F394957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 196 | 296 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0004169|Ga0451577_0004169_4040_4918 |
| Length | 265 |
| Sequence | MGPTHRRANSLSADTDATRRIVFVAPSSHEVFVKGASSRPVRNLLISSLPRGERDRMIAHCEPFELVFGTVVCIPDRPYREVYFPLRGFISLVKVMRDHPPMEMALIGNEGMLGATMILNTAIAPLRAIVQGAGSALRMSASHFQRELADSANLRRALDRYLYATMADSSQTAACAYFHEVGARLARWLLMTHDRAHADHFHLTHQFMADMLGVQRSAITIAAGELQDKKIIRYTRGEISILDRRGLEGASCECYAALRKRQARR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 2 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 3 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 130 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 144 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 145 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 147 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 154 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 155 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 156 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 157 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 158 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 159 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 160 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 161 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 162 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 163 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 164 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 165 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 166 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 167 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 168 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 169 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 170 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 171 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 172 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 188 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 189 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 190 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 191 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 195 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 196 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 0 |
| Isolates | 1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.02 |
| Nodule | 0 |
| Rhizoplane | 3.01 |
| Rhizosphere | 87.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000522 | 3300001904 | Bacteria | 7161 |
| 2 | JGI25156J39149_1001992 | 3300002705 | Bacteria | 7830 |
| 3 | JGI25162J39368_1000344 | 3300002737 | Bacteria | 40143 |
| 4 | JGI25154J39366_1000337 | 3300002738 | Bacteria | 27001 |
| 5 | JGI25157J39369_1000073 | 3300002741 | Bacteria | 88360 |
| 6 | JGI25157J39369_1000296 | 3300002741 | Bacteria | 36294 |
| 7 | JGI25163J39215_1000856 | 3300002771 | Bacteria | 7262 |
| 8 | JGI25164J39214_1000253 | 3300002772 | Bacteria | 40203 |
| 9 | JGI25164J39214_1000255 | 3300002772 | Bacteria | 40111 |
| 10 | JGI25164J39214_1001614 | 3300002772 | Bacteria | 4741 |
| 11 | JGI25165J46597_1000463 | 3300003214 | Bacteria | 40143 |
| 12 | Ga0065707_10158201 | 3300005295 | Unclassified | 1588 |
| 13 | Ga0070658_10042194 | 3300005327 | Bacteria | 3682 |
| 14 | Ga0070670_100000054 | 3300005331 | Bacteria | 127396 |
| 15 | Ga0070666_10000295 | 3300005335 | Bacteria | 32526 |
| 16 | Ga0070666_10008211 | 3300005335 | Bacteria | 6471 |
| 17 | Ga0068868_100038593 | 3300005338 | Bacteria | 3708 |
| 18 | Ga0068868_100186182 | 3300005338 | Bacteria | 1725 |
| 19 | Ga0070660_100006833 | 3300005339 | Bacteria | 7914 |
| 20 | Ga0070689_100542812 | 3300005340 | Bacteria | 1001 |
| 21 | Ga0070691_10438880 | 3300005341 | Unclassified | 743 |
| 22 | Ga0070668_100004327 | 3300005347 | Bacteria | 10533 |
| 23 | Ga0070669_100001255 | 3300005353 | Bacteria | 18423 |
| 24 | Ga0070669_100432362 | 3300005353 | Unclassified | 1082 |
| 25 | Ga0070675_100119554 | 3300005354 | Bacteria | 2238 |
| 26 | Ga0070671_100000037 | 3300005355 | Bacteria | 95248 |
| 27 | Ga0070671_100460127 | 3300005355 | Bacteria | 1092 |
| 28 | Ga0070673_100002495 | 3300005364 | Bacteria | 11227 |
| 29 | Ga0070673_100381762 | 3300005364 | Bacteria | 1256 |
| 30 | Ga0070688_100075041 | 3300005365 | Bacteria | 2173 |
| 31 | Ga0070688_100171130 | 3300005365 | Bacteria | 1499 |
| 32 | Ga0070659_100109501 | 3300005366 | Bacteria | 2229 |
| 33 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 34 | Ga0070667_100001412 | 3300005367 | Bacteria | 21492 |
| 35 | Ga0070667_100296572 | 3300005367 | Bacteria | 1455 |
| 36 | Ga0070667_100643567 | 3300005367 | Bacteria | 979 |
| 37 | Ga0070709_10123417 | 3300005434 | Bacteria | 1759 |
| 38 | Ga0070711_100015624 | 3300005439 | Bacteria | 4807 |
| 39 | Ga0070708_100435867 | 3300005445 | Bacteria | 1236 |
| 40 | Ga0070663_100041321 | 3300005455 | Bacteria | 3233 |
| 41 | Ga0070663_100061824 | 3300005455 | Bacteria | 2698 |
| 42 | Ga0070662_100003879 | 3300005457 | Bacteria | 9373 |
| 43 | Ga0070681_10060295 | 3300005458 | Bacteria | 3771 |
| 44 | Ga0068867_100095674 | 3300005459 | Bacteria | 2260 |
| 45 | Ga0070685_10000014 | 3300005466 | Bacteria | 120530 |
| 46 | Ga0070685_10000845 | 3300005466 | Bacteria | 16665 |
| 47 | Ga0070685_10457585 | 3300005466 | Bacteria | 895 |
| 48 | Ga0070684_100263999 | 3300005535 | Bacteria | 1575 |
| 49 | Ga0068853_100168441 | 3300005539 | Bacteria | 1981 |
