | Ga0500555_058514_82_975 | 292 |
| 16 | 3300005471 | Ga0070698_100173288 | Ga0070698_1001732881 | 294 |
| 17 | 3300005536 | Ga0070697_100145032 | Ga0070697_1001450322 | 294 |
| 18 | 3300025922 | Ga0207646_10000524 | Ga0207646_1000052423 | 294 |
| 19 | 3300005518 | Ga0070699_100000006 | Ga0070699_100000006316 | 296 |
| 20 | 3300005468 | Ga0070707_100000004 | Ga0070707_100000004206 | 297 |
| 21 | 3300005549 | Ga0070704_100001432 | Ga0070704_1000014323 | 297 |
| 22 | 3300006028 | Ga0070717_10000043 | Ga0070717_10000043123 | 297 |
| 23 | 3300006852 | Ga0075433_10020565 | Ga0075433_100205655 | 297 |
| 24 | 3300007076 | Ga0075435_100558766 | Ga0075435_1005587661 | 297 |
| 25 | 3300025910 | Ga0207684_10000034 | Ga0207684_10000034238 | 297 |
| 26 | 3300025922 | Ga0207646_10000018 | Ga0207646_10000018238 | 297 |
| 27 | 3300050507 | nmdc:mga05p37_281594_c1 | nmdc:mga05p37_281594_c1_361_1257 | 297 |
| 28 | 3300050512 | nmdc:mga0n895_161145_c1 | nmdc:mga0n895_161145_c1_664_1560 | 297 |
| 29 | 3300005445 | Ga0070708_100017843 | Ga0070708_1000178433 | 298 |
| 30 | 3300005467 | Ga0070706_100000372 | Ga0070706_10000037223 | 298 |
| 31 | 3300005468 | Ga0070707_100000566 | Ga0070707_10000056620 | 298 |
| 32 | 3300005471 | Ga0070698_100475322 | Ga0070698_1004753222 | 298 |
| 33 | 3300025910 | Ga0207684_10000014 | Ga0207684_10000014327 | 298 |
| 34 | 3300025922 | Ga0207646_10073488 | Ga0207646_100734883 | 298 |
| 35 | 3300049742 | Ga0501080_0137934 | Ga0501080_0137934_348_1247 | 298 |
| 36 | 3300009553 | Ga0105249_10311110 | Ga0105249_103111103 | 300 |
| 37 | 3300009093 | Ga0105240_10252947 | Ga0105240_102529474 | 301 |
| 38 | 3300009551 | Ga0105238_10000072 | Ga0105238_100000729 | 301 |
| 39 | 3300025924 | Ga0207694_10002233 | Ga0207694_100022335 | 301 |
| 40 | 3300036712 | Ga0316584_0164134 | Ga0316584_0164134_263_1180 | 301 |
| 41 | 3300031251 | Ga0265327_10005314 | Ga0265327_100053144 | 302 |
| 42 | 3300053104 | Ga0500556_0000552 | Ga0500556_0000552_8907_9821 | 304 |
| 43 | 3300005327 | Ga0070658_10150849 | Ga0070658_101508492 | 308 |
| 44 | 3300046683 | Ga0495658_0042603 | Ga0495658_0042603_1590_2519 | 309 |
| 45 | 3300005353 | Ga0070669_100321118 | Ga0070669_1003211182 | 311 |
| 46 | 3300005356 | Ga0070674_100004826 | Ga0070674_1000048269 | 311 |
| 47 | 3300005844 | Ga0068862_100026812 | Ga0068862_1000268128 | 311 |
| 48 | 3300005981 | Ga0081538_10004974 | Ga0081538_100049749 | 311 |
| 49 | 3300006881 | Ga0068865_100079557 | Ga0068865_1000795573 | 311 |
| 50 | 3300025935 | Ga0207709_10395563 | Ga0207709_103955631 | 311 |
| 51 | 3300028380 | Ga0268265_10136030 | Ga0268265_101360303 | 311 |
| 52 | 3300046683 | Ga0495658_0160299 | Ga0495658_0160299_93_1031 | 311 |
| 53 | 3300028800 | Ga0265338_10047121 | Ga0265338_100471213 | 312 |
| 54 | 3300049571 | Ga0501034_0021300 | Ga0501034_0021300_943_1881 | 312 |
