F394823

General Info

Members Datasets Scaffolds Average Seq Length
299 180 596 180

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11340232|Ga0105248_113402322
Length 162
Sequence MGVAEHRKEAVKGVRCAVLTISDTRKPETDVSGRTIVEIREKIQAWVASGFVEAIITTGGTGITGRDVTPEAFDHVLEKRIEGFGELFRMLSYAKIGTSTMQSRALGGVAGGTYLFALPGSTGAVRDAWDDILVHQLDNRFRPCNLVELMPRLQEHLQPAAE

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
88 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
89 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
90 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
91 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
167 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
176 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
177 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
178 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
179 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
180 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 2.68
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 0.33
Rhizoplane 2.01
Rhizosphere 77.26
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11340232 3300009177 Bacteria 810
2 rootH1_10269177 3300003323 Bacteria 1439
3 Ga0058862_12730972 3300004803 Bacteria 782
4 Ga0070658_10363431 3300005327 Bacteria 1240
5 Ga0070683_100413234 3300005329 Bacteria 1287
6 Ga0070680_100000855 3300005336 Bacteria 21623
7 Ga0070709_10264738 3300005434 Bacteria 1243
8 Ga0070713_100165822 3300005436 Bacteria 1975
9 Ga0070713_100614816 3300005436 Bacteria 1033
10 Ga0070713_101180254 3300005436 Bacteria 741
11 Ga0070710_10051402 3300005437 Bacteria 2314
12 Ga0070710_10670204 3300005437 Bacteria 729
13 Ga0070711_100079415 3300005439 Bacteria 2333
14 Ga0070711_100119395 3300005439 Bacteria 1948
15 Ga0070708_100710531 3300005445 Bacteria 946
16 Ga0070678_100015575 3300005456 Bacteria 4836
17 Ga0070681_10003166 3300005458 Bacteria 15312
18 Ga0070681_10569910 3300005458 Bacteria 1046
19 Ga0070707_100176545 3300005468 Bacteria 2082
20 Ga0070679_100002839 3300005530 Bacteria 15744
21 Ga0070679_100088572 3300005530 Bacteria 3082
22 Ga0070679_100651732 3300005530 Bacteria 996
23 Ga0070686_100204021 3300005544 Bacteria 1419
24 Ga0070665_100093878 3300005548 Bacteria 3005
25 Ga0068854_100087351 3300005578 Bacteria 2313
26 Ga0068856_100047534 3300005614 Bacteria 4227
27 Ga0068858_100440970 3300005842 Bacteria 1254
28 Ga0081455_10048246 3300005937 Bacteria 3681
29 Ga0081455_10444364 3300005937 Bacteria 887
30 Ga0070717_10054362 3300006028 Bacteria 3302
31 Ga0070717_10060965 3300006028 Bacteria 3125
32 Ga0070717_10230497 3300006028 Bacteria 1631
33 Ga0070717_10265949 3300006028 Bacteria 1518
34 Ga0070716_100510208 3300006173 Bacteria 889
35 Ga0070712_100065785 3300006175 Bacteria 2574
36 Ga0070712_100209876 3300006175 Bacteria 1535
37 Ga0070712_100752918 3300006175 Bacteria 834