| 50 | Ga0070665_100000097 | 3300005548 | Bacteria | 166302 |
| 51 | Ga0070665_100000414 | 3300005548 | Bacteria | 62478 |
| 52 | Ga0070665_100013053 | 3300005548 | Bacteria | 8365 |
| 53 | Ga0070665_100067901 | 3300005548 | Bacteria | 3575 |
| 54 | Ga0070665_100147018 | 3300005548 | Bacteria | 2360 |
| 55 | Ga0070704_100198833 | 3300005549 | Unclassified | 1617 |
| 56 | Ga0068855_100007451 | 3300005563 | Bacteria | 13252 |
| 57 | Ga0068855_100023082 | 3300005563 | Bacteria | 7455 |
| 58 | Ga0068855_100517416 | 3300005563 | Bacteria | 1295 |
| 59 | Ga0070664_100205628 | 3300005564 | Bacteria | 1758 |
| 60 | Ga0068857_100004102 | 3300005577 | Bacteria | 12273 |
| 61 | Ga0068857_100438601 | 3300005577 | Bacteria | 1220 |
| 62 | Ga0068854_100001345 | 3300005578 | Bacteria | 14809 |
| 63 | Ga0068854_100002155 | 3300005578 | Bacteria | 12081 |
| 64 | Ga0068854_100423562 | 3300005578 | Bacteria | 1106 |
| 65 | Ga0068856_100001352 | 3300005614 | Bacteria | 25767 |
| 66 | Ga0068856_100307921 | 3300005614 | Bacteria | 1602 |
| 67 | Ga0068852_100168391 | 3300005616 | Bacteria | 2052 |
| 68 | Ga0068852_100418152 | 3300005616 | Bacteria | 1322 |
| 69 | Ga0068852_100442710 | 3300005616 | Bacteria | 1285 |
| 70 | Ga0068859_100000201 | 3300005617 | Bacteria | 58643 |
| 71 | Ga0068859_100010515 | 3300005617 | Bacteria | 9313 |
| 72 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 73 | Ga0068851_10000410 | 3300005834 | Bacteria | 19327 |
| 74 | Ga0068863_100255131 | 3300005841 | Bacteria | 1695 |
| 75 | Ga0068863_101053857 | 3300005841 | Bacteria | 817 |
| 76 | Ga0068858_100000101 | 3300005842 | Bacteria | 89093 |
| 77 | Ga0068858_100074684 | 3300005842 | Bacteria | 3148 |
| 78 | Ga0068858_100124896 | 3300005842 | Bacteria | 2408 |
| 79 | Ga0068860_100000844 | 3300005843 | Bacteria | 34309 |
| 80 | Ga0068862_100000245 | 3300005844 | Bacteria | 60375 |
| 81 | Ga0068862_100003526 | 3300005844 | Bacteria | 13422 |
| 82 | Ga0075367_10100618 | 3300006178 | Bacteria | 1766 |
| 83 | Ga0097621_100388225 | 3300006237 | Bacteria | 1248 |
| 84 | Ga0075428_100013936 | 3300006844 | Bacteria | 8951 |
| 85 | Ga0075428_101154686 | 3300006844 | Unclassified | 817 |
| 86 | Ga0075429_100007417 | 3300006880 | Bacteria | 9516 |
| 87 | Ga0068865_100063633 | 3300006881 | Bacteria | 2594 |
| 88 | Ga0097620_100000201 | 3300006931 | Bacteria | 58643 |
| 89 | Ga0097620_100010515 | 3300006931 | Bacteria | 9313 |
| 90 | Ga0075435_100576015 | 3300007076 | Bacteria | 976 |
| 91 | Ga0105240_10002052 | 3300009093 | Bacteria | 33049 |
| 92 | Ga0105240_10010127 | 3300009093 | Bacteria | 13270 |
| 93 | Ga0105240_10387300 | 3300009093 | Bacteria | 1577 |
| 94 | Ga0105240_10566119 | 3300009093 | Bacteria | 1255 |
| 95 | Ga0111539_10027861 | 3300009094 | Bacteria | 6898 |
| 96 | Ga0105247_10125195 | 3300009101 | Bacteria | 1669 |
| 97 | Ga0105241_10006269 | 3300009174 | Bacteria | 8769 |
| 98 | Ga0105242_10054422 | 3300009176 | Bacteria | 3271 |
| 99 | Ga0105237_10037838 | 3300009545 | Bacteria | 4875 |
| 100 | Ga0105237_10049128 | 3300009545 | Bacteria | 4242 |
| 101 | Ga0105237_10423265 | 3300009545 | Bacteria | 1337 |
| 102 | Ga0105238_10000728 | 3300009551 | Bacteria | 34336 |
| 103 | Ga0105249_10409557 | 3300009553 | Bacteria | 1388 |
| 104 | Ga0105239_10007582 | 3300010375 | Bacteria | 12436 |
| 105 | Ga0105239_10015410 | 3300010375 | Bacteria | 8470 |
| 106 | Ga0105239_11215351 | 3300010375 | Bacteria | 869 |
| 107 | Ga0157371_10236217 | 3300013102 | Bacteria | 1314 |
| 108 | Ga0157370_10005720 | 3300013104 | Bacteria | 13898 |
| 109 | Ga0157370_10126564 | 3300013104 | Bacteria | 2384 |
| 110 | Ga0157369_10878130 | 3300013105 | Bacteria | 920 |
| 111 | Ga0163162_10029638 | 3300013306 | Bacteria | 5417 |
| 112 | Ga0163162_10030302 | 3300013306 | Bacteria | 5361 |
| 113 | Ga0157375_10423096 | 3300013308 | Bacteria | 1498 |
| 114 | Ga0157375_10722889 | 3300013308 | Unclassified | 1148 |
| 115 | Ga0163163_10000762 | 3300014325 | Bacteria | 27407 |
| 116 | Ga0163163_10551451 | 3300014325 | Bacteria | 1215 |
| 117 | Ga0157380_10049744 | 3300014326 | Bacteria | 3307 |
| 118 | Ga0157380_10255642 | 3300014326 | Bacteria | 1588 |
| 119 | Ga0157380_10663434 | 3300014326 | Bacteria | 1042 |
| 120 | Ga0157379_10103429 | 3300014968 | Bacteria | 2556 |
| 121 | Ga0157379_10315780 | 3300014968 | Bacteria | 1426 |
| 122 | Ga0157376_10108297 | 3300014969 | Bacteria | 2441 |
| 123 | Ga0163161_10546207 | 3300017792 | Bacteria | 949 |
| 124 | Ga0163161_10841840 | 3300017792 | Bacteria | 773 |
| 125 | Ga0209760_100162 | 3300025207 | Bacteria | 40192 |
| 126 | Ga0207427_100114 | 3300025231 | Bacteria | 104357 |
| 127 | Ga0207427_100272 | 3300025231 | Bacteria | 39011 |
| 128 | Ga0209437_100219 | 3300025233 | Bacteria | 104357 |
| 129 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 130 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 131 | Ga0209677_100087 | 3300025253 | Bacteria | 109892 |
| 132 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 133 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 134 | Ga0209233_1005094 | 3300025261 | Bacteria | 4396 |
| 135 | Ga0207680_10001552 | 3300025903 | Bacteria | 10822 |
| 136 | Ga0207680_10018041 | 3300025903 | Bacteria | 3741 |
| 137 | Ga0207647_10000075 | 3300025904 | Bacteria | 76289 |
| 138 | Ga0207705_10515306 | 3300025909 | Bacteria | 929 |
| 139 | Ga0207707_10072023 | 3300025912 | Bacteria | 3012 |