| 55 | 3300005347 | Ga0070668_100098112 | Ga0070668_1000981123 | 313 |
| 56 | 3300031911 | Ga0307412_10266754 | Ga0307412_102667542 | 313 |
| 57 | 3300047472 | Ga0495686_0091881 | Ga0495686_0091881_37_981 | 313 |
| 58 | iso_pu_bacteria | 2643221598 | 2644000224 | 313 |
| 59 | iso_pu_bacteria | 2643221614 | 2644085014 | 313 |
| 60 | iso_pu_bacteria | 2643221661 | 2644342566 | 313 |
| 61 | iso_pu_bacteria | 2643221666 | 2644365866 | 313 |
| 62 | 3300006847 | Ga0075431_100012229 | Ga0075431_1000122297 | 314 |
| 63 | 3300006880 | Ga0075429_100018062 | Ga0075429_1000180624 | 314 |
| 64 | 3300009147 | Ga0114129_10017292 | Ga0114129_100172923 | 314 |
| 65 | 3300025261 | Ga0209233_1000937 | Ga0209233_10009376 | 314 |
| 66 | 3300028573 | Ga0265334_10013640 | Ga0265334_100136403 | 314 |
| 67 | 3300028800 | Ga0265338_10018621 | Ga0265338_100186215 | 314 |
| 68 | 3300031711 | Ga0265314_10023705 | Ga0265314_100237052 | 314 |
| 69 | 3300046517 | Ga0495630_0065851 | Ga0495630_0065851_1697_2680 | 314 |
| 70 | 3300050507 | nmdc:mga05p37_13216_c2 | nmdc:mga05p37_13216_c2_4159_5103 | 314 |
| 71 | 3300050508 | nmdc:mga09592_144194_c1 | nmdc:mga09592_144194_c1_451_1395 | 314 |
| 72 | 3300050510 | nmdc:mga06r32_67936_c1 | nmdc:mga06r32_67936_c1_447_1391 | 314 |
| 73 | 3300053108 | Ga0500562_000288 | Ga0500562_000288_10689_11639 | 314 |
| 74 | iso_pu_bacteria | 2842694124 | 2842694225 | 314 |
| 75 | iso_pu_bacteria | 2917554339 | 2917555531 | 314 |
| 76 | 3300005290 | Ga0065712_10078550 | Ga0065712_100785504 | 315 |
| 77 | 3300005336 | Ga0070680_100098401 | Ga0070680_1000984012 | 315 |
| 78 | 3300005437 | Ga0070710_10114146 | Ga0070710_101141461 | 315 |
| 79 | 3300005530 | Ga0070679_100449814 | Ga0070679_1004498141 | 315 |
| 80 | 3300005535 | Ga0070684_100031522 | Ga0070684_1000315222 | 315 |
| 81 | 3300005563 | Ga0068855_100604117 | Ga0068855_1006041172 | 315 |
| 82 | 3300006175 | Ga0070712_100157108 | Ga0070712_1001571082 | 315 |
| 83 | 3300009147 | Ga0114129_10610040 | Ga0114129_106100402 | 315 |
| 84 | 3300031249 | Ga0265339_10085501 | Ga0265339_100855012 | 315 |
| 85 | 3300031595 | Ga0265313_10001659 | Ga0265313_100016595 | 315 |
| 86 | 3300035114 | Ga0373939_0005567 | Ga0373939_0005567_19_981 | 315 |
| 87 | 3300035398 | Ga0316574_0156210 | Ga0316574_0156210_179_1150 | 315 |
| 88 | 3300039447 | Ga0436361_0196619 | Ga0436361_0196619_1977_2930 | 315 |
| 89 | 3300046455 | Ga0495603_0042519 | Ga0495603_0042519_1514_2476 | 315 |
| 90 | 3300046557 | Ga0495622_0005503 | Ga0495622_0005503_2885_3847 | 315 |
| 91 | 3300046694 | Ga0495649_0058285 | Ga0495649_0058285_667_1629 | 315 |
| 92 | 3300048915 | Ga0496112_0463603 | Ga0496112_0463603_75_1022 | 315 |
| 93 | 3300053080 | Ga0500635_0008546 | Ga0500635_0008546_990_1952 | 315 |