38 Ga0075369_10060452 3300006186 Bacteria 1653
39 Ga0075430_100069801 3300006846 Bacteria 2947
40 Ga0075430_100410613 3300006846 Bacteria 1118
41 Ga0099795_10053721 3300007788 Bacteria 1475
42 Ga0099795_10210454 3300007788 Bacteria 824
43 Ga0105240_10812726 3300009093 Bacteria 1012
44 Ga0111539_10914958 3300009094 Bacteria 1020
45 Ga0105247_10366939 3300009101 Bacteria 1017
46 Ga0105248_10101190 3300009177 Bacteria 3248
47 Ga0105238_10478919 3300009551 Bacteria 1244
48 Ga0099796_10120857 3300010159 Bacteria 1006
49 Ga0157374_10323745 3300013296 Bacteria 1528
50 Ga0163163_11045274 3300014325 Bacteria 880
51 Ga0182008_10061668 3300014497 Bacteria 1848
52 Ga0182008_10088845 3300014497 Bacteria 1522
53 Ga0182008_10201079 3300014497 Bacteria 1014
54 Ga0182008_10383529 3300014497 Bacteria 752
55 Ga0157379_11224567 3300014968 Bacteria 723
56 Ga0163161_10549535 3300017792 Bacteria 946
57 Ga0213872_10006167 3300021361 Bacteria 6055
58 Ga0213872_10019280 3300021361 Bacteria 3142
59 Ga0213874_10240062 3300021377 Bacteria 665
60 Ga0213876_10428810 3300021384 Bacteria 703
61 Ga0213875_10000536 3300021388 Bacteria 31187
62 Ga0213875_10004859 3300021388 Bacteria 7296
63 Ga0213875_10032964 3300021388 Bacteria 2446
64 Ga0213875_10041097 3300021388 Bacteria 2175
65 Ga0213875_10047324 3300021388 Bacteria 2018
66 Ga0213875_10069668 3300021388 Bacteria 1642
67 Ga0213875_10104772 3300021388 Bacteria 1320
68 Ga0213871_10023131 3300021441 Bacteria 1562
69 Ga0224712_10241173 3300022467 Bacteria 833
70 Ga0209233_1012141 3300025261 Bacteria 2510
71 Ga0209130_1000573 3300025284 Bacteria 35960
72 Ga0207426_1000404 3300025302 Bacteria 72541
73 Ga0207699_10132515 3300025906 Bacteria 1628
74 Ga0207699_10469346 3300025906 Bacteria 905
75 Ga0207707_10007074 3300025912 Bacteria 9781
76 Ga0207707_10228795 3300025912 Bacteria 1618
77 Ga0207707_10385883 3300025912 Bacteria 1204
78 Ga0207695_10534226 3300025913 Bacteria 1054
79 Ga0207693_10002944 3300025915 Bacteria 14738
80 Ga0207693_10050777 3300025915 Bacteria 3256
81 Ga0207693_10189512 3300025915 Bacteria 1618
82 Ga0207693_10211861 3300025915 Bacteria 1523
83 Ga0207693_10510543 3300025915 Bacteria 938
84 Ga0207660_10001776 3300025917 Bacteria 14425
85 Ga0207652_10041637 3300025921 Bacteria 3906
86 Ga0207652_10445157 3300025921 Bacteria 1168
87 Ga0207652_10490252 3300025921 Bacteria 1107
88 Ga0207700_10002652 3300025928 Bacteria 10303
89 Ga0207700_10050638 3300025928 Bacteria 3096
90 Ga0207700_10187791 3300025928 Bacteria 1735
91 Ga0207700_10254841 3300025928 Bacteria 1500
92 Ga0207700_10408051 3300025928 Bacteria 1191
93 Ga0207664_10062005 3300025929 Bacteria 2985
94 Ga0207664_10085649 3300025929 Bacteria 2572
95 Ga0207664_10113721 3300025929 Bacteria 2254
96 Ga0207664_10389583 3300025929 Bacteria 1238
97 Ga0207664_10941404 3300025929 Bacteria 775
98 Ga0207665_10125746 3300025939 Bacteria 1815
99 Ga0207711_10228463 3300025941 Bacteria 1704