| 140 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 141 | Ga0207695_10013841 | 3300025913 | Bacteria | 9596 |
| 142 | Ga0207695_10015797 | 3300025913 | Bacteria | 8867 |
| 143 | Ga0207695_10020026 | 3300025913 | Bacteria | 7679 |
| 144 | Ga0207695_10341422 | 3300025913 | Unclassified | 1385 |
| 145 | Ga0207671_10031099 | 3300025914 | Bacteria | 3980 |
| 146 | Ga0207671_10033248 | 3300025914 | Bacteria | 3837 |
| 147 | Ga0207671_10082258 | 3300025914 | Bacteria | 2416 |
| 148 | Ga0207657_10033413 | 3300025919 | Bacteria | 4637 |
| 149 | Ga0207657_10163845 | 3300025919 | Bacteria | 1804 |
| 150 | Ga0207681_10018937 | 3300025923 | Bacteria | 4342 |
| 151 | Ga0207681_10205712 | 3300025923 | Bacteria | 1514 |
| 152 | Ga0207694_10000363 | 3300025924 | Bacteria | 42675 |
| 153 | Ga0207694_10000566 | 3300025924 | Bacteria | 33540 |
| 154 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 155 | Ga0207644_10000192 | 3300025931 | Bacteria | 43758 |
| 156 | Ga0207690_10096913 | 3300025932 | Bacteria | 2098 |
| 157 | Ga0207690_10432047 | 3300025932 | Bacteria | 1055 |
| 158 | Ga0207706_10032847 | 3300025933 | Bacteria | 4618 |
| 159 | Ga0207686_10100850 | 3300025934 | Bacteria | 1927 |
| 160 | Ga0207686_10191935 | 3300025934 | Bacteria | 1457 |
| 161 | Ga0207704_10478762 | 3300025938 | Bacteria | 999 |
| 162 | Ga0207691_10617912 | 3300025940 | Bacteria | 917 |
| 163 | Ga0207711_10000061 | 3300025941 | Bacteria | 125523 |
| 164 | Ga0207711_10000827 | 3300025941 | Bacteria | 30250 |
| 165 | Ga0207689_10035513 | 3300025942 | Bacteria | 4141 |
| 166 | Ga0207661_10601368 | 3300025944 | Bacteria | 1009 |
| 167 | Ga0207667_10019398 | 3300025949 | Bacteria | 7592 |
| 168 | Ga0207667_10342920 | 3300025949 | Bacteria | 1524 |
| 169 | Ga0207667_10682168 | 3300025949 | Bacteria | 1031 |
| 170 | Ga0207651_10003708 | 3300025960 | Bacteria | 7556 |
| 171 | Ga0207712_10000211 | 3300025961 | Bacteria | 58110 |
| 172 | Ga0207712_10113078 | 3300025961 | Bacteria | 2040 |
| 173 | Ga0207668_10198562 | 3300025972 | Bacteria | 1595 |
| 174 | Ga0207640_10003703 | 3300025981 | Bacteria | 8242 |
| 175 | Ga0207640_10005245 | 3300025981 | Bacteria | 7052 |
| 176 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 177 | Ga0207658_10100958 | 3300025986 | Bacteria | 2260 |
| 178 | Ga0207658_10448987 | 3300025986 | Bacteria | 1141 |
| 179 | Ga0207677_10084113 | 3300026023 | Bacteria | 2292 |
| 180 | Ga0207677_10270434 | 3300026023 | Bacteria | 1390 |
| 181 | Ga0207703_10000180 | 3300026035 | Bacteria | 73584 |
| 182 | Ga0207703_10056791 | 3300026035 | Bacteria | 3190 |
| 183 | Ga0207703_10083276 | 3300026035 | Bacteria | 2672 |
| 184 | Ga0207639_10000367 | 3300026041 | Bacteria | 31306 |
| 185 | Ga0207678_10004319 | 3300026067 | Bacteria | 12759 |
| 186 | Ga0207678_10014983 | 3300026067 | Bacteria | 6821 |
| 187 | Ga0207678_10025246 | 3300026067 | Bacteria | 5187 |
| 188 | Ga0207702_10001314 | 3300026078 | Bacteria | 24905 |
| 189 | Ga0207641_10053218 | 3300026088 | Bacteria | 3430 |
| 190 | Ga0207641_10112071 | 3300026088 | Bacteria | 2420 |
| 191 | Ga0207641_10364410 | 3300026088 | Bacteria | 1381 |
| 192 | Ga0207648_10045250 | 3300026089 | Bacteria | 3860 |
| 193 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 194 | Ga0207674_10004669 | 3300026116 | Bacteria | 16444 |
| 195 | Ga0207674_10104345 | 3300026116 | Bacteria | 2813 |
| 196 | Ga0207674_10328318 | 3300026116 | Bacteria | 1479 |
| 197 | Ga0207698_10237017 | 3300026142 | Bacteria | 1660 |
| 198 | Ga0207698_10646272 | 3300026142 | Bacteria | 1047 |
| 199 | Ga0207698_10899546 | 3300026142 | Bacteria | 892 |
| 200 | Ga0207428_10032334 | 3300027907 | Bacteria | 4304 |
| 201 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 202 | Ga0268266_10000101 | 3300028379 | Bacteria | 180443 |
| 203 | Ga0268266_10023465 | 3300028379 | Bacteria | 5254 |
| 204 | Ga0268265_10000509 | 3300028380 | Bacteria | 39997 |
| 205 | Ga0268265_10000888 | 3300028380 | Bacteria | 27896 |
| 206 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 207 | Ga0268264_10038744 | 3300028381 | Bacteria | 3935 |
| 208 | Ga0268264_10185404 | 3300028381 | Bacteria | 1893 |
| 209 | Ga0265331_10015456 | 3300031250 | Bacteria | 4029 |
| 210 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 211 | Ga0265327_10000540 | 3300031251 | Bacteria | 64733 |
| 212 | Ga0265327_10022809 | 3300031251 | Bacteria | 3727 |
| 213 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 214 | Ga0307408_100000060 | 3300031548 | Bacteria | 132341 |
| 215 | Ga0307408_100005552 | 3300031548 | Bacteria | 8427 |
| 216 | Ga0307408_100010436 | 3300031548 | Bacteria | 6127 |
| 217 | Ga0316575_10014033 | 3300031665 | Bacteria | 3002 |
| 218 | Ga0316579_10011287 | 3300031691 | Bacteria | 3795 |
| 219 | Ga0316576_10145716 | 3300031727 | Bacteria | 1783 |
| 220 | Ga0316576_10399424 | 3300031727 | Bacteria | 1018 |
| 221 | Ga0316578_10011297 | 3300031728 | Bacteria | 4665 |
| 222 | Ga0307405_10002728 | 3300031731 | Bacteria | 7903 |
| 223 | Ga0316577_10002020 | 3300031733 | Bacteria | 9890 |
| 224 | Ga0316577_10024646 | 3300031733 | Bacteria | 3345 |
| 225 | Ga0307410_10007663 | 3300031852 | Bacteria | 5924 |
| 226 | Ga0307406_10005694 | 3300031901 | Bacteria | 6818 |
| 227 | Ga0307406_10011237 | 3300031901 | Bacteria | 5076 |
| 228 | Ga0307412_10010890 | 3300031911 | Bacteria | 5251 |
| 229 | Ga0307412_10319213 | 3300031911 | Bacteria | 1235 |
| 230 | Ga0307409_100052381 | 3300031995 | Bacteria | 3129 |
| 231 | Ga0307416_100000500 | 3300032002 | Bacteria | 19946 |
| 232 | Ga0307414_10134005 | 3300032004 | Bacteria | 1928 |
| 233 | Ga0307411_10001394 | 3300032005 | Bacteria | 9817 |
| 234 | Ga0307415_100006019 | 3300032126 | Bacteria | 6498 |
| 235 | Ga0316583_10045941 | 3300032133 | Bacteria | 1541 |
| 236 | Ga0316580_10007702 | 3300032139 | Bacteria | 3214 |
| 237 | Ga0316580_10017612 | 3300032139 | Bacteria | 2197 |
| 238 | Ga0316574_0037530 | 3300035398 | Bacteria | 2972 |
| 239 | Ga0316574_0038101 | 3300035398 | Bacteria | 2950 |
| 240 | Ga0316582_0053388 | 3300036647 | Bacteria | 2570 |
| 241 | Ga0316584_0044703 | 3300036712 | Bacteria | 3303 |
| 242 | Ga0395900_0511453 | 3300037418 | Bacteria | 1150 |
| 243 | Ga0395898_0014144 | 3300037466 | Bacteria | 8204 |
| 244 | Ga0395905_0166910 | 3300037471 | Bacteria | 2069 |
| 245 | Ga0316581_0038956 | 3300037588 | Bacteria | 1446 |
| 246 | Ga0395901_0050631 | 3300038443 | Bacteria | 4314 |
| 247 | Ga0439466_0002189 | 3300041411 | Bacteria | 7652 |
| 248 | Ga0439437_000160 | 3300042000 | Bacteria | 5623 |
| 249 | Ga0439443_010391 | 3300042003 | Bacteria | 1348 |
| 250 | Ga0439445_0107636 | 3300042004 | Unclassified | 794 |
| 251 | Ga0439456_003630 | 3300042013 | Bacteria | 3134 |
| 252 | Ga0450911_000005 | 3300042115 | Bacteria | 233469 |
| 253 | Ga0450919_014656 | 3300042121 | Bacteria | 885 |
| 254 | Ga0450923_000102 | 3300042125 | Bacteria | 7136 |
| 255 | Ga0450923_013510 | 3300042125 | Bacteria | 1502 |
| 256 | Ga0450891_000598 | 3300042129 | Bacteria | 3768 |
| 257 | Ga0450894_011476 | 3300042131 | Bacteria | 1154 |
| 258 | Ga0450896_006872 | 3300042133 | Bacteria | 1565 |
| 259 | Ga0450904_000005 | 3300042139 | Bacteria | 60724 |
| 260 | Ga0450905_009968 | 3300042142 | Bacteria | 1311 |
| 261 | Ga0439446_0000061 | 3300042156 | Bacteria | 17244 |
| 262 | Ga0439446_0004824 | 3300042156 | Bacteria | 3437 |
| 263 | Ga0439446_0007462 | 3300042156 | Bacteria | 2876 |
| 264 | Ga0450908_000502 | 3300042184 | Bacteria | 7531 |
| 265 | Ga0439434_0000822 | 3300042435 | Bacteria | 8930 |
| 266 | Ga0439434_0010720 | 3300042435 | Bacteria | 2703 |
| 267 | Ga0439435_0000056 | 3300042436 | Bacteria | 13063 |
| 268 | Ga0439444_0014027 | 3300042437 | Bacteria | 1334 |
| 269 | Ga0439460_0003830 | 3300042461 | Bacteria | 3643 |
| 270 | Ga0450893_0001549 | 3300042532 | Bacteria | 3533 |
| 271 | Ga0451577_0004169 | 3300042876 | Bacteria | 15450 |
| 272 | Ga0453684_0199115 | 3300044712 | Bacteria | 2336 |
| 273 | Ga0451576_0252293 | 3300045051 | Bacteria | 1844 |
| 274 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 275 | Ga0495606_0002925 | 3300046507 | Bacteria | 18870 |
| 276 | Ga0495625_0004543 | 3300046660 | Bacteria | 13068 |
| 277 | Ga0495671_0016295 | 3300046692 | Bacteria | 3971 |
| 278 | Ga0495649_0000556 | 3300046694 | Bacteria | 31605 |
| 279 | Ga0496104_0016024 | 3300048907 | Bacteria | 6805 |
| 280 | Ga0496104_0497370 | 3300048907 | Bacteria | 1130 |
| 281 | Ga0496105_0001925 | 3300048908 | Bacteria | 14912 |
| 282 | Ga0496105_0538890 | 3300048908 | Bacteria | 912 |
| 283 | Ga0496108_0117131 | 3300048911 | Bacteria | 2282 |
| 284 | Ga0496112_0107826 | 3300048915 | Bacteria | 2755 |
| 285 | Ga0496113_0424930 | 3300048916 | Bacteria | 1067 |
| 286 | Ga0496115_0351838 | 3300048918 | Bacteria | 1201 |
| 287 | Ga0496118_0012612 | 3300048921 | Bacteria | 8089 |
| 288 | Ga0496125_0022425 | 3300048928 | Bacteria | 5864 |
| 289 | Ga0501257_011515 | 3300049686 | Bacteria | 2019 |
| 290 | Ga0501265_003851 | 3300049762 | Bacteria | 1704 |
| 291 | nmdc:mga06z11_88083_c1 | 3300050494 | Bacteria | 1680 |
| 292 | nmdc:mga09592_23184_c1 | 3300050508 | Bacteria | 5124 |
| 293 | nmdc:mga08y16_52944_c1 | 3300050511 | Bacteria | 4245 |
| 294 | Ga0500650_0000024 | 3300053098 | Bacteria | 61088 |
| 295 | Ga0500595_007427 | 3300053119 | Bacteria | 4548 |
| 296 | Ga0500636_0034270 | 3300053177 | Bacteria | 3004 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002772 | JGI25164J39214_1001614 | JGI25164J39214_10016146 | 211 |
| 2 | 3300005364 | Ga0070673_100002495 | Ga0070673_1000024953 | 211 |
| 3 | 3300009093 | Ga0105240_10387300 | Ga0105240_103873002 | 211 |
| 4 | 3300025231 | Ga0207427_100272 | Ga0207427_10027226 | 211 |
| 5 | 3300025909 | Ga0207705_10515306 | Ga0207705_105153062 | 211 |
| 6 | 3300025919 | Ga0207657_10033413 | Ga0207657_100334133 | 211 |
| 7 | 3300025932 | Ga0207690_10096913 | Ga0207690_100969132 | 211 |
| 8 | 3300037466 | Ga0395898_0014144 | Ga0395898_0014144_5436_6071 | 211 |
| 9 | 3300038443 | Ga0395901_0050631 | Ga0395901_0050631_143_778 | 211 |
| 10 | 3300017792 | Ga0163161_10546207 | Ga0163161_105462072 | 214 |
| 11 | 3300037471 | Ga0395905_0166910 | Ga0395905_0166910_1400_2044 | 214 |
| 12 | 3300013104 | Ga0157370_10005720 | Ga0157370_100057201 | 217 |
| 13 | 3300026088 | Ga0207641_10364410 | Ga0207641_103644101 | 217 |
| 14 | 3300014969 | Ga0157376_10108297 | Ga0157376_101082972 | 218 |
| 15 | 3300025942 | Ga0207689_10035513 | Ga0207689_100355134 | 218 |
| 16 | 3300007076 | Ga0075435_100576015 | Ga0075435_1005760152 | 219 |
| 17 | 3300046660 | Ga0495625_0004543 | Ga0495625_0004543_2971_3630 | 219 |
| 18 | 3300013308 | Ga0157375_10423096 | Ga0157375_104230962 | 220 |
| 19 | 3300044712 | Ga0453684_0199115 | Ga0453684_0199115_439_1110 | 222 |
| 20 | 3300013306 | Ga0163162_10029638 | Ga0163162_100296383 | 225 |