| 94 | 3300053178 | Ga0500637_0050963 | Ga0500637_0050963_686_1648 | 315 |
| 95 | iso_pu_bacteria | 2884960567 | 2884964999 | 315 |
| 96 | iso_pu_bacteria | 2919450847 | 2919451230 | 315 |
| 97 | iso_pu_bacteria | 2939669807 | 2939670880 | 315 |
| 98 | 3300005290 | Ga0065712_10070766 | Ga0065712_100707662 | 316 |
| 99 | 3300005434 | Ga0070709_10304635 | Ga0070709_103046351 | 316 |
| 100 | 3300005564 | Ga0070664_100116142 | Ga0070664_1001161422 | 316 |
| 101 | 3300005614 | Ga0068856_100332341 | Ga0068856_1003323412 | 316 |
| 102 | 3300006048 | Ga0075363_100106539 | Ga0075363_1001065392 | 316 |
| 103 | 3300006177 | Ga0075362_10001151 | Ga0075362_100011515 | 316 |
| 104 | 3300006353 | Ga0075370_10243010 | Ga0075370_102430101 | 316 |
| 105 | 3300009177 | Ga0105248_10107115 | Ga0105248_101071152 | 316 |
| 106 | 3300009551 | Ga0105238_10149578 | Ga0105238_101495782 | 316 |
| 107 | 3300021384 | Ga0213876_10000108 | Ga0213876_1000010835 | 316 |
| 108 | 3300025906 | Ga0207699_10070823 | Ga0207699_100708232 | 316 |
| 109 | 3300025913 | Ga0207695_10088226 | Ga0207695_100882264 | 316 |
| 110 | 3300026078 | Ga0207702_10411483 | Ga0207702_104114831 | 316 |
| 111 | 3300030521 | Ga0307511_10045869 | Ga0307511_100458692 | 316 |
| 112 | 3300031456 | Ga0307513_10000181 | Ga0307513_100001816 | 316 |
| 113 | 3300039437 | Ga0436365_1544656 | Ga0436365_1544656_71904_72854 | 316 |
| 114 | 3300039438 | Ga0436360_1124904 | Ga0436360_1124904_388_1350 | 316 |
| 115 | 3300039450 | Ga0436363_0732235 | Ga0436363_0732235_2976_3926 | 316 |
| 116 | 3300046684 | Ga0495669_0000024 | Ga0495669_0000024_5949_6908 | 316 |
| 117 | 3300048909 | Ga0496106_0317901 | Ga0496106_0317901_118_1068 | 316 |
| 118 | 3300049581 | Ga0501047_0116815 | Ga0501047_0116815_986_1960 | 316 |
| 119 | 3300050489 | nmdc:mga03683_3737_c1 | nmdc:mga03683_3737_c1_2887_3837 | 316 |
| 120 | 3300050515 | nmdc:mga0a205_90176_c1 | nmdc:mga0a205_90176_c1_1002_1952 | 316 |
| 121 | 3300053108 | Ga0500562_001429 | Ga0500562_001429_2746_3705 | 316 |
| 122 | 3300053119 | Ga0500595_022099 | Ga0500595_022099_797_1753 | 316 |
| 123 | 3300005331 | Ga0070670_100032414 | Ga0070670_1000324144 | 317 |
| 124 | 3300005347 | Ga0070668_100010260 | Ga0070668_1000102605 | 317 |
| 125 | 3300005347 | Ga0070668_100010392 | Ga0070668_1000103926 | 317 |
| 126 | 3300005353 | Ga0070669_100031889 | Ga0070669_1000318892 | 317 |
| 127 | 3300005355 | Ga0070671_100012757 | Ga0070671_1000127575 | 317 |
| 128 | 3300005355 | Ga0070671_100072617 | Ga0070671_1000726172 | 317 |
| 129 | 3300005618 | Ga0068864_100011680 | Ga0068864_1000116802 | 317 |
| 130 | 3300005841 | Ga0068863_100017150 | Ga0068863_1000171506 | 317 |
| 131 | 3300005841 | Ga0068863_100029789 | Ga0068863_1000297892 | 317 |
| 132 | 3300005841 | Ga0068863_100048438 | Ga0068863_1000484383 | 317 |
| 133 | 3300005843 | Ga0068860_100000145 | Ga0068860_10000014575 | 317 |
| 134 | 3300005843 | Ga0068860_100005851 | Ga0068860_1000058519 | 317 |
| 135 | 3300005844 | Ga0068862_100035830 | Ga0068862_1000358304 | 317 |
| 136 | 3300005844 | Ga0068862_100044379 | Ga0068862_1000443793 | 317 |
| 137 | 3300006051 | Ga0075364_10181672 | Ga0075364_101816722 | 317 |
| 138 | 3300006846 | Ga0075430_100147872 | Ga0075430_1001478722 | 317 |
| 139 | 3300006847 | Ga0075431_100177859 | Ga0075431_1001778593 | 317 |
| 140 | 3300009093 | Ga0105240_10009914 | Ga0105240_100099143 | 317 |
| 141 | 3300010375 | Ga0105239_10013880 | Ga0105239_100138804 | 317 |
| 142 | 3300011119 | Ga0105246_10001758 | Ga0105246_100017584 | 317 |
| 143 | 3300025250 | Ga0209026_1002404 | Ga0209026_10024046 | 317 |
| 144 | 3300025250 | Ga0209026_1010061 | Ga0209026_10100612 | 317 |
| 145 | 3300025925 | Ga0207650_10233012 | Ga0207650_102330122 | 317 |
| 146 | 3300025931 | Ga0207644_10017521 | Ga0207644_100175212 | 317 |
| 147 | 3300025960 | Ga0207651_10010453 | Ga0207651_100104533 | 317 |
| 148 | 3300025972 | Ga0207668_10020100 | Ga0207668_100201004 | 317 |
| 149 | 3300025972 | Ga0207668_10199769 | Ga0207668_101997692 | 317 |
| 150 | 3300026088 | Ga0207641_10041949 | Ga0207641_100419493 | 317 |
| 151 | 3300026095 | Ga0207676_10213245 | Ga0207676_102132453 | 317 |
| 152 | 3300026121 | Ga0207683_10166835 | Ga0207683_101668352 | 317 |
| 153 | 3300028379 | Ga0268266_10152215 | Ga0268266_101522152 | 317 |
| 154 | 3300028380 | Ga0268265_10001646 | Ga0268265_100016467 | 317 |
| 155 | 3300028380 | Ga0268265_10128528 | Ga0268265_101285282 | 317 |
| 156 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046124 | 317 |
| 157 | 3300028800 | Ga0265338_10009737 | Ga0265338_100097376 | 317 |
| 158 | 3300031251 | Ga0265327_10000166 | Ga0265327_1000016614 | 317 |
| 159 | 3300031251 | Ga0265327_10007283 | Ga0265327_100072836 | 317 |
| 160 | 3300031251 | Ga0265327_10011393 | Ga0265327_100113932 | 317 |
| 161 | 3300031456 | Ga0307513_10011115 | Ga0307513_100111153 | 317 |
| 162 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004328 | 317 |
| 163 | 3300032005 | Ga0307411_10050488 | Ga0307411_100504882 | 317 |
| 164 | 3300036401 | Ga0373937_0013600 | Ga0373937_0013600_2827_3780 | 317 |
| 165 | 3300036401 | Ga0373937_0127051 | Ga0373937_0127051_75_1028 | 317 |
| 166 | 3300037068 | Ga0373925_0000478 | Ga0373925_0000478_28049_29014 | 317 |
| 167 | 3300037418 | Ga0395900_0025375 | Ga0395900_0025375_3266_4222 | 317 |
| 168 | 3300037853 | Ga0436364_1317670 | Ga0436364_1317670_416_1372 | 317 |
| 169 | 3300038443 | Ga0395901_0090200 | Ga0395901_0090200_674_1630 | 317 |
| 170 | 3300039450 | Ga0436363_1115256 | Ga0436363_1115256_341_1294 | 317 |
| 171 | 3300046506 | Ga0495583_0015880 | Ga0495583_0015880_2498_3460 | 317 |
| 172 | 3300046648 | Ga0495611_0040954 | Ga0495611_0040954_1027_1989 | 317 |
| 173 | 3300046660 | Ga0495625_0119778 | Ga0495625_0119778_459_1421 | 317 |
| 174 | 3300046684 | Ga0495669_0000294 | Ga0495669_0000294_12521_13573 | 317 |
| 175 | 3300046689 | Ga0495613_0032453 | Ga0495613_0032453_1300_2259 | 317 |
| 176 | 3300047320 | Ga0495672_0014263 | Ga0495672_0014263_2337_3299 | 317 |
| 177 | 3300047320 | Ga0495672_0028221 | Ga0495672_0028221_2581_3543 | 317 |
| 178 | 3300047444 | Ga0495675_0164140 | Ga0495675_0164140_59_1054 | 317 |
| 179 | 3300047445 | Ga0495677_0055591 | Ga0495677_0055591_328_1380 | 317 |
| 180 | 3300048911 | Ga0496108_0070755 | Ga0496108_0070755_1284_2246 | 317 |
| 181 | 3300048912 | Ga0496109_0005745 | Ga0496109_0005745_7486_8448 | 317 |
| 182 | 3300048915 | Ga0496112_0089451 | Ga0496112_0089451_558_1520 | 317 |
| 183 | 3300050507 | nmdc:mga05p37_65540_c1 | nmdc:mga05p37_65540_c1_2884_3840 | 317 |
| 184 | 3300050511 | nmdc:mga08y16_258484_c1 | nmdc:mga08y16_258484_c1_206_1162 | 317 |
| 185 | 3300053119 | Ga0500595_005331 | Ga0500595_005331_2498_3460 | 317 |
| 186 | 3300053119 | Ga0500595_025298 | Ga0500595_025298_1053_2009 | 317 |
| 187 | 3300005336 | Ga0070680_100236474 | Ga0070680_1002364742 | 318 |
| 188 | 3300005341 | Ga0070691_10000580 | Ga0070691_100005806 | 318 |
| 189 | 3300005366 | Ga0070659_100000206 | Ga0070659_10000020628 | 318 |
| 190 | 3300005366 | Ga0070659_100004222 | Ga0070659_1000042226 | 318 |
| 191 | 3300005458 | Ga0070681_10016924 | Ga0070681_100169247 | 318 |
| 192 | 3300005458 | Ga0070681_10051870 | Ga0070681_100518702 | 318 |
| 193 | 3300005539 | Ga0068853_100012010 | Ga0068853_1000120102 | 318 |
| 194 | 3300005548 | Ga0070665_100000116 | Ga0070665_10000011653 | 318 |
| 195 | 3300005563 | Ga0068855_100021204 | Ga0068855_1000212042 | 318 |
| 196 | 3300005563 | Ga0068855_100025315 | Ga0068855_1000253155 | 318 |
| 197 | 3300005577 | Ga0068857_100042032 | Ga0068857_1000420325 | 318 |
| 198 | 3300006881 | Ga0068865_100004207 | Ga0068865_1000042073 | 318 |
| 199 | 3300009093 | Ga0105240_10028781 | Ga0105240_100287817 | 318 |
| 200 | 3300009177 | Ga0105248_10000154 | Ga0105248_1000015454 | 318 |
| 201 | 3300010375 | Ga0105239_10442001 | Ga0105239_104420011 | 318 |
| 202 | 3300025909 | Ga0207705_10002109 | Ga0207705_100021092 | 318 |
| 203 | 3300025909 | Ga0207705_10062655 | Ga0207705_100626552 | 318 |
| 204 | 3300025913 | Ga0207695_10001670 | Ga0207695_1000167018 | 318 |
| 205 | 3300025913 | Ga0207695_10001727 | Ga0207695_1000172718 | 318 |
| 206 | 3300025913 | Ga0207695_10045033 | Ga0207695_100450335 | 318 |
| 207 | 3300025914 | Ga0207671_10154862 | Ga0207671_101548622 | 318 |
| 208 | 3300025917 | Ga0207660_10006636 | Ga0207660_100066366 | 318 |
| 209 | 3300025919 | Ga0207657_10007960 | Ga0207657_100079606 | 318 |
| 210 | 3300025921 | Ga0207652_10012704 | Ga0207652_100127045 | 318 |
| 211 | 3300025924 | Ga0207694_10054899 | Ga0207694_100548994 | 318 |
| 212 | 3300025932 | Ga0207690_10000129 | Ga0207690_1000012938 | 318 |
| 213 | 3300025932 | Ga0207690_10035123 | Ga0207690_100351232 | 318 |
| 214 | 3300025938 | Ga0207704_10000836 | Ga0207704_100008363 | 318 |
| 215 | 3300025941 | Ga0207711_10000887 | Ga0207711_100008876 | 318 |
| 216 | 3300025949 | Ga0207667_10012057 | Ga0207667_100120572 | 318 |
| 217 | 3300025949 | Ga0207667_10019640 | Ga0207667_100196401 | 318 |
| 218 | 3300026041 | Ga0207639_10034375 | Ga0207639_100343751 | 318 |
| 219 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064159 | 318 |
| 220 | 3300028786 | Ga0307517_10000497 | Ga0307517_100004975 | 318 |
| 221 | 3300035113 | Ga0373936_0019429 | Ga0373936_0019429_326_1291 | 318 |
| 222 | 3300037312 | Ga0395899_0000213 | Ga0395899_0000213_79131_80102 | 318 |
| 223 | 3300037418 | Ga0395900_0000121 | Ga0395900_0000121_130754_131725 | 318 |
| 224 | 3300037466 | Ga0395898_0000247 | Ga0395898_0000247_3302_4273 | 318 |
| 225 | 3300037471 | Ga0395905_0000112 | Ga0395905_0000112_3286_4257 | 318 |
| 226 | 3300038443 | Ga0395901_0000078 | Ga0395901_0000078_130754_131725 | 318 |
| 227 | 3300046454 | Ga0495592_0083857 | Ga0495592_0083857_1206_2171 | 318 |
| 228 | 3300046516 | Ga0495628_0051940 | Ga0495628_0051940_1081_2046 | 318 |
| 229 | 3300046543 | Ga0495645_0033156 | Ga0495645_0033156_1649_2614 | 318 |
| 230 | 3300048915 | Ga0496112_0070748 | Ga0496112_0070748_687_1664 | 318 |
| 231 | 3300048918 | Ga0496115_0029381 | Ga0496115_0029381_1228_2193 | 318 |
| 232 | 3300049569 | Ga0501032_0000064 | Ga0501032_0000064_33862_34839 | 318 |
| 233 | 3300049569 | Ga0501032_0002338 | Ga0501032_0002338_566_1531 | 318 |
| 234 | 3300049570 | Ga0501033_0000286 | Ga0501033_0000286_588_1565 | 318 |
| 235 | 3300049570 | Ga0501033_0007597 | Ga0501033_0007597_7361_8326 | 318 |
| 236 | 3300049570 | Ga0501033_0163235 | Ga0501033_0163235_74_1039 | 318 |
| 237 | 3300049571 | Ga0501034_0000174 | Ga0501034_0000174_38456_39433 | 318 |
| 238 | 3300049571 | Ga0501034_0089453 | Ga0501034_0089453_1975_2943 | 318 |
| 239 | 3300049571 | Ga0501034_0150148 | Ga0501034_0150148_1077_2036 | 318 |
| 240 | 3300049572 | Ga0501036_0011420 | Ga0501036_0011420_5840_6817 | 318 |
| 241 | 3300049573 | Ga0501037_0000147 | Ga0501037_0000147_96_1061 | 318 |
| 242 | 3300049573 | Ga0501037_0009152 | Ga0501037_0009152_542_1519 | 318 |
| 243 | 3300049574 | Ga0501038_0000031 | Ga0501038_0000031_117081_118058 | 318 |
| 244 | 3300049575 | Ga0501039_0000057 | Ga0501039_0000057_31647_32624 | 318 |
| 245 | 3300049579 | Ga0501043_0000048 | Ga0501043_0000048_38456_39433 | 318 |
| 246 | 3300049580 | Ga0501046_0216928 | Ga0501046_0216928_238_1215 | 318 |
| 247 | 3300049584 | Ga0501068_0205406 | Ga0501068_0205406_267_1226 | 318 |
| 248 | 3300049585 | Ga0501069_0000018 | Ga0501069_0000018_11790_12755 | 318 |
| 249 | 3300049585 | Ga0501069_0079075 | Ga0501069_0079075_878_1837 | 318 |
| 250 | 3300049586 | Ga0501070_0000048 | Ga0501070_0000048_12426_13391 | 318 |
| 251 | 3300049586 | Ga0501070_0245726 | Ga0501070_0245726_165_1124 | 318 |
| 252 | 3300049589 | Ga0501073_0057847 | Ga0501073_0057847_829_1788 | 318 |
| 253 | 3300049590 | Ga0501074_0000001 | Ga0501074_0000001_56956_57921 | 318 |
| 254 | 3300049742 | Ga0501080_0000197 | Ga0501080_0000197_28151_29116 | 318 |
| 255 | 3300049744 | Ga0501083_0005530 | Ga0501083_0005530_5465_6430 | 318 |
| 256 | 3300049744 | Ga0501083_0008221 | Ga0501083_0008221_4778_5737 | 318 |
| 257 | 3300049822 | Ga0501035_0000048 | Ga0501035_0000048_24183_25148 | 318 |
| 258 | 3300049822 | Ga0501035_0004746 | Ga0501035_0004746_9258_10223 | 318 |
| 259 | 3300049822 | Ga0501035_0130236 | Ga0501035_0130236_656_1633 | 318 |
| 260 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_228830_229795 | 318 |
| 261 | 3300049823 | Ga0501044_0010560 | Ga0501044_0010560_3478_4455 | 318 |
| 262 | 3300049823 | Ga0501044_0181045 | Ga0501044_0181045_1088_2053 | 318 |
| 263 | 3300060353 | Ga0501082_0003165 | Ga0501082_0003165_285_1244 | 318 |
| 264 | 3300001979 | JGI24740J21852_10021354 | JGI24740J21852_100213541 | 319 |
| 265 | 3300003775 | Ga0055524_1021494 | Ga0055524_10214942 | 319 |
| 266 | 3300005539 | Ga0068853_100012248 | Ga0068853_1000122484 | 319 |
| 267 | 3300005577 | Ga0068857_100008808 | Ga0068857_1000088083 | 319 |
| 268 | 3300005578 | Ga0068854_100026764 | Ga0068854_1000267642 | 319 |
| 269 | 3300005614 | Ga0068856_100017571 | Ga0068856_1000175713 | 319 |
| 270 | 3300005616 | Ga0068852_100020749 | Ga0068852_1000207493 | 319 |
| 271 | 3300005834 | Ga0068851_10001023 | Ga0068851_100010232 | 319 |
| 272 | 3300006186 | Ga0075369_10007154 | Ga0075369_100071543 | 319 |
| 273 | 3300009551 | Ga0105238_10021668 | Ga0105238_100216684 | 319 |
| 274 | 3300025292 | Ga0209676_1000057 | Ga0209676_100005720 | 319 |
| 275 | 3300025292 | Ga0209676_1001335 | Ga0209676_100133515 | 319 |
| 276 | 3300025298 | Ga0209050_1001221 | Ga0209050_100122113 | 319 |
| 277 | 3300025299 | Ga0209256_1002873 | Ga0209256_10028735 | 319 |
| 278 | 3300025303 | Ga0209051_1007128 | Ga0209051_10071285 | 319 |
| 279 | 3300025304 | Ga0209257_1001883 | Ga0209257_100188312 | 319 |
| 280 | 3300025911 | Ga0207654_10001364 | Ga0207654_100013642 | 319 |
| 281 | 3300025913 | Ga0207695_10017258 | Ga0207695_100172583 | 319 |
| 282 | 3300025924 | Ga0207694_10000504 | Ga0207694_1000050418 | 319 |
| 283 | 3300025949 | Ga0207667_10045788 | Ga0207667_100457882 | 319 |
| 284 | 3300025981 | Ga0207640_10156569 | Ga0207640_101565692 | 319 |
| 285 | 3300026067 | Ga0207678_10121787 | Ga0207678_101217873 | 319 |
| 286 | 3300026078 | Ga0207702_10000093 | Ga0207702_1000009345 | 319 |
| 287 | 3300026142 | Ga0207698_10026177 | Ga0207698_100261772 | 319 |
| 288 | 3300028794 | Ga0307515_10047013 | Ga0307515_100470133 | 319 |
| 289 | 3300046460 | Ga0495638_0000260 | Ga0495638_0000260_53232_54224 | 319 |
| 290 | 3300046616 | Ga0495668_0000345 | Ga0495668_0000345_6609_7586 | 319 |
| 291 | 3300046660 | Ga0495625_0000342 | Ga0495625_0000342_7878_8855 | 319 |
| 292 | 3300048927 | Ga0496124_0015953 | Ga0496124_0015953_963_1940 | 319 |
| 293 | 3300048928 | Ga0496125_0096951 | Ga0496125_0096951_888_1865 | 319 |
| 294 | 3300049589 | Ga0501073_0073794 | Ga0501073_0073794_1024_1986 | 319 |
| 295 | 3300050516 | nmdc:mga0sz30_16976_c1 | nmdc:mga0sz30_16976_c1_838_1815 | 319 |
| 296 | 3300053122 | Ga0500608_000025 | Ga0500608_000025_54286_55302 | 319 |
| 297 | 3300053136 | Ga0500559_0001640 | Ga0500559_0001640_4088_5065 | 319 |
| 298 | 3300053156 | Ga0500622_0005488 | Ga0500622_0005488_3689_4666 | 319 |
| 299 | iso_pu_bacteria | 2857504554 | 2857506244 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5exk-assembly6.cif.gz_K | crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate | 0.9795 | 26 | 314 |
| 4u0p-assembly1.cif.gz_B | the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine | 0.9614 | 29 | 303 |
| 5exk-assembly6.cif.gz_K | crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate | 0.947 | 26 | 314 |
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.9469 | 32 | 303 |
| 4u0o-assembly1.cif.gz_B | crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt | 0.9367 | 32 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60716_82_298_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9928 | 76 | 288 | 3.20.20.70 |
| af_Q2FZX4_3_265_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9863 | 27 | 283 | 3.20.20.70 |
| af_P9WK91_74_280_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9849 | 80 | 288 | 3.20.20.70 |
| af_P9WK91_74_280_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9802 | 80 | 288 | 3.20.20.70 |
| af_P0CH67_115_331_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9726 | 70 | 278 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531YMD4-F1-model_v4 | deleted | 0.9991 | 117 | 301 |
|
| AF-A0A436B320-F1-model_v4 | lipoyl synthase (EC 2.8.1.8) | 0.9952 | 80 | 316 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A535Q8R3-F1-model_v4 | Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) | 0.9949 | 81 | 305 |
GO:0005737
GO:0016992 GO:0046872 GO:0051539 |
| AF-X1G6A7-F1-model_v4 | lipoyl synthase (EC 2.8.1.8) | 0.9949 | 84 | 305 |
GO:0016992
GO:0046872 GO:0051539 |
| AF-A0A2S6RRG8-F1-model_v4 | Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) | 0.994 | 81 | 316 |
GO:0005737
GO:0016992 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar