F394957

General Info

Members Datasets Scaffolds Average Seq Length
299 196 296 235

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0004169|Ga0451577_0004169_4040_4918
Length 265
Sequence MGPTHRRANSLSADTDATRRIVFVAPSSHEVFVKGASSRPVRNLLISSLPRGERDRMIAHCEPFELVFGTVVCIPDRPYREVYFPLRGFISLVKVMRDHPPMEMALIGNEGMLGATMILNTAIAPLRAIVQGAGSALRMSASHFQRELADSANLRRALDRYLYATMADSSQTAACAYFHEVGARLARWLLMTHDRAHADHFHLTHQFMADMLGVQRSAITIAAGELQDKKIIRYTRGEISILDRRGLEGASCECYAALRKRQARR

Samples

Sample ID Description Type Environment
1 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
2 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
3 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
155 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
158 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
159 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
162 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
163 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
164 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
165 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
190 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 0
Rhizoplane 3.01
Rhizosphere 87.29
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000522 3300001904 Bacteria 7161
2 JGI25156J39149_1001992 3300002705 Bacteria 7830
3 JGI25162J39368_1000344 3300002737 Bacteria 40143
4 JGI25154J39366_1000337 3300002738 Bacteria 27001
5 JGI25157J39369_1000073 3300002741 Bacteria 88360
6 JGI25157J39369_1000296 3300002741 Bacteria 36294
7 JGI25163J39215_1000856 3300002771 Bacteria 7262
8 JGI25164J39214_1000253 3300002772 Bacteria 40203
9 JGI25164J39214_1000255 3300002772 Bacteria 40111
10 JGI25164J39214_1001614 3300002772 Bacteria 4741
11 JGI25165J46597_1000463 3300003214 Bacteria 40143
12 Ga0065707_10158201 3300005295 Unclassified 1588
13 Ga0070658_10042194 3300005327 Bacteria 3682
14 Ga0070670_100000054 3300005331 Bacteria 127396
15 Ga0070666_10000295 3300005335 Bacteria 32526
16 Ga0070666_10008211 3300005335 Bacteria 6471
17 Ga0068868_100038593 3300005338 Bacteria 3708
18 Ga0068868_100186182 3300005338 Bacteria 1725
19 Ga0070660_100006833 3300005339 Bacteria 7914
20 Ga0070689_100542812 3300005340 Bacteria 1001
21 Ga0070691_10438880 3300005341 Unclassified 743
22 Ga0070668_100004327 3300005347 Bacteria 10533
23 Ga0070669_100001255 3300005353 Bacteria 18423
24 Ga0070669_100432362 3300005353 Unclassified 1082
25 Ga0070675_100119554 3300005354 Bacteria 2238
26 Ga0070671_100000037 3300005355 Bacteria 95248
27 Ga0070671_100460127 3300005355 Bacteria 1092
28 Ga0070673_100002495 3300005364 Bacteria 11227
29 Ga0070673_100381762 3300005364 Bacteria 1256
30 Ga0070688_100075041 3300005365 Bacteria 2173
31 Ga0070688_100171130 3300005365 Bacteria 1499
32 Ga0070659_100109501 3300005366 Bacteria 2229
33 Ga0070667_100000002 3300005367 Bacteria 504831
34 Ga0070667_100001412 3300005367 Bacteria 21492
35 Ga0070667_100296572 3300005367 Bacteria 1455
36 Ga0070667_100643567 3300005367 Bacteria 979
37 Ga0070709_10123417 3300005434 Bacteria 1759
38 Ga0070711_100015624 3300005439 Bacteria 4807
39 Ga0070708_100435867 3300005445 Bacteria 1236
40 Ga0070663_100041321 3300005455 Bacteria 3233
41 Ga0070663_100061824 3300005455 Bacteria 2698
42 Ga0070662_100003879 3300005457 Bacteria 9373
43 Ga0070681_10060295 3300005458 Bacteria 3771
44 Ga0068867_100095674 3300005459 Bacteria 2260
45 Ga0070685_10000014 3300005466 Bacteria 120530
46 Ga0070685_10000845 3300005466 Bacteria 16665
47 Ga0070685_10457585 3300005466 Bacteria 895
48 Ga0070684_100263999 3300005535 Bacteria 1575
49 Ga0068853_100168441 3300005539 Bacteria 1981
50 Ga0070665_100000097 3300005548 Bacteria 166302
51 Ga0070665_100000414 3300005548 Bacteria 62478
52 Ga0070665_100013053 3300005548 Bacteria 8365
53 Ga0070665_100067901 3300005548 Bacteria 3575
54 Ga0070665_100147018 3300005548 Bacteria 2360
55 Ga0070704_100198833 3300005549 Unclassified 1617
56 Ga0068855_100007451 3300005563 Bacteria 13252
57 Ga0068855_100023082 3300005563 Bacteria 7455
58 Ga0068855_100517416 3300005563 Bacteria 1295
59 Ga0070664_100205628 3300005564 Bacteria 1758
60 Ga0068857_100004102 3300005577 Bacteria 12273
61 Ga0068857_100438601 3300005577 Bacteria 1220
62 Ga0068854_100001345 3300005578 Bacteria 14809
63 Ga0068854_100002155 3300005578 Bacteria 12081
64 Ga0068854_100423562 3300005578 Bacteria 1106
65 Ga0068856_100001352 3300005614 Bacteria 25767
66 Ga0068856_100307921 3300005614 Bacteria 1602
67 Ga0068852_100168391 3300005616 Bacteria 2052
68 Ga0068852_100418152 3300005616 Bacteria 1322
69 Ga0068852_100442710 3300005616 Bacteria 1285
70 Ga0068859_100000201 3300005617 Bacteria 58643
71 Ga0068859_100010515 3300005617 Bacteria 9313
72 Ga0068864_100000002 3300005618 Bacteria 658857
73 Ga0068851_10000410 3300005834 Bacteria 19327
74 Ga0068863_100255131 3300005841 Bacteria 1695
75 Ga0068863_101053857 3300005841 Bacteria 817
76 Ga0068858_100000101 3300005842 Bacteria 89093
77 Ga0068858_100074684 3300005842 Bacteria 3148
78 Ga0068858_100124896 3300005842 Bacteria 2408
79 Ga0068860_100000844 3300005843 Bacteria 34309
80 Ga0068862_100000245 3300005844 Bacteria 60375
81 Ga0068862_100003526 3300005844 Bacteria 13422
82 Ga0075367_10100618 3300006178 Bacteria 1766
83 Ga0097621_100388225 3300006237 Bacteria 1248
84 Ga0075428_100013936 3300006844 Bacteria 8951
85 Ga0075428_101154686 3300006844 Unclassified 817
86 Ga0075429_100007417 3300006880 Bacteria 9516
87 Ga0068865_100063633 3300006881 Bacteria 2594
88 Ga0097620_100000201 3300006931 Bacteria 58643
89 Ga0097620_100010515 3300006931 Bacteria 9313
90 Ga0075435_100576015 3300007076 Bacteria 976
91 Ga0105240_10002052 3300009093 Bacteria 33049
92 Ga0105240_10010127 3300009093 Bacteria 13270
93 Ga0105240_10387300 3300009093 Bacteria 1577
94 Ga0105240_10566119 3300009093 Bacteria 1255
95 Ga0111539_10027861 3300009094 Bacteria 6898
96 Ga0105247_10125195 3300009101 Bacteria 1669
97 Ga0105241_10006269 3300009174 Bacteria 8769
98 Ga0105242_10054422 3300009176 Bacteria 3271
99 Ga0105237_10037838 3300009545 Bacteria 4875
100 Ga0105237_10049128 3300009545 Bacteria 4242
101 Ga0105237_10423265 3300009545 Bacteria 1337
102 Ga0105238_10000728 3300009551 Bacteria 34336
103 Ga0105249_10409557 3300009553 Bacteria 1388
104 Ga0105239_10007582 3300010375 Bacteria 12436
105 Ga0105239_10015410 3300010375 Bacteria 8470
106 Ga0105239_11215351 3300010375 Bacteria 869
107 Ga0157371_10236217 3300013102 Bacteria 1314
108 Ga0157370_10005720 3300013104 Bacteria 13898
109 Ga0157370_10126564 3300013104 Bacteria 2384
110 Ga0157369_10878130 3300013105 Bacteria 920
111 Ga0163162_10029638 3300013306 Bacteria 5417
112 Ga0163162_10030302 3300013306 Bacteria 5361
113 Ga0157375_10423096 3300013308 Bacteria 1498
114 Ga0157375_10722889 3300013308 Unclassified 1148
115 Ga0163163_10000762 3300014325 Bacteria 27407
116 Ga0163163_10551451 3300014325 Bacteria 1215
117 Ga0157380_10049744 3300014326 Bacteria 3307
118 Ga0157380_10255642 3300014326 Bacteria 1588
119 Ga0157380_10663434 3300014326 Bacteria 1042
120 Ga0157379_10103429 3300014968 Bacteria 2556
121 Ga0157379_10315780 3300014968 Bacteria 1426
122 Ga0157376_10108297 3300014969 Bacteria 2441
123 Ga0163161_10546207 3300017792 Bacteria 949
124 Ga0163161_10841840 3300017792 Bacteria 773
125 Ga0209760_100162 3300025207 Bacteria 40192
126 Ga0207427_100114 3300025231 Bacteria 104357
127 Ga0207427_100272 3300025231 Bacteria 39011
128 Ga0209437_100219 3300025233 Bacteria 104357
129 Ga0209646_1000067 3300025246 Bacteria 241595
130 Ga0209026_1000033 3300025250 Bacteria 318512
131 Ga0209677_100087 3300025253 Bacteria 109892
132 Ga0209759_1000024 3300025256 Bacteria 318512
133 Ga0209233_1000012 3300025261 Bacteria 1019519
134 Ga0209233_1005094 3300025261 Bacteria 4396
135 Ga0207680_10001552 3300025903 Bacteria 10822
136 Ga0207680_10018041 3300025903 Bacteria 3741
137 Ga0207647_10000075 3300025904 Bacteria 76289
138 Ga0207705_10515306 3300025909 Bacteria 929
139 Ga0207707_10072023 3300025912 Bacteria 3012
140 Ga0207695_10000007 3300025913 Bacteria 1092551
141 Ga0207695_10013841 3300025913 Bacteria 9596
142 Ga0207695_10015797 3300025913 Bacteria 8867
143 Ga0207695_10020026 3300025913 Bacteria 7679
144 Ga0207695_10341422 3300025913 Unclassified 1385
145 Ga0207671_10031099 3300025914 Bacteria 3980
146 Ga0207671_10033248 3300025914 Bacteria 3837
147 Ga0207671_10082258 3300025914 Bacteria 2416
148 Ga0207657_10033413 3300025919 Bacteria 4637
149 Ga0207657_10163845 3300025919 Bacteria 1804
150 Ga0207681_10018937 3300025923 Bacteria 4342
151 Ga0207681_10205712 3300025923 Bacteria 1514
152 Ga0207694_10000363 3300025924 Bacteria 42675
153 Ga0207694_10000566 3300025924 Bacteria 33540
154 Ga0207650_10000002 3300025925 Bacteria 1439222
155 Ga0207644_10000192 3300025931 Bacteria 43758
156 Ga0207690_10096913 3300025932 Bacteria 2098
157 Ga0207690_10432047 3300025932 Bacteria 1055
158 Ga0207706_10032847 3300025933 Bacteria 4618
159 Ga0207686_10100850 3300025934 Bacteria 1927
160 Ga0207686_10191935 3300025934 Bacteria 1457
161 Ga0207704_10478762 3300025938 Bacteria 999
162 Ga0207691_10617912 3300025940 Bacteria 917
163 Ga0207711_10000061 3300025941 Bacteria 125523
164 Ga0207711_10000827 3300025941 Bacteria 30250
165 Ga0207689_10035513 3300025942 Bacteria 4141
166 Ga0207661_10601368 3300025944 Bacteria 1009
167 Ga0207667_10019398 3300025949 Bacteria 7592
168 Ga0207667_10342920 3300025949 Bacteria 1524
169 Ga0207667_10682168 3300025949 Bacteria 1031
170 Ga0207651_10003708 3300025960 Bacteria 7556
171 Ga0207712_10000211 3300025961 Bacteria 58110
172 Ga0207712_10113078 3300025961 Bacteria 2040
173 Ga0207668_10198562 3300025972 Bacteria 1595
174 Ga0207640_10003703 3300025981 Bacteria 8242
175 Ga0207640_10005245 3300025981 Bacteria 7052
176 Ga0207658_10000001 3300025986 Bacteria 1439333
177 Ga0207658_10100958 3300025986 Bacteria 2260
178 Ga0207658_10448987 3300025986 Bacteria 1141
179 Ga0207677_10084113 3300026023 Bacteria 2292
180 Ga0207677_10270434 3300026023 Bacteria 1390
181 Ga0207703_10000180 3300026035 Bacteria 73584
182 Ga0207703_10056791 3300026035 Bacteria 3190
183 Ga0207703_10083276 3300026035 Bacteria 2672
184 Ga0207639_10000367 3300026041 Bacteria 31306
185 Ga0207678_10004319 3300026067 Bacteria 12759
186 Ga0207678_10014983 3300026067 Bacteria 6821
187 Ga0207678_10025246 3300026067 Bacteria 5187
188 Ga0207702_10001314 3300026078 Bacteria 24905
189 Ga0207641_10053218 3300026088 Bacteria 3430
190 Ga0207641_10112071 3300026088 Bacteria 2420
191 Ga0207641_10364410 3300026088 Bacteria 1381
192 Ga0207648_10045250 3300026089 Bacteria 3860
193 Ga0207676_10000001 3300026095 Bacteria 1439222
194 Ga0207674_10004669 3300026116 Bacteria 16444
195 Ga0207674_10104345 3300026116 Bacteria 2813
196 Ga0207674_10328318 3300026116 Bacteria 1479
197 Ga0207698_10237017 3300026142 Bacteria 1660
198 Ga0207698_10646272 3300026142 Bacteria 1047
199 Ga0207698_10899546 3300026142 Bacteria 892
200 Ga0207428_10032334 3300027907 Bacteria 4304
201 Ga0268266_10000008 3300028379 Bacteria 1161875
202 Ga0268266_10000101 3300028379 Bacteria 180443
203 Ga0268266_10023465 3300028379 Bacteria 5254
204 Ga0268265_10000509 3300028380 Bacteria 39997
205 Ga0268265_10000888 3300028380 Bacteria 27896
206 Ga0268264_10000004 3300028381 Bacteria 1116842
207 Ga0268264_10038744 3300028381 Bacteria 3935
208 Ga0268264_10185404 3300028381 Bacteria 1893
209 Ga0265331_10015456 3300031250 Bacteria 4029
210 Ga0265327_10000008 3300031251 Bacteria 658870
211 Ga0265327_10000540 3300031251 Bacteria 64733
212 Ga0265327_10022809 3300031251 Bacteria 3727
213 Ga0307408_100000018 3300031548 Bacteria 346872
214 Ga0307408_100000060 3300031548 Bacteria 132341
215 Ga0307408_100005552 3300031548 Bacteria 8427
216 Ga0307408_100010436 3300031548 Bacteria 6127
217 Ga0316575_10014033 3300031665 Bacteria 3002
218 Ga0316579_10011287 3300031691 Bacteria 3795
219 Ga0316576_10145716 3300031727 Bacteria 1783
220 Ga0316576_10399424 3300031727 Bacteria 1018
221 Ga0316578_10011297 3300031728 Bacteria 4665
222 Ga0307405_10002728 3300031731 Bacteria 7903
223 Ga0316577_10002020 3300031733 Bacteria 9890
224 Ga0316577_10024646 3300031733 Bacteria 3345
225 Ga0307410_10007663 3300031852 Bacteria 5924
226 Ga0307406_10005694 3300031901 Bacteria 6818
227 Ga0307406_10011237 3300031901 Bacteria 5076
228 Ga0307412_10010890 3300031911 Bacteria 5251
229 Ga0307412_10319213 3300031911 Bacteria 1235
230 Ga0307409_100052381 3300031995 Bacteria 3129
231 Ga0307416_100000500 3300032002 Bacteria 19946
232 Ga0307414_10134005 3300032004 Bacteria 1928
233 Ga0307411_10001394 3300032005 Bacteria 9817
234 Ga0307415_100006019 3300032126 Bacteria 6498
235 Ga0316583_10045941 3300032133 Bacteria 1541
236 Ga0316580_10007702 3300032139 Bacteria 3214
237 Ga0316580_10017612 3300032139 Bacteria 2197
238 Ga0316574_0037530 3300035398 Bacteria 2972
239 Ga0316574_0038101 3300035398 Bacteria 2950
240 Ga0316582_0053388 3300036647 Bacteria 2570
241 Ga0316584_0044703 3300036712 Bacteria 3303
242 Ga0395900_0511453 3300037418 Bacteria 1150
243 Ga0395898_0014144 3300037466 Bacteria 8204
244 Ga0395905_0166910 3300037471 Bacteria 2069
245 Ga0316581_0038956 3300037588 Bacteria 1446
246 Ga0395901_0050631 3300038443 Bacteria 4314
247 Ga0439466_0002189 3300041411 Bacteria 7652
248 Ga0439437_000160 3300042000 Bacteria 5623
249 Ga0439443_010391 3300042003 Bacteria 1348
250 Ga0439445_0107636 3300042004 Unclassified 794
251 Ga0439456_003630 3300042013 Bacteria 3134
252 Ga0450911_000005 3300042115 Bacteria 233469
253 Ga0450919_014656 3300042121 Bacteria 885
254 Ga0450923_000102 3300042125 Bacteria 7136
255 Ga0450923_013510 3300042125 Bacteria 1502
256 Ga0450891_000598 3300042129 Bacteria 3768
257 Ga0450894_011476 3300042131 Bacteria 1154
258 Ga0450896_006872 3300042133 Bacteria 1565
259 Ga0450904_000005 3300042139 Bacteria 60724
260 Ga0450905_009968 3300042142 Bacteria 1311
261 Ga0439446_0000061 3300042156 Bacteria 17244
262 Ga0439446_0004824 3300042156 Bacteria 3437
263 Ga0439446_0007462 3300042156 Bacteria 2876
264 Ga0450908_000502 3300042184 Bacteria 7531
265 Ga0439434_0000822 3300042435 Bacteria 8930
266 Ga0439434_0010720 3300042435 Bacteria 2703
267 Ga0439435_0000056 3300042436 Bacteria 13063
268 Ga0439444_0014027 3300042437 Bacteria 1334
269 Ga0439460_0003830 3300042461 Bacteria 3643
270 Ga0450893_0001549 3300042532 Bacteria 3533
271 Ga0451577_0004169 3300042876 Bacteria 15450
272 Ga0453684_0199115 3300044712 Bacteria 2336
273 Ga0451576_0252293 3300045051 Bacteria 1844
274 Ga0495583_0000159 3300046506 Bacteria 113627
275 Ga0495606_0002925 3300046507 Bacteria 18870
276 Ga0495625_0004543 3300046660 Bacteria 13068
277 Ga0495671_0016295 3300046692 Bacteria 3971
278 Ga0495649_0000556 3300046694 Bacteria 31605
279 Ga0496104_0016024 3300048907 Bacteria 6805
280 Ga0496104_0497370 3300048907 Bacteria 1130
281 Ga0496105_0001925 3300048908 Bacteria 14912
282 Ga0496105_0538890 3300048908 Bacteria 912
283 Ga0496108_0117131 3300048911 Bacteria 2282
284 Ga0496112_0107826 3300048915 Bacteria 2755
285 Ga0496113_0424930 3300048916 Bacteria 1067
286 Ga0496115_0351838 3300048918 Bacteria 1201
287 Ga0496118_0012612 3300048921 Bacteria 8089
288 Ga0496125_0022425 3300048928 Bacteria 5864
289 Ga0501257_011515 3300049686 Bacteria 2019
290 Ga0501265_003851 3300049762 Bacteria 1704
291 nmdc:mga06z11_88083_c1 3300050494 Bacteria 1680
292 nmdc:mga09592_23184_c1 3300050508 Bacteria 5124
293 nmdc:mga08y16_52944_c1 3300050511 Bacteria 4245
294 Ga0500650_0000024 3300053098 Bacteria 61088
295 Ga0500595_007427 3300053119 Bacteria 4548
296 Ga0500636_0034270 3300053177 Bacteria 3004

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002772 JGI25164J39214_1001614 JGI25164J39214_10016146 211
2 3300005364 Ga0070673_100002495 Ga0070673_1000024953 211
3 3300009093 Ga0105240_10387300 Ga0105240_103873002 211
4 3300025231 Ga0207427_100272 Ga0207427_10027226 211
5 3300025909 Ga0207705_10515306 Ga0207705_105153062 211
6 3300025919 Ga0207657_10033413 Ga0207657_100334133 211
7 3300025932 Ga0207690_10096913 Ga0207690_100969132 211
8 3300037466 Ga0395898_0014144 Ga0395898_0014144_5436_6071 211
9 3300038443 Ga0395901_0050631 Ga0395901_0050631_143_778 211
10 3300017792 Ga0163161_10546207 Ga0163161_105462072 214
11 3300037471 Ga0395905_0166910 Ga0395905_0166910_1400_2044 214
12 3300013104 Ga0157370_10005720 Ga0157370_100057201 217
13 3300026088 Ga0207641_10364410 Ga0207641_103644101 217
14 3300014969 Ga0157376_10108297 Ga0157376_101082972 218
15 3300025942 Ga0207689_10035513 Ga0207689_100355134 218
16 3300007076 Ga0075435_100576015 Ga0075435_1005760152 219
17 3300046660 Ga0495625_0004543 Ga0495625_0004543_2971_3630 219
18 3300013308 Ga0157375_10423096 Ga0157375_104230962 220
19 3300044712 Ga0453684_0199115 Ga0453684_0199115_439_1110 222
20 3300013306 Ga0163162_10029638 Ga0163162_100296383 225
21 3300013308 Ga0157375_10722889 Ga0157375_107228892 225
22 3300042156 Ga0439446_0007462 Ga0439446_0007462_1512_2192 226
23 3300042435 Ga0439434_0010720 Ga0439434_0010720_1200_1880 226
24 3300041411 Ga0439466_0002189 Ga0439466_0002189_2969_3652 227
25 iso_pu_bacteria 2600255389 2602010913 227
26 3300005295 Ga0065707_10158201 Ga0065707_101582012 228
27 3300006844 Ga0075428_100013936 Ga0075428_1000139365 228
28 3300006880 Ga0075429_100007417 Ga0075429_10000741711 228
29 3300027907 Ga0207428_10032334 Ga0207428_100323342 228
30 3300002737 JGI25162J39368_1000344 JGI25162J39368_10003445 229
31 3300002771 JGI25163J39215_1000856 JGI25163J39215_10008567 229
32 3300002772 JGI25164J39214_1000253 JGI25164J39214_10002535 229
33 3300002772 JGI25164J39214_1000255 JGI25164J39214_100025533 229
34 3300003214 JGI25165J46597_1000463 JGI25165J46597_10004635 229
35 3300025207 Ga0209760_100162 Ga0209760_1001625 229
36 3300025231 Ga0207427_100114 Ga0207427_10011459 229
37 3300025233 Ga0209437_100219 Ga0209437_10021959 229
38 3300025261 Ga0209233_1000012 Ga0209233_1000012871 229
39 3300031548 Ga0307408_100010436 Ga0307408_1000104363 229
40 3300031731 Ga0307405_10002728 Ga0307405_100027283 229
41 3300031852 Ga0307410_10007663 Ga0307410_100076634 229
42 3300031911 Ga0307412_10010890 Ga0307412_100108904 229
43 3300031995 Ga0307409_100052381 Ga0307409_1000523812 229
44 3300032002 Ga0307416_100000500 Ga0307416_10000050016 229
45 3300032004 Ga0307414_10134005 Ga0307414_101340051 229
46 3300032005 Ga0307411_10001394 Ga0307411_100013944 229
47 3300032126 Ga0307415_100006019 Ga0307415_1000060192 229
48 3300042003 Ga0439443_010391 Ga0439443_010391_541_1230 229
49 3300042004 Ga0439445_0107636 Ga0439445_0107636_15_704 229
50 3300042125 Ga0450923_000102 Ga0450923_000102_2074_2763 229
51 3300042131 Ga0450894_011476 Ga0450894_011476_408_1097 229
52 3300042133 Ga0450896_006872 Ga0450896_006872_91_780 229
53 3300042156 Ga0439446_0000061 Ga0439446_0000061_14036_14725 229
54 3300042184 Ga0450908_000502 Ga0450908_000502_4977_5666 229
55 3300042435 Ga0439434_0000822 Ga0439434_0000822_1859_2548 229
56 3300042436 Ga0439435_0000056 Ga0439435_0000056_4577_5266 229
57 3300042437 Ga0439444_0014027 Ga0439444_0014027_486_1175 229
58 3300042461 Ga0439460_0003830 Ga0439460_0003830_2272_2961 229
59 3300002705 JGI25156J39149_1001992 JGI25156J39149_10019928 230
60 3300002738 JGI25154J39366_1000337 JGI25154J39366_100033713 230
61 3300002741 JGI25157J39369_1000073 JGI25157J39369_100007364 230
62 3300002741 JGI25157J39369_1000296 JGI25157J39369_100029626 230
63 3300005339 Ga0070660_100006833 Ga0070660_1000068333 230
64 3300005364 Ga0070673_100381762 Ga0070673_1003817621 230
65 3300005366 Ga0070659_100109501 Ga0070659_1001095012 230
66 3300005439 Ga0070711_100015624 Ga0070711_1000156242 230
67 3300005466 Ga0070685_10457585 Ga0070685_104575851 230
68 3300005535 Ga0070684_100263999 Ga0070684_1002639992 230
69 3300005539 Ga0068853_100168441 Ga0068853_1001684412 230
70 3300005548 Ga0070665_100147018 Ga0070665_1001470182 230
71 3300005563 Ga0068855_100007451 Ga0068855_1000074515 230
72 3300005563 Ga0068855_100517416 Ga0068855_1005174162 230
73 3300005577 Ga0068857_100004102 Ga0068857_10000410215 230
74 3300005577 Ga0068857_100438601 Ga0068857_1004386012 230
75 3300005578 Ga0068854_100002155 Ga0068854_1000021554 230
76 3300005614 Ga0068856_100001352 Ga0068856_10000135222 230
77 3300005616 Ga0068852_100168391 Ga0068852_1001683914 230
78 3300005841 Ga0068863_101053857 Ga0068863_1010538571 230
79 3300009176 Ga0105242_10054422 Ga0105242_100544223 230
80 3300009545 Ga0105237_10049128 Ga0105237_100491284 230
81 3300025246 Ga0209646_1000067 Ga0209646_1000067123 230
82 3300025250 Ga0209026_1000033 Ga0209026_1000033107 230
83 3300025253 Ga0209677_100087 Ga0209677_10008790 230
84 3300025256 Ga0209759_1000024 Ga0209759_1000024107 230
85 3300025913 Ga0207695_10013841 Ga0207695_100138416 230
86 3300025913 Ga0207695_10341422 Ga0207695_103414222 230
87 3300025914 Ga0207671_10082258 Ga0207671_100822582 230
88 3300025919 Ga0207657_10163845 Ga0207657_101638452 230
89 3300025934 Ga0207686_10100850 Ga0207686_101008502 230
90 3300025944 Ga0207661_10601368 Ga0207661_106013681 230
91 3300025949 Ga0207667_10019398 Ga0207667_100193982 230
92 3300025949 Ga0207667_10682168 Ga0207667_106821682 230
93 3300025981 Ga0207640_10005245 Ga0207640_100052453 230
94 3300026078 Ga0207702_10001314 Ga0207702_100013149 230
95 3300026116 Ga0207674_10004669 Ga0207674_1000466913 230
96 3300026116 Ga0207674_10328318 Ga0207674_103283182 230
97 3300026142 Ga0207698_10899546 Ga0207698_108995461 230
98 3300031911 Ga0307412_10319213 Ga0307412_103192131 230
99 3300045051 Ga0451576_0252293 Ga0451576_0252293_1142_1834 230
100 3300046506 Ga0495583_0000159 Ga0495583_0000159_63138_63830 230
101 3300046507 Ga0495606_0002925 Ga0495606_0002925_14193_14885 230
102 3300046692 Ga0495671_0016295 Ga0495671_0016295_2772_3482 230
103 3300046694 Ga0495649_0000556 Ga0495649_0000556_13567_14259 230
104 3300048907 Ga0496104_0016024 Ga0496104_0016024_4358_5053 230
105 3300048907 Ga0496104_0497370 Ga0496104_0497370_364_1062 230
106 3300048908 Ga0496105_0001925 Ga0496105_0001925_9359_10054 230
107 3300048908 Ga0496105_0538890 Ga0496105_0538890_193_885 230
108 3300048911 Ga0496108_0117131 Ga0496108_0117131_1097_1789 230
109 3300048915 Ga0496112_0107826 Ga0496112_0107826_1719_2411 230
110 3300048916 Ga0496113_0424930 Ga0496113_0424930_344_1036 230
111 3300048918 Ga0496115_0351838 Ga0496115_0351838_228_923 230
112 3300049686 Ga0501257_011515 Ga0501257_011515_736_1428 230
113 3300049762 Ga0501265_003851 Ga0501265_003851_271_963 230
114 3300053177 Ga0500636_0034270 Ga0500636_0034270_354_1046 230
115 3300031548 Ga0307408_100000018 Ga0307408_100000018210 231
116 iso_pu_bacteria 2690315857 2691332730 231
117 iso_pu_bacteria 2919534386 2919537853 231
118 3300005367 Ga0070667_100001412 Ga0070667_1000014124 232
119 3300005548 Ga0070665_100000097 Ga0070665_100000097112 232
120 3300005842 Ga0068858_100074684 Ga0068858_1000746842 232
121 3300025972 Ga0207668_10198562 Ga0207668_101985622 232
122 3300026035 Ga0207703_10056791 Ga0207703_100567913 232
123 3300028379 Ga0268266_10000101 Ga0268266_10000101113 232
124 3300028381 Ga0268264_10185404 Ga0268264_101854042 232
125 3300005331 Ga0070670_100000054 Ga0070670_10000005451 233
126 3300005335 Ga0070666_10008211 Ga0070666_100082112 233
127 3300005353 Ga0070669_100001255 Ga0070669_1000012558 233
128 3300005355 Ga0070671_100000037 Ga0070671_10000003725 233
129 3300005367 Ga0070667_100000002 Ga0070667_100000002405 233
130 3300005466 Ga0070685_10000014 Ga0070685_1000001445 233
131 3300005548 Ga0070665_100013053 Ga0070665_1000130535 233
132 3300005617 Ga0068859_100010515 Ga0068859_1000105159 233
133 3300005618 Ga0068864_100000002 Ga0068864_10000000268 233
134 3300005842 Ga0068858_100124896 Ga0068858_1001248962 233
135 3300005843 Ga0068860_100000844 Ga0068860_10000084429 233
136 3300005844 Ga0068862_100003526 Ga0068862_1000035268 233
137 3300006931 Ga0097620_100010515 Ga0097620_1000105159 233
138 3300009101 Ga0105247_10125195 Ga0105247_101251951 233
139 3300009553 Ga0105249_10409557 Ga0105249_104095572 233
140 3300013306 Ga0163162_10030302 Ga0163162_100303022 233
141 3300014325 Ga0163163_10000762 Ga0163163_1000076219 233
142 3300014968 Ga0157379_10103429 Ga0157379_101034293 233
143 3300025903 Ga0207680_10018041 Ga0207680_100180417 233
144 3300025923 Ga0207681_10018937 Ga0207681_100189373 233
145 3300025925 Ga0207650_10000002 Ga0207650_1000000268 233
146 3300025931 Ga0207644_10000192 Ga0207644_1000019225 233
147 3300025941 Ga0207711_10000061 Ga0207711_1000006120 233
148 3300025941 Ga0207711_10000827 Ga0207711_100008278 233
149 3300025961 Ga0207712_10113078 Ga0207712_101130782 233
150 3300025986 Ga0207658_10000001 Ga0207658_100000011286 233
151 3300026035 Ga0207703_10083276 Ga0207703_100832762 233
152 3300026088 Ga0207641_10053218 Ga0207641_100532186 233
153 3300026095 Ga0207676_10000001 Ga0207676_1000000168 233
154 3300028379 Ga0268266_10023465 Ga0268266_100234658 233
155 3300028380 Ga0268265_10000888 Ga0268265_100008882 233
156 3300028381 Ga0268264_10000004 Ga0268264_1000000465 233
157 3300037418 Ga0395900_0511453 Ga0395900_0511453_267_968 233
158 3300042876 Ga0451577_0004169 Ga0451577_0004169_4040_4918 233
159 3300048928 Ga0496125_0022425 Ga0496125_0022425_4314_5015 233
160 3300005354 Ga0070675_100119554 Ga0070675_1001195542 234
161 3300005434 Ga0070709_10123417 Ga0070709_101234172 234
162 3300014326 Ga0157380_10255642 Ga0157380_102556424 234
163 3300017792 Ga0163161_10841840 Ga0163161_108418401 234
164 3300025938 Ga0207704_10478762 Ga0207704_104787621 234
165 3300025940 Ga0207691_10617912 Ga0207691_106179121 234
166 3300042121 Ga0450919_014656 Ga0450919_014656_61_765 234
167 3300042125 Ga0450923_013510 Ga0450923_013510_501_1205 234
168 3300042156 Ga0439446_0004824 Ga0439446_0004824_1476_2180 234
169 3300001904 JGI24736J21556_1000522 JGI24736J21556_10005223 235
170 3300005327 Ga0070658_10042194 Ga0070658_100421941 235
171 3300005335 Ga0070666_10000295 Ga0070666_1000029514 235
172 3300005338 Ga0068868_100038593 Ga0068868_1000385934 235
173 3300005338 Ga0068868_100186182 Ga0068868_1001861822 235
174 3300005340 Ga0070689_100542812 Ga0070689_1005428121 235
175 3300005341 Ga0070691_10438880 Ga0070691_104388801 235
176 3300005347 Ga0070668_100004327 Ga0070668_1000043274 235
177 3300005353 Ga0070669_100432362 Ga0070669_1004323622 235
178 3300005355 Ga0070671_100460127 Ga0070671_1004601272 235
179 3300005365 Ga0070688_100075041 Ga0070688_1000750413 235
180 3300005365 Ga0070688_100171130 Ga0070688_1001711302 235
181 3300005367 Ga0070667_100296572 Ga0070667_1002965722 235
182 3300005367 Ga0070667_100643567 Ga0070667_1006435671 235
183 3300005445 Ga0070708_100435867 Ga0070708_1004358672 235
184 3300005455 Ga0070663_100041321 Ga0070663_1000413212 235
185 3300005455 Ga0070663_100061824 Ga0070663_1000618244 235
186 3300005457 Ga0070662_100003879 Ga0070662_10000387915 235
187 3300005458 Ga0070681_10060295 Ga0070681_100602955 235
188 3300005459 Ga0068867_100095674 Ga0068867_1000956741 235
189 3300005466 Ga0070685_10000845 Ga0070685_100008452 235
190 3300005548 Ga0070665_100000414 Ga0070665_10000041449 235
191 3300005548 Ga0070665_100067901 Ga0070665_1000679012 235
192 3300005549 Ga0070704_100198833 Ga0070704_1001988332 235
193 3300005563 Ga0068855_100023082 Ga0068855_1000230821 235
194 3300005564 Ga0070664_100205628 Ga0070664_1002056281 235
195 3300005578 Ga0068854_100001345 Ga0068854_10000134515 235
196 3300005578 Ga0068854_100423562 Ga0068854_1004235622 235
197 3300005614 Ga0068856_100307921 Ga0068856_1003079213 235
198 3300005616 Ga0068852_100418152 Ga0068852_1004181522 235
199 3300005616 Ga0068852_100442710 Ga0068852_1004427102 235
200 3300005617 Ga0068859_100000201 Ga0068859_1000002017 235
201 3300005834 Ga0068851_10000410 Ga0068851_1000041014 235
202 3300005841 Ga0068863_100255131 Ga0068863_1002551312 235
203 3300005842 Ga0068858_100000101 Ga0068858_10000010128 235
204 3300005844 Ga0068862_100000245 Ga0068862_10000024541 235
205 3300006178 Ga0075367_10100618 Ga0075367_101006183 235
206 3300006237 Ga0097621_100388225 Ga0097621_1003882252 235
207 3300006844 Ga0075428_101154686 Ga0075428_1011546861 235
208 3300006881 Ga0068865_100063633 Ga0068865_1000636332 235
209 3300006931 Ga0097620_100000201 Ga0097620_1000002017 235
210 3300009093 Ga0105240_10002052 Ga0105240_1000205224 235
211 3300009093 Ga0105240_10010127 Ga0105240_1001012724 235
212 3300009093 Ga0105240_10566119 Ga0105240_105661191 235
213 3300009094 Ga0111539_10027861 Ga0111539_100278617 235
214 3300009174 Ga0105241_10006269 Ga0105241_1000626914 235
215 3300009545 Ga0105237_10037838 Ga0105237_100378387 235
216 3300009545 Ga0105237_10423265 Ga0105237_104232652 235
217 3300009551 Ga0105238_10000728 Ga0105238_1000072824 235
218 3300010375 Ga0105239_10007582 Ga0105239_100075822 235
219 3300010375 Ga0105239_10015410 Ga0105239_100154102 235
220 3300010375 Ga0105239_11215351 Ga0105239_112153511 235
221 3300013102 Ga0157371_10236217 Ga0157371_102362172 235
222 3300013104 Ga0157370_10126564 Ga0157370_101265642 235
223 3300013105 Ga0157369_10878130 Ga0157369_108781301 235
224 3300014325 Ga0163163_10551451 Ga0163163_105514511 235
225 3300014326 Ga0157380_10049744 Ga0157380_100497442 235
226 3300014326 Ga0157380_10663434 Ga0157380_106634342 235
227 3300014968 Ga0157379_10315780 Ga0157379_103157801 235
228 3300025261 Ga0209233_1005094 Ga0209233_10050944 235
229 3300025903 Ga0207680_10001552 Ga0207680_100015529 235
230 3300025904 Ga0207647_10000075 Ga0207647_1000007524 235
231 3300025912 Ga0207707_10072023 Ga0207707_100720231 235
232 3300025913 Ga0207695_10000007 Ga0207695_10000007285 235
233 3300025913 Ga0207695_10015797 Ga0207695_100157972 235
234 3300025913 Ga0207695_10020026 Ga0207695_100200262 235
235 3300025914 Ga0207671_10031099 Ga0207671_100310994 235
236 3300025914 Ga0207671_10033248 Ga0207671_100332482 235
237 3300025923 Ga0207681_10205712 Ga0207681_102057122 235
238 3300025924 Ga0207694_10000363 Ga0207694_1000036314 235
239 3300025924 Ga0207694_10000566 Ga0207694_1000056625 235
240 3300025932 Ga0207690_10432047 Ga0207690_104320471 235
241 3300025933 Ga0207706_10032847 Ga0207706_100328473 235
242 3300025934 Ga0207686_10191935 Ga0207686_101919352 235
243 3300025949 Ga0207667_10342920 Ga0207667_103429202 235
244 3300025960 Ga0207651_10003708 Ga0207651_100037084 235
245 3300025961 Ga0207712_10000211 Ga0207712_1000021127 235
246 3300025981 Ga0207640_10003703 Ga0207640_1000370310 235
247 3300025986 Ga0207658_10100958 Ga0207658_101009582 235
248 3300025986 Ga0207658_10448987 Ga0207658_104489872 235
249 3300026023 Ga0207677_10084113 Ga0207677_100841133 235
250 3300026023 Ga0207677_10270434 Ga0207677_102704342 235
251 3300026035 Ga0207703_10000180 Ga0207703_1000018033 235
252 3300026041 Ga0207639_10000367 Ga0207639_1000036732 235
253 3300026067 Ga0207678_10004319 Ga0207678_100043193 235
254 3300026067 Ga0207678_10014983 Ga0207678_1001498310 235
255 3300026067 Ga0207678_10025246 Ga0207678_100252464 235
256 3300026088 Ga0207641_10112071 Ga0207641_101120712 235
257 3300026089 Ga0207648_10045250 Ga0207648_100452505 235
258 3300026116 Ga0207674_10104345 Ga0207674_101043452 235
259 3300026142 Ga0207698_10237017 Ga0207698_102370171 235
260 3300026142 Ga0207698_10646272 Ga0207698_106462721 235
261 3300028379 Ga0268266_10000008 Ga0268266_10000008409 235
262 3300028380 Ga0268265_10000509 Ga0268265_1000050925 235
263 3300028381 Ga0268264_10038744 Ga0268264_100387442 235
264 3300031250 Ga0265331_10015456 Ga0265331_100154561 235
265 3300031251 Ga0265327_10000008 Ga0265327_10000008592 235
266 3300031251 Ga0265327_10000540 Ga0265327_1000054032 235
267 3300031251 Ga0265327_10022809 Ga0265327_100228093 235
268 3300031548 Ga0307408_100000060 Ga0307408_10000006085 235
269 3300031548 Ga0307408_100005552 Ga0307408_1000055527 235
270 3300031665 Ga0316575_10014033 Ga0316575_100140333 235
271 3300031691 Ga0316579_10011287 Ga0316579_100112875 235
272 3300031727 Ga0316576_10145716 Ga0316576_101457162 235
273 3300031727 Ga0316576_10399424 Ga0316576_103994241 235
274 3300031728 Ga0316578_10011297 Ga0316578_100112971 235
275 3300031733 Ga0316577_10002020 Ga0316577_100020202 235
276 3300031733 Ga0316577_10024646 Ga0316577_100246462 235
277 3300031901 Ga0307406_10005694 Ga0307406_100056944 235
278 3300031901 Ga0307406_10011237 Ga0307406_100112376 235
279 3300032133 Ga0316583_10045941 Ga0316583_100459412 235
280 3300032139 Ga0316580_10007702 Ga0316580_100077022 235
281 3300032139 Ga0316580_10017612 Ga0316580_100176122 235
282 3300035398 Ga0316574_0037530 Ga0316574_0037530_833_1543 235
283 3300035398 Ga0316574_0038101 Ga0316574_0038101_142_864 235
284 3300036647 Ga0316582_0053388 Ga0316582_0053388_1758_2468 235
285 3300036712 Ga0316584_0044703 Ga0316584_0044703_2352_3074 235
286 3300037588 Ga0316581_0038956 Ga0316581_0038956_320_1030 235
287 3300042000 Ga0439437_000160 Ga0439437_000160_2466_3212 235
288 3300042013 Ga0439456_003630 Ga0439456_003630_136_882 235
289 3300042115 Ga0450911_000005 Ga0450911_000005_52258_53004 235
290 3300042129 Ga0450891_000598 Ga0450891_000598_2134_2904 235
291 3300042139 Ga0450904_000005 Ga0450904_000005_4397_5143 235
292 3300042142 Ga0450905_009968 Ga0450905_009968_99_845 235
293 3300042532 Ga0450893_0001549 Ga0450893_0001549_27_773 235
294 3300048921 Ga0496118_0012612 Ga0496118_0012612_209_931 235
295 3300050494 nmdc:mga06z11_88083_c1 nmdc:mga06z11_88083_c1_874_1587 235
296 3300050508 nmdc:mga09592_23184_c1 nmdc:mga09592_23184_c1_3137_3871 235
297 3300050511 nmdc:mga08y16_52944_c1 nmdc:mga08y16_52944_c1_626_1360 235
298 3300053098 Ga0500650_0000024 Ga0500650_0000024_7973_8704 235
299 3300053119 Ga0500595_007427 Ga0500595_007427_118_909 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

183

250

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ffq-assembly2.cif.gz_B hcn2i 443-640 apo-state 0.8822 13 127
3ffq-assembly1.cif.gz_A hcn2i 443-640 apo-state 0.8782 13 130
6rsx-assembly1.cif.gz_A regulatory subunit of camp-dependant protein kinase a from euglena gracilis at 1.6 a resolution 0.8659 11 129
4ku7-assembly1.cif.gz_A structures of pkgi reveal a cgmp-selective activation mechanism 0.8653 13 116
4hbn-assembly1.cif.gz_A crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation 0.8645 13 136
ID Description Score Start End Superfamily
4n9iC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9701 168 210 1.10.10.10
4n9iD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 168 210 1.10.10.10
3dv8A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9428 149 218 1.10.10.10
3iwzA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 149 209 1.10.10.10
1z05A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 172 201 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A257FJN5-F1-model_v4 deleted 0.9892 9 232
AF-A0A515D744-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9746 11 235 GO:0003677
GO:0003700
GO:0005829
AF-A0A2T1E1Z0-F1-model_v4 Crp/Fnr family transcriptional regulator 0.973 10 234 GO:0003677
GO:0003700
GO:0005829
AF-A0A3D1IZK8-F1-model_v4 Protein kinase 0.9706 6 234 GO:0003677
GO:0003700
GO:0005829
GO:0016301
AF-A0A3T0VUM7-F1-model_v4 deleted 0.9679 5 232

Feature Viewer

pLDDT pTM Quality
92.67 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map