| 21 | 3300013308 | Ga0157375_10722889 | Ga0157375_107228892 | 225 |
| 22 | 3300042156 | Ga0439446_0007462 | Ga0439446_0007462_1512_2192 | 226 |
| 23 | 3300042435 | Ga0439434_0010720 | Ga0439434_0010720_1200_1880 | 226 |
| 24 | 3300041411 | Ga0439466_0002189 | Ga0439466_0002189_2969_3652 | 227 |
| 25 | iso_pu_bacteria | 2600255389 | 2602010913 | 227 |
| 26 | 3300005295 | Ga0065707_10158201 | Ga0065707_101582012 | 228 |
| 27 | 3300006844 | Ga0075428_100013936 | Ga0075428_1000139365 | 228 |
| 28 | 3300006880 | Ga0075429_100007417 | Ga0075429_10000741711 | 228 |
| 29 | 3300027907 | Ga0207428_10032334 | Ga0207428_100323342 | 228 |
| 30 | 3300002737 | JGI25162J39368_1000344 | JGI25162J39368_10003445 | 229 |
| 31 | 3300002771 | JGI25163J39215_1000856 | JGI25163J39215_10008567 | 229 |
| 32 | 3300002772 | JGI25164J39214_1000253 | JGI25164J39214_10002535 | 229 |
| 33 | 3300002772 | JGI25164J39214_1000255 | JGI25164J39214_100025533 | 229 |
| 34 | 3300003214 | JGI25165J46597_1000463 | JGI25165J46597_10004635 | 229 |
| 35 | 3300025207 | Ga0209760_100162 | Ga0209760_1001625 | 229 |
| 36 | 3300025231 | Ga0207427_100114 | Ga0207427_10011459 | 229 |
| 37 | 3300025233 | Ga0209437_100219 | Ga0209437_10021959 | 229 |
| 38 | 3300025261 | Ga0209233_1000012 | Ga0209233_1000012871 | 229 |
| 39 | 3300031548 | Ga0307408_100010436 | Ga0307408_1000104363 | 229 |
| 40 | 3300031731 | Ga0307405_10002728 | Ga0307405_100027283 | 229 |
| 41 | 3300031852 | Ga0307410_10007663 | Ga0307410_100076634 | 229 |
| 42 | 3300031911 | Ga0307412_10010890 | Ga0307412_100108904 | 229 |
| 43 | 3300031995 | Ga0307409_100052381 | Ga0307409_1000523812 | 229 |
| 44 | 3300032002 | Ga0307416_100000500 | Ga0307416_10000050016 | 229 |
| 45 | 3300032004 | Ga0307414_10134005 | Ga0307414_101340051 | 229 |
| 46 | 3300032005 | Ga0307411_10001394 | Ga0307411_100013944 | 229 |
| 47 | 3300032126 | Ga0307415_100006019 | Ga0307415_1000060192 | 229 |
| 48 | 3300042003 | Ga0439443_010391 | Ga0439443_010391_541_1230 | 229 |
| 49 | 3300042004 | Ga0439445_0107636 | Ga0439445_0107636_15_704 | 229 |
| 50 | 3300042125 | Ga0450923_000102 | Ga0450923_000102_2074_2763 | 229 |
| 51 | 3300042131 | Ga0450894_011476 | Ga0450894_011476_408_1097 | 229 |
| 52 | 3300042133 | Ga0450896_006872 | Ga0450896_006872_91_780 | 229 |
| 53 | 3300042156 | Ga0439446_0000061 | Ga0439446_0000061_14036_14725 | 229 |
| 54 | 3300042184 | Ga0450908_000502 | Ga0450908_000502_4977_5666 | 229 |
| 55 | 3300042435 | Ga0439434_0000822 | Ga0439434_0000822_1859_2548 | 229 |
| 56 | 3300042436 | Ga0439435_0000056 | Ga0439435_0000056_4577_5266 | 229 |
| 57 | 3300042437 | Ga0439444_0014027 | Ga0439444_0014027_486_1175 | 229 |
| 58 | 3300042461 | Ga0439460_0003830 | Ga0439460_0003830_2272_2961 | 229 |
| 59 | 3300002705 | JGI25156J39149_1001992 | JGI25156J39149_10019928 | 230 |
| 60 | 3300002738 | JGI25154J39366_1000337 | JGI25154J39366_100033713 | 230 |
| 61 | 3300002741 | JGI25157J39369_1000073 | JGI25157J39369_100007364 | 230 |
| 62 | 3300002741 | JGI25157J39369_1000296 | JGI25157J39369_100029626 | 230 |
| 63 | 3300005339 | Ga0070660_100006833 | Ga0070660_1000068333 | 230 |
| 64 | 3300005364 | Ga0070673_100381762 | Ga0070673_1003817621 | 230 |
| 65 | 3300005366 | Ga0070659_100109501 | Ga0070659_1001095012 | 230 |
| 66 | 3300005439 | Ga0070711_100015624 | Ga0070711_1000156242 | 230 |
| 67 | 3300005466 | Ga0070685_10457585 | Ga0070685_104575851 | 230 |
| 68 | 3300005535 | Ga0070684_100263999 | Ga0070684_1002639992 | 230 |
| 69 | 3300005539 | Ga0068853_100168441 | Ga0068853_1001684412 | 230 |
| 70 | 3300005548 | Ga0070665_100147018 | Ga0070665_1001470182 | 230 |
| 71 | 3300005563 | Ga0068855_100007451 | Ga0068855_1000074515 | 230 |
| 72 | 3300005563 | Ga0068855_100517416 | Ga0068855_1005174162 | 230 |
| 73 | 3300005577 | Ga0068857_100004102 | Ga0068857_10000410215 | 230 |
| 74 | 3300005577 | Ga0068857_100438601 | Ga0068857_1004386012 | 230 |
| 75 | 3300005578 | Ga0068854_100002155 | Ga0068854_1000021554 | 230 |
| 76 | 3300005614 | Ga0068856_100001352 | Ga0068856_10000135222 | 230 |
| 77 | 3300005616 | Ga0068852_100168391 | Ga0068852_1001683914 | 230 |
| 78 | 3300005841 | Ga0068863_101053857 | Ga0068863_1010538571 | 230 |
| 79 | 3300009176 | Ga0105242_10054422 | Ga0105242_100544223 | 230 |
| 80 | 3300009545 | Ga0105237_10049128 | Ga0105237_100491284 | 230 |
| 81 | 3300025246 | Ga0209646_1000067 | Ga0209646_1000067123 | 230 |
| 82 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033107 | 230 |
| 83 | 3300025253 | Ga0209677_100087 | Ga0209677_10008790 | 230 |
| 84 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024107 | 230 |
| 85 | 3300025913 | Ga0207695_10013841 | Ga0207695_100138416 | 230 |
| 86 | 3300025913 | Ga0207695_10341422 | Ga0207695_103414222 | 230 |
| 87 | 3300025914 | Ga0207671_10082258 | Ga0207671_100822582 | 230 |
| 88 | 3300025919 | Ga0207657_10163845 | Ga0207657_101638452 | 230 |
| 89 | 3300025934 | Ga0207686_10100850 | Ga0207686_101008502 | 230 |
| 90 | 3300025944 | Ga0207661_10601368 | Ga0207661_106013681 | 230 |
| 91 | 3300025949 | Ga0207667_10019398 | Ga0207667_100193982 | 230 |
| 92 | 3300025949 | Ga0207667_10682168 | Ga0207667_106821682 | 230 |
| 93 | 3300025981 | Ga0207640_10005245 | Ga0207640_100052453 | 230 |
| 94 | 3300026078 | Ga0207702_10001314 | Ga0207702_100013149 | 230 |
| 95 | 3300026116 | Ga0207674_10004669 | Ga0207674_1000466913 | 230 |
| 96 | 3300026116 | Ga0207674_10328318 | Ga0207674_103283182 | 230 |