100 Ga0207661_10176993 3300025944 Bacteria 1861
101 Ga0207667_10487617 3300025949 Bacteria 1251
102 Ga0207667_10925312 3300025949 Bacteria 863
103 Ga0207703_10171903 3300026035 Bacteria 1906
104 Ga0207703_10211586 3300026035 Bacteria 1729
105 Ga0207702_10006013 3300026078 Bacteria 10529
106 Ga0207702_11018725 3300026078 Bacteria 821
107 Ga0207683_10107676 3300026121 Bacteria 2494
108 Ga0268266_10134577 3300028379 Bacteria 2213
109 Ga0265338_10600621 3300028800 Bacteria 766
110 Ga0265327_10002149 3300031251 Bacteria 21745
111 Ga0265327_10008079 3300031251 Bacteria 7925
112 Ga0307513_10093872 3300031456 Bacteria 3048
113 Ga0307416_100560032 3300032002 Bacteria 1218
114 Ga0373926_0015669 3300035083 Bacteria 2586
115 Ga0373934_0011346 3300035086 Bacteria 3354
116 Ga0373944_0006729 3300035089 Bacteria 3058
117 Ga0373923_0029923 3300035111 Bacteria 2187
118 Ga0373923_0331469 3300035111 Bacteria 724
119 Ga0373941_0084258 3300035115 Bacteria 1079
120 Ga0373945_0143678 3300035116 Bacteria 963
121 Ga0373953_0011030 3300035117 Bacteria 3159
122 Ga0373954_0013044 3300035118 Bacteria 3699
123 Ga0373954_0069333 3300035118 Bacteria 1674
124 Ga0373954_0119097 3300035118 Bacteria 1281
125 Ga0373954_0210929 3300035118 Bacteria 955
126 Ga0373956_0005342 3300035119 Bacteria 5141
127 Ga0373956_0010673 3300035119 Bacteria 3771
128 Ga0373957_0047471 3300035120 Bacteria 1633
129 Ga0373943_0024958 3300035170 Bacteria 2791
130 Ga0373943_0224562 3300035170 Bacteria 1047
131 Ga0373955_0023118 3300035172 Bacteria 3163
132 Ga0373924_0042004 3300035410 Bacteria 1875
133 Ga0373931_0044854 3300035691 Bacteria 2333
134 Ga0373935_0006392 3300035692 Bacteria 7029
135 Ga0373935_0078672 3300035692 Bacteria 2139
136 Ga0373933_0002132 3300035724 Bacteria 11371
137 Ga0373933_0004882 3300035724 Bacteria 7320
138 Ga0373933_0169357 3300035724 Bacteria 1389
139 Ga0373933_0179412 3300035724 Bacteria 1350
140 Ga0373933_0432316 3300035724 Bacteria 860
141 Ga0373947_0050533 3300035725 Bacteria 2500
142 Ga0373947_0543340 3300035725 Bacteria 791
143 Ga0373937_0002684 3300036401 Bacteria 14843
144 Ga0373937_0051990 3300036401 Bacteria 3755
145 Ga0373937_0229927 3300036401 Bacteria 1746
146 Ga0373937_0487879 3300036401 Bacteria 1170
147 Ga0373937_0592625 3300036401 Bacteria 1052
148 Ga0373925_0012299 3300037068 Bacteria 6193
149 Ga0373925_0023777 3300037068 Bacteria 4470
150 Ga0373925_0148436 3300037068 Bacteria 1839
151 Ga0373925_1275071 3300037068 Bacteria 603
152 Ga0436364_0028637 3300037853 Bacteria 4003
153 Ga0436364_0305898 3300037853 Bacteria 2899
154 Ga0436364_0454682 3300037853 Bacteria 15734
155 Ga0436364_0727265 3300037853 Bacteria 9980
156 Ga0436364_0741160 3300037853 Bacteria 51330
157 Ga0436364_0791399 3300037853 Bacteria 2500
158 Ga0436364_0807686 3300037853 Bacteria 1146
159 Ga0436364_1012724 3300037853 Bacteria 3458
160 Ga0436364_1070118 3300037853 Bacteria 1395
161 Ga0436364_1213552 3300037853 Bacteria 904
162 Ga0436364_1439493 3300037853 Bacteria 584
163 Ga0400484_01201 3300038725 Bacteria 4142
164 Ga0400490_04814 3300038726 Bacteria 4244
165 Ga0400491_16584 3300038727 Bacteria 1009
166 Ga0400488_51583 3300038741 Bacteria 1022
167 Ga0400486_24887 3300038742 Bacteria 3616
168 Ga0400483_025491 3300039062 Bacteria 1292
169 Ga0400483_056119 3300039062 Bacteria 9579
170 Ga0400483_157269 3300039062 Bacteria 10695
171 Ga0400483_215676 3300039062 Bacteria 5503
172 Ga0400483_254928 3300039062 Unclassified 3835
173 Ga0400487_08115 3300039110 Bacteria 39055
174 Ga0400487_26883 3300039110 Unclassified 1749
175 Ga0400487_44429 3300039110 Bacteria 1709
176 Ga0400487_52381 3300039110 Bacteria 5647
177 Ga0436365_0541822 3300039437 Bacteria 1169
178 Ga0436365_0890239 3300039437 Bacteria 853
179 Ga0436365_1501287 3300039437 Bacteria 762
180 Ga0436360_0142058 3300039438 Bacteria 1448
181 Ga0436360_0225066 3300039438 Bacteria 745
182 Ga0436360_0242326 3300039438 Bacteria 3276
183 Ga0436360_0337114 3300039438 Bacteria 5518
184 Ga0436360_0347370 3300039438 Bacteria 2497
185 Ga0436360_0591531 3300039438 Bacteria 6614
186 Ga0436361_0116671 3300039447 Bacteria 8674
187 Ga0436361_0253120 3300039447 Bacteria 1739
188 Ga0436361_0282139 3300039447 Bacteria 3114
189 Ga0436361_0538563 3300039447 Bacteria 1209
190 Ga0436361_0910727 3300039447 Bacteria 35301
191 Ga0436361_0930250 3300039447 Bacteria 933
192 Ga0436361_0952936 3300039447 Bacteria 6615
193 Ga0436361_1049620 3300039447 Bacteria 2978
194 Ga0436361_1116824 3300039447 Bacteria 1861
195 Ga0436363_0785570 3300039450 Bacteria 1014
196 Ga0436363_0864422 3300039450 Bacteria 954
197 Ga0436363_1019408 3300039450 Bacteria 1050
198 Ga0436363_1208704 3300039450 Bacteria 943
199 Ga0436362_0843464 3300039453 Bacteria 1599
200 Ga0450923_034598 3300042125 Bacteria 1043
201 Ga0466964_0226571 3300044706 Bacteria 910
202 Ga0466968_0174144 3300044735 Bacteria 998
203 Ga0466960_0172157 3300044901 Bacteria 1169
204 Ga0451576_1250662 3300045051 Bacteria 774
205 Ga0495592_0076276 3300046454 Bacteria 2433
206 Ga0495629_0278702 3300046459 Bacteria 1148
207 Ga0495651_0021946 3300046462 Bacteria 4965
208 Ga0495651_0409574 3300046462 Bacteria 883
209 Ga0495653_0110144 3300046463 Bacteria 1980
210 Ga0495580_0382798 3300046472 Bacteria 950
211 Ga0495582_0222385 3300046473 Bacteria 1080
212 Ga0495639_0492373 3300046475 Bacteria 625
213 Ga0495664_0026132 3300046477 Bacteria 3400
214 Ga0495608_0050948 3300046511 Bacteria 2745
215 Ga0495608_0064319 3300046511 Bacteria 2405
216 Ga0495608_0130169 3300046511 Bacteria 1611
217 Ga0495618_0186246 3300046514 Bacteria 1318
218 Ga0495618_0279803 3300046514 Bacteria 1041
219 Ga0495643_0013100 3300046522 Bacteria 4980
220 Ga0495640_0180961 3300046533 Bacteria 1343
221 Ga0495640_0224945 3300046533 Bacteria 1182
222 Ga0495587_0252918 3300046536 Bacteria 990
223 Ga0495645_0023344 3300046543 Bacteria 4478
224 Ga0495645_0074780 3300046543 Bacteria 2439
225 Ga0495667_0209983 3300046559 Bacteria 1244
226 Ga0495635_0393658 3300046663 Bacteria 921
227 Ga0495657_0171425 3300046675 Bacteria 1336
228 Ga0495599_0049714 3300046678 Bacteria 2628
229 Ga0495599_0175310 3300046678 Bacteria 1322
230 Ga0495623_0065835 3300046679 Bacteria 2265
231 Ga0495658_0117582 3300046683 Bacteria 1605
232 Ga0495613_0121218 3300046689 Bacteria 1878
233 Ga0495600_0178146 3300046809 Bacteria 1370
234 Ga0495581_0344621 3300047315 Bacteria 870
235 Ga0495604_0018130 3300047317 Bacteria 5635
236 Ga0495674_0096836 3300047319 Bacteria 2514
237 Ga0495674_0290596 3300047319 Bacteria 1337
238 Ga0495680_0018421 3300047322 Bacteria 5930
239 Ga0495675_0013697 3300047444 Bacteria 5125
240 Ga0495684_0099292 3300047471 Bacteria 2201
241 Ga0495684_0243574 3300047471 Bacteria 1310
242 Ga0495686_0064460 3300047472 Bacteria 2268
243 Ga0495602_0003660 3300048088 Bacteria 15928
244 Ga0495602_0090895 3300048088 Bacteria 2534
245 Ga0495602_0268424 3300048088 Bacteria 1262
246 Ga0496103_0571486 3300048906 Bacteria 721
247 Ga0496104_0215225 3300048907 Bacteria 1833
248 Ga0496109_0330510 3300048912 Bacteria 1439
249 Ga0496110_0767624 3300048913 Bacteria 868
250 Ga0496112_0694170 3300048915 Bacteria 946
251 Ga0496113_0247280 3300048916 Bacteria 1423
252 Ga0496117_0129894 3300048920 Bacteria 1529
253 Ga0496118_0112541 3300048921 Bacteria 1801
254 Ga0496126_0000029 3300048929 Bacteria 389370
255 Ga0496126_0093514 3300048929 Bacteria 2640
256 Ga0501033_0228436 3300049570 Bacteria 1323
257 Ga0501034_0200766 3300049571 Bacteria 1952
258 Ga0501036_0123902 3300049572 Bacteria 2183
259 Ga0501040_0257600 3300049576 Bacteria 1245
260 Ga0501041_0274542 3300049577 Bacteria 1060
261 Ga0501047_0337098 3300049581 Bacteria 1346
262 Ga0501048_0108075 3300049582 Bacteria 1964
263 Ga0501069_0128595 3300049585 Bacteria 1450
264 Ga0501070_0091754 3300049586 Bacteria 2514
265 Ga0501070_0195573 3300049586 Bacteria 1661
266 Ga0501076_0831485 3300049592 Bacteria 762
267 Ga0501080_1045925 3300049742 Bacteria 707
268 Ga0501263_006786 3300049760 Bacteria 1331
269 Ga0501044_1054625 3300049823 Bacteria 683
270 nmdc:mga00v17_124356_c1 3300050491 Bacteria 1645
271 nmdc:mga0qj67_152598_c1 3300050509 Bacteria 1874
272 nmdc:mga0sz30_104431_c1 3300050516 Bacteria 1239
273 Ga0495601_0032418 3300053077 Bacteria 3253
274 Ga0495601_0257429 3300053077 Bacteria 1139
275 Ga0495601_0515891 3300053077 Bacteria 770
276 Ga0495612_0012190 3300053078 Bacteria 3465
277 Ga0495595_0055833 3300053084 Bacteria 1839
278 Ga0495595_0102212 3300053084 Bacteria 1384
279 Ga0495595_0332048 3300053084 Bacteria 766
280 Ga0495619_0151928 3300053085 Bacteria 1597
281 Ga0500578_0068786 3300053086 Bacteria 2257
282 Ga0500643_003385 3300053087 Bacteria 7710
283 Ga0500559_0001746 3300053136 Bacteria 11915
284 Ga0500661_000173 3300055283 Bacteria 11231
285 Ga0587084_013706 3300059477 Bacteria 1119
286 Ga0587073_0021761 3300059492 Bacteria 1237
287 Ga0587083_0032712 3300059505 Bacteria 1045
288 Ga0587075_042106 3300059644 Bacteria 769
289 Ga0587076_091870 3300059645 Bacteria 665
290 Ga0587111_0129512 3300060346 Bacteria 658
291 Ga0466962_0046484 3300061719 Bacteria 2074
292 Ga0530510_0338855 3300061734 Bacteria 1129
293 2512643639 2512564014 Bacteria 4639632
294 2842336715 2842333319 Bacteria 8899485
295 2842776875 2842775625 Bacteria 5587290
296 2883577556 2883577096 Bacteria 4709178
297 2929204522 2929199973 Bacteria 7260745
298 8055916315 8055909800 Bacteria 7278581
299 Ga0105248_11340232
300 rootH1_10269177
301 Ga0058862_12730972
302 Ga0070658_10363431
303 Ga0070683_100413234
304 Ga0070680_100000855
305 Ga0070709_10264738
306 Ga0070713_100165822
307 Ga0070713_100614816
308 Ga0070713_101180254
309 Ga0070710_10051402
310 Ga0070710_10670204
311 Ga0070711_100079415
312 Ga0070711_100119395
313 Ga0070708_100710531
314 Ga0070678_100015575
315 Ga0070681_10003166
316 Ga0070681_10569910
317 Ga0070707_100176545
318 Ga0070679_100002839
319 Ga0070679_100088572
320 Ga0070679_100651732
321 Ga0070686_100204021
322 Ga0070665_100093878
323 Ga0068854_100087351
324 Ga0068856_100047534
325 Ga0068858_100440970
326 Ga0081455_10048246
327 Ga0081455_10444364
328 Ga0070717_10054362
329 Ga0070717_10060965
330 Ga0070717_10230497
331 Ga0070717_10265949
332 Ga0070716_100510208
333 Ga0070712_100065785
334 Ga0070712_100209876
335 Ga0070712_100752918
336 Ga0075369_10060452
337 Ga0075430_100069801
338 Ga0075430_100410613
339 Ga0099795_10053721
340 Ga0099795_10210454
341 Ga0105240_10812726
342 Ga0111539_10914958
343 Ga0105247_10366939
344 Ga0105248_10101190
345 Ga0105238_10478919
346 Ga0099796_10120857
347 Ga0157374_10323745
348 Ga0163163_11045274
349 Ga0182008_10061668
350 Ga0182008_10088845
351 Ga0182008_10201079
352 Ga0182008_10383529
353 Ga0157379_11224567
354 Ga0163161_10549535
355 Ga0213872_10006167
356 Ga0213872_10019280
357 Ga0213874_10240062
358 Ga0213876_10428810
359 Ga0213875_10000536
360 Ga0213875_10004859
361 Ga0213875_10032964
362 Ga0213875_10041097
363 Ga0213875_10047324
364 Ga0213875_10069668
365 Ga0213875_10104772
366 Ga0213871_10023131
367 Ga0224712_10241173
368 Ga0209233_1012141
369 Ga0209130_1000573
370 Ga0207426_1000404
371 Ga0207699_10132515
372 Ga0207699_10469346
373 Ga0207707_10007074
374 Ga0207707_10228795
375 Ga0207707_10385883
376 Ga0207695_10534226
377 Ga0207693_10002944
378 Ga0207693_10050777
379 Ga0207693_10189512
380 Ga0207693_10211861
381 Ga0207693_10510543
382 Ga0207660_10001776
383 Ga0207652_10041637
384 Ga0207652_10445157
385 Ga0207652_10490252
386 Ga0207700_10002652
387 Ga0207700_10050638
388 Ga0207700_10187791
389 Ga0207700_10254841
390 Ga0207700_10408051
391 Ga0207664_10062005
392 Ga0207664_10085649
393 Ga0207664_10113721
394 Ga0207664_10389583
395 Ga0207664_10941404
396 Ga0207665_10125746
397 Ga0207711_10228463
398 Ga0207661_10176993
399 Ga0207667_10487617
400 Ga0207667_10925312
401 Ga0207703_10171903
402 Ga0207703_10211586
403 Ga0207702_10006013
404 Ga0207702_11018725
405 Ga0207683_10107676
406 Ga0268266_10134577
407 Ga0265338_10600621
408 Ga0265327_10002149
409 Ga0265327_10008079
410 Ga0307513_10093872
411 Ga0307416_100560032
412 Ga0373926_0015669
413 Ga0373934_0011346
414 Ga0373944_0006729
415 Ga0373923_0029923
416 Ga0373923_0331469
417 Ga0373941_0084258
418 Ga0373945_0143678
419 Ga0373953_0011030
420 Ga0373954_0013044
421 Ga0373954_0069333
422 Ga0373954_0119097
423 Ga0373954_0210929
424 Ga0373956_0005342
425 Ga0373956_0010673
426 Ga0373957_0047471
427 Ga0373943_0024958
428 Ga0373943_0224562
429 Ga0373955_0023118
430 Ga0373924_0042004
431 Ga0373931_0044854
432 Ga0373935_0006392
433 Ga0373935_0078672
434 Ga0373933_0002132
435 Ga0373933_0004882
436 Ga0373933_0169357
437 Ga0373933_0179412
438 Ga0373933_0432316
439 Ga0373947_0050533
440 Ga0373947_0543340
441 Ga0373937_0002684
442 Ga0373937_0051990
443 Ga0373937_0229927
444 Ga0373937_0487879
445 Ga0373937_0592625
446 Ga0373925_0012299
447 Ga0373925_0023777
448 Ga0373925_0148436
449 Ga0373925_1275071
450 Ga0436364_0028637
451 Ga0436364_0305898
452 Ga0436364_0454682
453 Ga0436364_0727265
454 Ga0436364_0741160
455 Ga0436364_0791399
456 Ga0436364_0807686
457 Ga0436364_1012724
458 Ga0436364_1070118
459 Ga0436364_1213552
460 Ga0436364_1439493
461 Ga0400484_01201
462 Ga0400490_04814
463 Ga0400491_16584
464 Ga0400488_51583
465 Ga0400486_24887
466 Ga0400483_025491
467 Ga0400483_056119
468 Ga0400483_157269
469 Ga0400483_215676
470 Ga0400483_254928
471 Ga0400487_08115
472 Ga0400487_26883
473 Ga0400487_44429
474 Ga0400487_52381
475 Ga0436365_0541822
476 Ga0436365_0890239
477 Ga0436365_1501287
478 Ga0436360_0142058
479 Ga0436360_0225066
480 Ga0436360_0242326
481 Ga0436360_0337114
482 Ga0436360_0347370
483 Ga0436360_0591531
484 Ga0436361_0116671
485 Ga0436361_0253120
486 Ga0436361_0282139
487 Ga0436361_0538563
488 Ga0436361_0910727
489 Ga0436361_0930250
490 Ga0436361_0952936
491 Ga0436361_1049620
492 Ga0436361_1116824
493 Ga0436363_0785570
494 Ga0436363_0864422
495 Ga0436363_1019408
496 Ga0436363_1208704
497 Ga0436362_0843464
498 Ga0450923_034598
499 Ga0466964_0226571
500 Ga0466968_0174144
501 Ga0466960_0172157
502 Ga0451576_1250662
503 Ga0495592_0076276
504 Ga0495629_0278702
505 Ga0495651_0021946
506 Ga0495651_0409574
507 Ga0495653_0110144
508 Ga0495580_0382798
509 Ga0495582_0222385
510 Ga0495639_0492373
511 Ga0495664_0026132
512 Ga0495608_0050948
513 Ga0495608_0064319
514 Ga0495608_0130169
515 Ga0495618_0186246
516 Ga0495618_0279803
517 Ga0495643_0013100
518 Ga0495640_0180961
519 Ga0495640_0224945
520 Ga0495587_0252918
521 Ga0495645_0023344
522 Ga0495645_0074780
523 Ga0495667_0209983
524 Ga0495635_0393658
525 Ga0495657_0171425
526 Ga0495599_0049714
527 Ga0495599_0175310
528 Ga0495623_0065835
529 Ga0495658_0117582
530 Ga0495613_0121218
531 Ga0495600_0178146
532 Ga0495581_0344621
533 Ga0495604_0018130
534 Ga0495674_0096836
535 Ga0495674_0290596
536 Ga0495680_0018421
537 Ga0495675_0013697
538 Ga0495684_0099292
539 Ga0495684_0243574
540 Ga0495686_0064460
541 Ga0495602_0003660
542 Ga0495602_0090895
543 Ga0495602_0268424
544 Ga0496103_0571486
545 Ga0496104_0215225
546 Ga0496109_0330510
547 Ga0496110_0767624
548 Ga0496112_0694170
549 Ga0496113_0247280
550 Ga0496117_0129894
551 Ga0496118_0112541
552 Ga0496126_0000029
553 Ga0496126_0093514
554 Ga0501033_0228436
555 Ga0501034_0200766
556 Ga0501036_0123902
557 Ga0501040_0257600
558 Ga0501041_0274542
559 Ga0501047_0337098
560 Ga0501048_0108075
561 Ga0501069_0128595
562 Ga0501070_0091754
563 Ga0501070_0195573
564 Ga0501076_0831485
565 Ga0501080_1045925
566 Ga0501263_006786
567 Ga0501044_1054625
568 nmdc:mga00v17_124356_c1
569 nmdc:mga0qj67_152598_c1
570 nmdc:mga0sz30_104431_c1
571 Ga0495601_0032418
572 Ga0495601_0257429
573 Ga0495601_0515891
574 Ga0495612_0012190
575 Ga0495595_0055833
576 Ga0495595_0102212
577 Ga0495595_0332048
578 Ga0495619_0151928
579 Ga0500578_0068786
580 Ga0500643_003385
581 Ga0500559_0001746
582 Ga0500661_000173
583 Ga0587084_013706
584 Ga0587073_0021761
585 Ga0587083_0032712
586 Ga0587075_042106
587 Ga0587076_091870
588 Ga0587111_0129512
589 Ga0466962_0046484
590 Ga0530510_0338855
591 2512643639
592 2842336715
593 2842776875
594 2883577556
595 2929204522
596 8055916315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

27

139

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9801 4 160
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9656 3 152
3iwt-assembly1.cif.gz_A structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii 0.9548 6 152
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9476 4 171
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9203 4 171
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9742 4 160 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9587 3 152 3.40.980.10
2pjkA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9545 6 152 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9256 7 152 3.40.980.10
af_A0A1D6DUY2_88_206_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9124 6 97 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A017HJD4-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9855 3 170 GO:0005829
GO:0006777
AF-A0A7U4J719-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9854 3 171 GO:0005829
GO:0006777
AF-A0A6N1DPE1-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9851 1 171 GO:0005829
GO:0006777
AF-A0A4Q3AFE3-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.985 3 171 GO:0005829
GO:0006777
AF-A0A7S6N3S0-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9848 1 171 GO:0005829
GO:0006777

Map