| 97 | 3300026142 | Ga0207698_10899546 | Ga0207698_108995461 | 230 |
| 98 | 3300031911 | Ga0307412_10319213 | Ga0307412_103192131 | 230 |
| 99 | 3300045051 | Ga0451576_0252293 | Ga0451576_0252293_1142_1834 | 230 |
| 100 | 3300046506 | Ga0495583_0000159 | Ga0495583_0000159_63138_63830 | 230 |
| 101 | 3300046507 | Ga0495606_0002925 | Ga0495606_0002925_14193_14885 | 230 |
| 102 | 3300046692 | Ga0495671_0016295 | Ga0495671_0016295_2772_3482 | 230 |
| 103 | 3300046694 | Ga0495649_0000556 | Ga0495649_0000556_13567_14259 | 230 |
| 104 | 3300048907 | Ga0496104_0016024 | Ga0496104_0016024_4358_5053 | 230 |
| 105 | 3300048907 | Ga0496104_0497370 | Ga0496104_0497370_364_1062 | 230 |
| 106 | 3300048908 | Ga0496105_0001925 | Ga0496105_0001925_9359_10054 | 230 |
| 107 | 3300048908 | Ga0496105_0538890 | Ga0496105_0538890_193_885 | 230 |
| 108 | 3300048911 | Ga0496108_0117131 | Ga0496108_0117131_1097_1789 | 230 |
| 109 | 3300048915 | Ga0496112_0107826 | Ga0496112_0107826_1719_2411 | 230 |
| 110 | 3300048916 | Ga0496113_0424930 | Ga0496113_0424930_344_1036 | 230 |
| 111 | 3300048918 | Ga0496115_0351838 | Ga0496115_0351838_228_923 | 230 |
| 112 | 3300049686 | Ga0501257_011515 | Ga0501257_011515_736_1428 | 230 |
| 113 | 3300049762 | Ga0501265_003851 | Ga0501265_003851_271_963 | 230 |
| 114 | 3300053177 | Ga0500636_0034270 | Ga0500636_0034270_354_1046 | 230 |
| 115 | 3300031548 | Ga0307408_100000018 | Ga0307408_100000018210 | 231 |
| 116 | iso_pu_bacteria | 2690315857 | 2691332730 | 231 |
| 117 | iso_pu_bacteria | 2919534386 | 2919537853 | 231 |
| 118 | 3300005367 | Ga0070667_100001412 | Ga0070667_1000014124 | 232 |
| 119 | 3300005548 | Ga0070665_100000097 | Ga0070665_100000097112 | 232 |
| 120 | 3300005842 | Ga0068858_100074684 | Ga0068858_1000746842 | 232 |
| 121 | 3300025972 | Ga0207668_10198562 | Ga0207668_101985622 | 232 |
| 122 | 3300026035 | Ga0207703_10056791 | Ga0207703_100567913 | 232 |
| 123 | 3300028379 | Ga0268266_10000101 | Ga0268266_10000101113 | 232 |
| 124 | 3300028381 | Ga0268264_10185404 | Ga0268264_101854042 | 232 |
| 125 | 3300005331 | Ga0070670_100000054 | Ga0070670_10000005451 | 233 |
| 126 | 3300005335 | Ga0070666_10008211 | Ga0070666_100082112 | 233 |
| 127 | 3300005353 | Ga0070669_100001255 | Ga0070669_1000012558 | 233 |
| 128 | 3300005355 | Ga0070671_100000037 | Ga0070671_10000003725 | 233 |
| 129 | 3300005367 | Ga0070667_100000002 | Ga0070667_100000002405 | 233 |
| 130 | 3300005466 | Ga0070685_10000014 | Ga0070685_1000001445 | 233 |
| 131 | 3300005548 | Ga0070665_100013053 | Ga0070665_1000130535 | 233 |
| 132 | 3300005617 | Ga0068859_100010515 | Ga0068859_1000105159 | 233 |
| 133 | 3300005618 | Ga0068864_100000002 | Ga0068864_10000000268 | 233 |
| 134 | 3300005842 | Ga0068858_100124896 | Ga0068858_1001248962 | 233 |
| 135 | 3300005843 | Ga0068860_100000844 | Ga0068860_10000084429 | 233 |
| 136 | 3300005844 | Ga0068862_100003526 | Ga0068862_1000035268 | 233 |
| 137 | 3300006931 | Ga0097620_100010515 | Ga0097620_1000105159 | 233 |
| 138 | 3300009101 | Ga0105247_10125195 | Ga0105247_101251951 | 233 |
| 139 | 3300009553 | Ga0105249_10409557 | Ga0105249_104095572 | 233 |
| 140 | 3300013306 | Ga0163162_10030302 | Ga0163162_100303022 | 233 |
| 141 | 3300014325 | Ga0163163_10000762 | Ga0163163_1000076219 | 233 |
| 142 | 3300014968 | Ga0157379_10103429 | Ga0157379_101034293 | 233 |
| 143 | 3300025903 | Ga0207680_10018041 | Ga0207680_100180417 | 233 |
| 144 | 3300025923 | Ga0207681_10018937 | Ga0207681_100189373 | 233 |
| 145 | 3300025925 | Ga0207650_10000002 | Ga0207650_1000000268 | 233 |
| 146 | 3300025931 | Ga0207644_10000192 | Ga0207644_1000019225 | 233 |
| 147 | 3300025941 | Ga0207711_10000061 | Ga0207711_1000006120 | 233 |
| 148 | 3300025941 | Ga0207711_10000827 | Ga0207711_100008278 | 233 |
| 149 | 3300025961 | Ga0207712_10113078 | Ga0207712_101130782 | 233 |
| 150 | 3300025986 | Ga0207658_10000001 | Ga0207658_100000011286 | 233 |
| 151 | 3300026035 | Ga0207703_10083276 | Ga0207703_100832762 | 233 |
| 152 | 3300026088 | Ga0207641_10053218 | Ga0207641_100532186 | 233 |
| 153 | 3300026095 | Ga0207676_10000001 | Ga0207676_1000000168 | 233 |
| 154 | 3300028379 | Ga0268266_10023465 | Ga0268266_100234658 | 233 |
| 155 | 3300028380 | Ga0268265_10000888 | Ga0268265_100008882 | 233 |
| 156 | 3300028381 | Ga0268264_10000004 | Ga0268264_1000000465 | 233 |
| 157 | 3300037418 | Ga0395900_0511453 | Ga0395900_0511453_267_968 | 233 |
| 158 | 3300042876 | Ga0451577_0004169 | Ga0451577_0004169_4040_4918 | 233 |
| 159 | 3300048928 | Ga0496125_0022425 | Ga0496125_0022425_4314_5015 | 233 |
| 160 | 3300005354 | Ga0070675_100119554 | Ga0070675_1001195542 | 234 |
| 161 | 3300005434 | Ga0070709_10123417 | Ga0070709_101234172 | 234 |
| 162 | 3300014326 | Ga0157380_10255642 | Ga0157380_102556424 | 234 |
| 163 | 3300017792 | Ga0163161_10841840 | Ga0163161_108418401 | 234 |
| 164 | 3300025938 | Ga0207704_10478762 | Ga0207704_104787621 | 234 |
| 165 | 3300025940 | Ga0207691_10617912 | Ga0207691_106179121 | 234 |
| 166 | 3300042121 | Ga0450919_014656 | Ga0450919_014656_61_765 | 234 |
| 167 | 3300042125 | Ga0450923_013510 | Ga0450923_013510_501_1205 | 234 |
| 168 | 3300042156 | Ga0439446_0004824 | Ga0439446_0004824_1476_2180 | 234 |
| 169 | 3300001904 | JGI24736J21556_1000522 | JGI24736J21556_10005223 | 235 |
| 170 | 3300005327 | Ga0070658_10042194 | Ga0070658_100421941 | 235 |
| 171 | 3300005335 | Ga0070666_10000295 | Ga0070666_1000029514 | 235 |
| 172 | 3300005338 | Ga0068868_100038593 | Ga0068868_1000385934 | 235 |
| 173 | 3300005338 | Ga0068868_100186182 | Ga0068868_1001861822 | 235 |
| 174 | 3300005340 | Ga0070689_100542812 | Ga0070689_1005428121 | 235 |
| 175 | 3300005341 | Ga0070691_10438880 | Ga0070691_104388801 | 235 |
| 176 | 3300005347 | Ga0070668_100004327 | Ga0070668_1000043274 | 235 |
| 177 | 3300005353 | Ga0070669_100432362 | Ga0070669_1004323622 | 235 |
| 178 | 3300005355 | Ga0070671_100460127 | Ga0070671_1004601272 | 235 |
| 179 | 3300005365 | Ga0070688_100075041 | Ga0070688_1000750413 | 235 |
| 180 | 3300005365 | Ga0070688_100171130 | Ga0070688_1001711302 | 235 |
| 181 | 3300005367 | Ga0070667_100296572 | Ga0070667_1002965722 | 235 |
| 182 | 3300005367 | Ga0070667_100643567 | Ga0070667_1006435671 | 235 |
| 183 | 3300005445 | Ga0070708_100435867 | Ga0070708_1004358672 | 235 |
| 184 | 3300005455 | Ga0070663_100041321 | Ga0070663_1000413212 | 235 |
| 185 | 3300005455 | Ga0070663_100061824 | Ga0070663_1000618244 | 235 |
| 186 | 3300005457 | Ga0070662_100003879 | Ga0070662_10000387915 | 235 |
| 187 | 3300005458 | Ga0070681_10060295 | Ga0070681_100602955 | 235 |
| 188 | 3300005459 | Ga0068867_100095674 | Ga0068867_1000956741 | 235 |
| 189 | 3300005466 | Ga0070685_10000845 | Ga0070685_100008452 | 235 |
| 190 | 3300005548 | Ga0070665_100000414 | Ga0070665_10000041449 | 235 |
| 191 | 3300005548 | Ga0070665_100067901 | Ga0070665_1000679012 | 235 |
| 192 | 3300005549 | Ga0070704_100198833 | Ga0070704_1001988332 | 235 |
| 193 | 3300005563 | Ga0068855_100023082 | Ga0068855_1000230821 | 235 |
| 194 | 3300005564 | Ga0070664_100205628 | Ga0070664_1002056281 | 235 |
| 195 | 3300005578 | Ga0068854_100001345 | Ga0068854_10000134515 | 235 |
| 196 | 3300005578 | Ga0068854_100423562 | Ga0068854_1004235622 | 235 |
| 197 | 3300005614 | Ga0068856_100307921 | Ga0068856_1003079213 | 235 |
| 198 | 3300005616 | Ga0068852_100418152 | Ga0068852_1004181522 | 235 |
| 199 | 3300005616 | Ga0068852_100442710 | Ga0068852_1004427102 | 235 |
| 200 | 3300005617 | Ga0068859_100000201 | Ga0068859_1000002017 | 235 |
| 201 | 3300005834 | Ga0068851_10000410 | Ga0068851_1000041014 | 235 |
| 202 | 3300005841 | Ga0068863_100255131 | Ga0068863_1002551312 | 235 |
| 203 | 3300005842 | Ga0068858_100000101 | Ga0068858_10000010128 | 235 |
| 204 | 3300005844 | Ga0068862_100000245 | Ga0068862_10000024541 | 235 |
| 205 | 3300006178 | Ga0075367_10100618 | Ga0075367_101006183 | 235 |
| 206 | 3300006237 | Ga0097621_100388225 | Ga0097621_1003882252 | 235 |
| 207 | 3300006844 | Ga0075428_101154686 | Ga0075428_1011546861 | 235 |
| 208 | 3300006881 | Ga0068865_100063633 | Ga0068865_1000636332 | 235 |
| 209 | 3300006931 | Ga0097620_100000201 | Ga0097620_1000002017 | 235 |
| 210 | 3300009093 | Ga0105240_10002052 | Ga0105240_1000205224 | 235 |
| 211 | 3300009093 | Ga0105240_10010127 | Ga0105240_1001012724 | 235 |
| 212 | 3300009093 | Ga0105240_10566119 | Ga0105240_105661191 | 235 |
| 213 | 3300009094 | Ga0111539_10027861 | Ga0111539_100278617 | 235 |
| 214 | 3300009174 | Ga0105241_10006269 | Ga0105241_1000626914 | 235 |
| 215 | 3300009545 | Ga0105237_10037838 | Ga0105237_100378387 | 235 |
| 216 | 3300009545 | Ga0105237_10423265 | Ga0105237_104232652 | 235 |
| 217 | 3300009551 | Ga0105238_10000728 | Ga0105238_1000072824 | 235 |
| 218 | 3300010375 | Ga0105239_10007582 | Ga0105239_100075822 | 235 |
| 219 | 3300010375 | Ga0105239_10015410 | Ga0105239_100154102 | 235 |
| 220 | 3300010375 | Ga0105239_11215351 | Ga0105239_112153511 | 235 |
| 221 | 3300013102 | Ga0157371_10236217 | Ga0157371_102362172 | 235 |
| 222 | 3300013104 | Ga0157370_10126564 | Ga0157370_101265642 | 235 |
| 223 | 3300013105 | Ga0157369_10878130 | Ga0157369_108781301 | 235 |
| 224 | 3300014325 | Ga0163163_10551451 | Ga0163163_105514511 | 235 |
| 225 | 3300014326 | Ga0157380_10049744 | Ga0157380_100497442 | 235 |
| 226 | 3300014326 | Ga0157380_10663434 | Ga0157380_106634342 | 235 |
| 227 | 3300014968 | Ga0157379_10315780 | Ga0157379_103157801 | 235 |
| 228 | 3300025261 | Ga0209233_1005094 | Ga0209233_10050944 | 235 |
| 229 | 3300025903 | Ga0207680_10001552 | Ga0207680_100015529 | 235 |
| 230 | 3300025904 | Ga0207647_10000075 | Ga0207647_1000007524 | 235 |
| 231 | 3300025912 | Ga0207707_10072023 | Ga0207707_100720231 | 235 |
| 232 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007285 | 235 |
| 233 | 3300025913 | Ga0207695_10015797 | Ga0207695_100157972 | 235 |
| 234 | 3300025913 | Ga0207695_10020026 | Ga0207695_100200262 | 235 |
| 235 | 3300025914 | Ga0207671_10031099 | Ga0207671_100310994 | 235 |
| 236 | 3300025914 | Ga0207671_10033248 | Ga0207671_100332482 | 235 |
| 237 | 3300025923 | Ga0207681_10205712 | Ga0207681_102057122 | 235 |
| 238 | 3300025924 | Ga0207694_10000363 | Ga0207694_1000036314 | 235 |
| 239 | 3300025924 | Ga0207694_10000566 | Ga0207694_1000056625 | 235 |
| 240 | 3300025932 | Ga0207690_10432047 | Ga0207690_104320471 | 235 |
| 241 | 3300025933 | Ga0207706_10032847 | Ga0207706_100328473 | 235 |
| 242 | 3300025934 | Ga0207686_10191935 | Ga0207686_101919352 | 235 |
| 243 | 3300025949 | Ga0207667_10342920 | Ga0207667_103429202 | 235 |
| 244 | 3300025960 | Ga0207651_10003708 | Ga0207651_100037084 | 235 |
| 245 | 3300025961 | Ga0207712_10000211 | Ga0207712_1000021127 | 235 |
| 246 | 3300025981 | Ga0207640_10003703 | Ga0207640_1000370310 | 235 |
| 247 | 3300025986 | Ga0207658_10100958 | Ga0207658_101009582 | 235 |
| 248 | 3300025986 | Ga0207658_10448987 | Ga0207658_104489872 | 235 |
| 249 | 3300026023 | Ga0207677_10084113 | Ga0207677_100841133 | 235 |
| 250 | 3300026023 | Ga0207677_10270434 | Ga0207677_102704342 | 235 |
| 251 | 3300026035 | Ga0207703_10000180 | Ga0207703_1000018033 | 235 |
| 252 | 3300026041 | Ga0207639_10000367 | Ga0207639_1000036732 | 235 |
| 253 | 3300026067 | Ga0207678_10004319 | Ga0207678_100043193 | 235 |
| 254 | 3300026067 | Ga0207678_10014983 | Ga0207678_1001498310 | 235 |
| 255 | 3300026067 | Ga0207678_10025246 | Ga0207678_100252464 | 235 |
| 256 | 3300026088 | Ga0207641_10112071 | Ga0207641_101120712 | 235 |
| 257 | 3300026089 | Ga0207648_10045250 | Ga0207648_100452505 | 235 |
| 258 | 3300026116 | Ga0207674_10104345 | Ga0207674_101043452 | 235 |
| 259 | 3300026142 | Ga0207698_10237017 | Ga0207698_102370171 | 235 |
| 260 | 3300026142 | Ga0207698_10646272 | Ga0207698_106462721 | 235 |
| 261 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008409 | 235 |
| 262 | 3300028380 | Ga0268265_10000509 | Ga0268265_1000050925 | 235 |
| 263 | 3300028381 | Ga0268264_10038744 | Ga0268264_100387442 | 235 |
| 264 | 3300031250 | Ga0265331_10015456 | Ga0265331_100154561 | 235 |
| 265 | 3300031251 | Ga0265327_10000008 | Ga0265327_10000008592 | 235 |
| 266 | 3300031251 | Ga0265327_10000540 | Ga0265327_1000054032 | 235 |
| 267 | 3300031251 | Ga0265327_10022809 | Ga0265327_100228093 | 235 |
| 268 | 3300031548 | Ga0307408_100000060 | Ga0307408_10000006085 | 235 |
| 269 | 3300031548 | Ga0307408_100005552 | Ga0307408_1000055527 | 235 |
| 270 | 3300031665 | Ga0316575_10014033 | Ga0316575_100140333 | 235 |
| 271 | 3300031691 | Ga0316579_10011287 | Ga0316579_100112875 | 235 |
| 272 | 3300031727 | Ga0316576_10145716 | Ga0316576_101457162 | 235 |
| 273 | 3300031727 | Ga0316576_10399424 | Ga0316576_103994241 | 235 |
| 274 | 3300031728 | Ga0316578_10011297 | Ga0316578_100112971 | 235 |
| 275 | 3300031733 | Ga0316577_10002020 | Ga0316577_100020202 | 235 |
| 276 | 3300031733 | Ga0316577_10024646 | Ga0316577_100246462 | 235 |
| 277 | 3300031901 | Ga0307406_10005694 | Ga0307406_100056944 | 235 |
| 278 | 3300031901 | Ga0307406_10011237 | Ga0307406_100112376 | 235 |
| 279 | 3300032133 | Ga0316583_10045941 | Ga0316583_100459412 | 235 |
| 280 | 3300032139 | Ga0316580_10007702 | Ga0316580_100077022 | 235 |
| 281 | 3300032139 | Ga0316580_10017612 | Ga0316580_100176122 | 235 |
| 282 | 3300035398 | Ga0316574_0037530 | Ga0316574_0037530_833_1543 | 235 |
| 283 | 3300035398 | Ga0316574_0038101 | Ga0316574_0038101_142_864 | 235 |
| 284 | 3300036647 | Ga0316582_0053388 | Ga0316582_0053388_1758_2468 | 235 |
| 285 | 3300036712 | Ga0316584_0044703 | Ga0316584_0044703_2352_3074 | 235 |
| 286 | 3300037588 | Ga0316581_0038956 | Ga0316581_0038956_320_1030 | 235 |
| 287 | 3300042000 | Ga0439437_000160 | Ga0439437_000160_2466_3212 | 235 |
| 288 | 3300042013 | Ga0439456_003630 | Ga0439456_003630_136_882 | 235 |
| 289 | 3300042115 | Ga0450911_000005 | Ga0450911_000005_52258_53004 | 235 |
| 290 | 3300042129 | Ga0450891_000598 | Ga0450891_000598_2134_2904 | 235 |
| 291 | 3300042139 | Ga0450904_000005 | Ga0450904_000005_4397_5143 | 235 |
| 292 | 3300042142 | Ga0450905_009968 | Ga0450905_009968_99_845 | 235 |
| 293 | 3300042532 | Ga0450893_0001549 | Ga0450893_0001549_27_773 | 235 |
| 294 | 3300048921 | Ga0496118_0012612 | Ga0496118_0012612_209_931 | 235 |
| 295 | 3300050494 | nmdc:mga06z11_88083_c1 | nmdc:mga06z11_88083_c1_874_1587 | 235 |
| 296 | 3300050508 | nmdc:mga09592_23184_c1 | nmdc:mga09592_23184_c1_3137_3871 | 235 |
| 297 | 3300050511 | nmdc:mga08y16_52944_c1 | nmdc:mga08y16_52944_c1_626_1360 | 235 |
| 298 | 3300053098 | Ga0500650_0000024 | Ga0500650_0000024_7973_8704 | 235 |
| 299 | 3300053119 | Ga0500595_007427 | Ga0500595_007427_118_909 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ffq-assembly2.cif.gz_B | hcn2i 443-640 apo-state | 0.8822 | 13 | 127 |
| 3ffq-assembly1.cif.gz_A | hcn2i 443-640 apo-state | 0.8782 | 13 | 130 |
| 6rsx-assembly1.cif.gz_A | regulatory subunit of camp-dependant protein kinase a from euglena gracilis at 1.6 a resolution | 0.8659 | 11 | 129 |
| 4ku7-assembly1.cif.gz_A | structures of pkgi reveal a cgmp-selective activation mechanism | 0.8653 | 13 | 116 |
| 4hbn-assembly1.cif.gz_A | crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation | 0.8645 | 13 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n9iC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9701 | 168 | 210 | 1.10.10.10 |
| 4n9iD02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9551 | 168 | 210 | 1.10.10.10 |
| 3dv8A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9428 | 149 | 218 | 1.10.10.10 |
| 3iwzA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9164 | 149 | 209 | 1.10.10.10 |
| 1z05A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9121 | 172 | 201 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257FJN5-F1-model_v4 | deleted | 0.9892 | 9 | 232 |
|
| AF-A0A515D744-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.9746 | 11 | 235 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A2T1E1Z0-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.973 | 10 | 234 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A3D1IZK8-F1-model_v4 | Protein kinase | 0.9706 | 6 | 234 |
GO:0003677
GO:0003700 GO:0005829 GO:0016301 |
| AF-A0A3T0VUM7-F1-model_v4 | deleted | 0.9679 | 5 | 232 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar